Basic Information | |
---|---|
Family ID | F040312 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 162 |
Average Sequence Length | 44 residues |
Representative Sequence | ARTAAWRGARASKLCIFNFVIVVLSFTVVNLYLSQSHRYF |
Number of Associated Samples | 141 |
Number of Associated Scaffolds | 162 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 88.27 % |
Associated GOLD sequencing projects | 132 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.383 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.753 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.309 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.383 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 162 Family Scaffolds |
---|---|---|
PF05201 | GlutR_N | 80.25 |
PF01379 | Porphobil_deam | 7.41 |
PF02602 | HEM4 | 2.47 |
PF00202 | Aminotran_3 | 1.23 |
PF03900 | Porphobil_deamC | 1.23 |
PF01488 | Shikimate_DH | 1.23 |
PF00697 | PRAI | 0.62 |
PF07715 | Plug | 0.62 |
PF13751 | DDE_Tnp_1_6 | 0.62 |
PF00490 | ALAD | 0.62 |
PF16576 | HlyD_D23 | 0.62 |
COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
---|---|---|---|
COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 80.25 |
COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 8.64 |
COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 2.47 |
COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 0.62 |
COG0135 | Phosphoribosylanthranilate isomerase | Amino acid transport and metabolism [E] | 0.62 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.38 % |
Unclassified | root | N/A | 0.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_16603453 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
3300000721|JGI12410J11868_105001 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300000912|JGI12032J12867_1013608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
3300001471|JGI12712J15308_10072702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
3300002562|JGI25382J37095_10092102 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300002886|JGI25612J43240_1063971 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300002917|JGI25616J43925_10069553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1490 | Open in IMG/M |
3300003219|JGI26341J46601_10142242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
3300004080|Ga0062385_10516680 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300004152|Ga0062386_100785159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
3300004635|Ga0062388_101418932 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300005434|Ga0070709_10086174 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
3300005445|Ga0070708_101960074 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005542|Ga0070732_10896100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
3300005555|Ga0066692_10798864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300005557|Ga0066704_10955921 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005921|Ga0070766_10550187 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300005952|Ga0080026_10198962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300006102|Ga0075015_100613322 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300006172|Ga0075018_10151783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1069 | Open in IMG/M |
3300006176|Ga0070765_101231850 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300006804|Ga0079221_10025320 | All Organisms → cellular organisms → Bacteria | 2460 | Open in IMG/M |
3300006806|Ga0079220_11281360 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300006903|Ga0075426_10629928 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300009088|Ga0099830_10583316 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300009089|Ga0099828_10148880 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
3300009089|Ga0099828_11847446 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300009101|Ga0105247_10117353 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
3300009698|Ga0116216_10599466 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300009760|Ga0116131_1033763 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
3300010048|Ga0126373_10250363 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300010333|Ga0134080_10614687 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300010359|Ga0126376_10340741 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
3300010360|Ga0126372_11754555 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300010360|Ga0126372_11765384 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300010361|Ga0126378_11211674 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300010376|Ga0126381_103584323 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300011120|Ga0150983_14825340 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300011271|Ga0137393_11504335 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300012096|Ga0137389_11153062 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300012096|Ga0137389_11202089 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300012189|Ga0137388_10428450 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300012200|Ga0137382_11317892 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300012203|Ga0137399_10124793 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
3300012203|Ga0137399_10248408 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300012203|Ga0137399_10802943 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300012205|Ga0137362_11453250 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300012206|Ga0137380_11433535 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300012210|Ga0137378_11055607 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300012349|Ga0137387_11154109 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012683|Ga0137398_10736934 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300012918|Ga0137396_10290619 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300012918|Ga0137396_10354406 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300012922|Ga0137394_10298588 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300012923|Ga0137359_10649043 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300012925|Ga0137419_10660720 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300012925|Ga0137419_11099993 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300012929|Ga0137404_10077921 | All Organisms → cellular organisms → Bacteria | 2621 | Open in IMG/M |
3300012929|Ga0137404_11449715 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300012930|Ga0137407_12334830 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300014495|Ga0182015_10848662 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300015053|Ga0137405_1049277 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
3300015197|Ga0167638_1091144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300015242|Ga0137412_10359344 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300016404|Ga0182037_11081444 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300017926|Ga0187807_1064961 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300017934|Ga0187803_10034597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2006 | Open in IMG/M |
3300017961|Ga0187778_10984429 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300017973|Ga0187780_10882969 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300018007|Ga0187805_10001442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8759 | Open in IMG/M |
3300018007|Ga0187805_10437927 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300018037|Ga0187883_10431216 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300018044|Ga0187890_10858452 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300018058|Ga0187766_10706415 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300018086|Ga0187769_10752401 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300018088|Ga0187771_11459382 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300018468|Ga0066662_10192456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1602 | Open in IMG/M |
3300018468|Ga0066662_11103874 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300020001|Ga0193731_1076260 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300020021|Ga0193726_1073061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1592 | Open in IMG/M |
3300020140|Ga0179590_1167786 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300020579|Ga0210407_11047708 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300020583|Ga0210401_10081776 | All Organisms → cellular organisms → Bacteria | 3040 | Open in IMG/M |
3300021088|Ga0210404_10735166 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300021088|Ga0210404_10795523 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300021168|Ga0210406_10743315 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300021178|Ga0210408_10321498 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300021178|Ga0210408_10675294 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300021180|Ga0210396_10452443 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300021180|Ga0210396_10535396 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300021384|Ga0213876_10416912 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300021401|Ga0210393_10941534 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300021403|Ga0210397_10281007 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300021406|Ga0210386_11477539 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300021432|Ga0210384_10041653 | All Organisms → cellular organisms → Bacteria | 4213 | Open in IMG/M |
3300021433|Ga0210391_10290497 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
3300021433|Ga0210391_10670684 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300021479|Ga0210410_10179045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 1896 | Open in IMG/M |
3300021559|Ga0210409_10222270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1715 | Open in IMG/M |
3300023075|Ga0224520_1126629 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300024323|Ga0247666_1108098 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300024330|Ga0137417_1476252 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
3300025501|Ga0208563_1042207 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300025916|Ga0207663_10358202 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300025922|Ga0207646_11876057 | Not Available | 511 | Open in IMG/M |
3300026318|Ga0209471_1213864 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300026360|Ga0257173_1023413 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300026361|Ga0257176_1052872 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300026524|Ga0209690_1214506 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300026532|Ga0209160_1357975 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300027381|Ga0208983_1053905 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300027502|Ga0209622_1027639 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300027616|Ga0209106_1130820 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300027645|Ga0209117_1089687 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300027648|Ga0209420_1195227 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300027660|Ga0209736_1162530 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300027671|Ga0209588_1031228 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
3300027674|Ga0209118_1077857 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300027725|Ga0209178_1197382 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300027765|Ga0209073_10294417 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300027767|Ga0209655_10127821 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300027824|Ga0209040_10074066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1985 | Open in IMG/M |
3300027846|Ga0209180_10559516 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300027867|Ga0209167_10419945 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300027875|Ga0209283_10929692 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300027898|Ga0209067_10879760 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300027898|Ga0209067_10947980 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300027905|Ga0209415_10664736 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300027908|Ga0209006_10167415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1922 | Open in IMG/M |
3300030019|Ga0311348_11333877 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300030737|Ga0302310_10359201 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300030991|Ga0073994_12321374 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300031057|Ga0170834_109561774 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300031128|Ga0170823_15127444 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300031234|Ga0302325_12038245 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300031236|Ga0302324_103332275 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300031446|Ga0170820_13006829 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300031546|Ga0318538_10327734 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300031573|Ga0310915_10080796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2161 | Open in IMG/M |
3300031720|Ga0307469_10097160 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
3300031753|Ga0307477_10799873 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300031754|Ga0307475_10050237 | All Organisms → cellular organisms → Bacteria | 3129 | Open in IMG/M |
3300031754|Ga0307475_10301417 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300031754|Ga0307475_10481473 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300031754|Ga0307475_10912915 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300031778|Ga0318498_10239119 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300031823|Ga0307478_10016095 | All Organisms → cellular organisms → Bacteria | 5212 | Open in IMG/M |
3300031890|Ga0306925_10178416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2288 | Open in IMG/M |
3300031890|Ga0306925_10490206 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300031896|Ga0318551_10859775 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031942|Ga0310916_10572757 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300031962|Ga0307479_11464003 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300032001|Ga0306922_11549417 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300032174|Ga0307470_10615372 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300032180|Ga0307471_101617801 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300032205|Ga0307472_101577472 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300032261|Ga0306920_104440959 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300032770|Ga0335085_10259023 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
3300032897|Ga0335071_10030971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5322 | Open in IMG/M |
3300032955|Ga0335076_10086836 | All Organisms → cellular organisms → Bacteria | 3062 | Open in IMG/M |
3300032955|Ga0335076_10390045 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300032955|Ga0335076_10769446 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.05% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.79% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.09% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.09% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.09% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.47% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.47% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.47% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.85% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.23% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.23% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.23% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.23% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.23% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.62% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.62% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.62% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.62% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000721 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 | Environmental | Open in IMG/M |
3300000912 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300023075 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_02758600 | 2088090014 | Soil | PGWRGARASQLCIFNFAIVIFSFTVVNLFFSRAHRYF |
JGI12410J11868_1050011 | 3300000721 | Tropical Forest Soil | VLYAIYFQLARTAAWRGARASKLCVFNFALVILSFTVVNLYLSQHHRYF* |
JGI12032J12867_10136081 | 3300000912 | Forest Soil | LLVLALYVLYFRLARTTAWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF* |
JGI12712J15308_100727022 | 3300001471 | Forest Soil | LFLYLLYFQLARSTAWRGARASKLCVFNFFVVVMSFTVVNLYLSHSHRYF* |
JGI25382J37095_100921021 | 3300002562 | Grasslands Soil | LVLALYVLYFRLAGTAAWRGARASKXCIFNFVIVVLSFTVVNLXLSHSHRYF* |
JGI25612J43240_10639711 | 3300002886 | Grasslands Soil | AYFQLARTTAWRGARASKLCVFNFVLVVLSFTVVNLYFSSHHRYF* |
JGI25616J43925_100695531 | 3300002917 | Grasslands Soil | LYALYFRLARTTAWRGGRASKLCIFNFVIVVLSFTVVNLYLSHSHRYF* |
JGI26341J46601_101422422 | 3300003219 | Bog Forest Soil | ARTAAWRGARASKLCIFNFVIVVLSFTVVNLYLSQSHRYF* |
Ga0062385_105166802 | 3300004080 | Bog Forest Soil | RTTAWRGARASMLCVFNFVLVVLSFTVVNLYFSQHHRYF* |
Ga0062386_1007851592 | 3300004152 | Bog Forest Soil | LVLFLYVLYLRLSRTTAWRGGRASKLCVFNFAVVVLSFTVVNLYLSHSHRYF* |
Ga0062388_1014189321 | 3300004635 | Bog Forest Soil | YFQLARSTAWRGARASRLCVFNFVLVVLSFTVVNLYFSPHHRYF* |
Ga0070709_100861743 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | YFRLARTAAWRGARASRLCVFNFVLVILNFAVVNLFFSQSHRYF* |
Ga0070708_1019600741 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ARNPGWRGARASQLCIFNFAIVIFSFTVVNLFFSRSHRYF* |
Ga0070732_108961002 | 3300005542 | Surface Soil | LSRTSNWRGARASRLNIFNFAVVILSFTVVNLYLSHSHRYF* |
Ga0066692_107988641 | 3300005555 | Soil | ALYALYFRLARTTAWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF* |
Ga0066704_109559211 | 3300005557 | Soil | LFVLLLYALYFRLARTATWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF* |
Ga0070766_105501871 | 3300005921 | Soil | WVARTAAWRGARASKLCVFNFVVVILSFTVVNFYLSQSHRYF* |
Ga0080026_101989622 | 3300005952 | Permafrost Soil | VITLVVLFLYLLYFQLARTTAWRGARASKLCVFNFFVVVMSFTVVNLYLSHSHRYF* |
Ga0075015_1006133222 | 3300006102 | Watersheds | YFQLARTTAWRGARASKLCVFNFVLVVLSFTVVNLYFSAHHRYF* |
Ga0075018_101517831 | 3300006172 | Watersheds | IYLRLSRTASWRGPRASRLCIFNFAVVILSFTVVNLYLSHSHRYF* |
Ga0070765_1012318502 | 3300006176 | Soil | YFQLARTASWRGARASRLCIFNFFVVVMSFTVVNLYLSQSHRYF* |
Ga0079221_100253204 | 3300006804 | Agricultural Soil | YFRLARTASWRGARASKLCIFNFFVVVMSFTVVNLYLSQSHRYF* |
Ga0079220_112813602 | 3300006806 | Agricultural Soil | LVLYTVYFQLAKSATWRGARASKLCIFNFAVVVMSFTVVNLYLSQSHRYF* |
Ga0075426_106299281 | 3300006903 | Populus Rhizosphere | AAYLFLARSAAWRGARASKLCVFNFLLVIFSFTAVNLFFSHAHRYF* |
Ga0099830_105833162 | 3300009088 | Vadose Zone Soil | YFRLARTTAWRGARASKLCIFNFAVVVLSFTVVNLYLSHSHRYF* |
Ga0099828_101488803 | 3300009089 | Vadose Zone Soil | ALYAAYFQLSRTTSWRGARASRLCIFNFVIVILSFTVVNFYLSHSHRYF* |
Ga0099828_118474462 | 3300009089 | Vadose Zone Soil | YAVYLQLSRTTRWRGARASRLNIFNFVVVILSFTVVNLYLSHSHRYF* |
Ga0105247_101173531 | 3300009101 | Switchgrass Rhizosphere | LSYAYLRLARTASWRGPRASRLCIFNFVVVILSFTVVNLYLSHSHRYF* |
Ga0116216_105994661 | 3300009698 | Peatlands Soil | RTAAWRGARASKLCVFNFVLVVVNFWVVNLFFSQHHRYF* |
Ga0116131_10337633 | 3300009760 | Peatland | FRLARTAAWRGARASKLCVLNFVLVVVNFWVVNLFFSQHHRYF* |
Ga0126373_102503631 | 3300010048 | Tropical Forest Soil | RTTAWRGARASKLCVFNFVIVFLSFTVVNFYLSHSHRYF* |
Ga0134080_106146871 | 3300010333 | Grasslands Soil | VFYLRLARNPSWRGARASQLCIFNFAIVIFSFTVVNLFFSRSHRYF* |
Ga0126376_103407412 | 3300010359 | Tropical Forest Soil | LILYAAYFRLARTTVWRGARASKLCVFNFLIIFLSFTVVNLYLSPHHRFF* |
Ga0126372_117545552 | 3300010360 | Tropical Forest Soil | TAWRGARASKLCVFNFVVVFLSFTVVNLYLSHSHRYF* |
Ga0126372_117653842 | 3300010360 | Tropical Forest Soil | AWRGARASKLCVFNFILVIFSFTAVNLFFSHVHRYF* |
Ga0126378_112116741 | 3300010361 | Tropical Forest Soil | TTAWRGARASKLCVFNFVIVFLSFTVVNFYLSHSHRYF* |
Ga0126381_1035843232 | 3300010376 | Tropical Forest Soil | LARTAVWRGARASLLCVFNFVLVVLSFTVVNLYFSQHHKYF* |
Ga0150983_148253401 | 3300011120 | Forest Soil | RLARKTAWQGARACKLCIFNFAVVVLSFTVVNFYVSHSHRYF* |
Ga0137393_115043352 | 3300011271 | Vadose Zone Soil | AAYLQLSRTTSWRGARASRLCIFNFVIVILSFTVVNLYLSHSHRYF* |
Ga0137389_111530622 | 3300012096 | Vadose Zone Soil | GWRGARASQLCIFNFAIVIFSFTVVNLFFSHAHRYF* |
Ga0137389_112020891 | 3300012096 | Vadose Zone Soil | TLLVLLLYVLYFRLARTATWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF* |
Ga0137388_104284502 | 3300012189 | Vadose Zone Soil | LLLYVVYFRLARTTAWRGARASRLCVFNFVVVILSFTVVNLYLSQYHRFF* |
Ga0137382_113178922 | 3300012200 | Vadose Zone Soil | YVSYLRLARNPSWRVARASQLCIFNFAIVIFSFTVVNLFFSHAHRYF* |
Ga0137399_101247931 | 3300012203 | Vadose Zone Soil | LYFRLAGTAAWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF* |
Ga0137399_102484081 | 3300012203 | Vadose Zone Soil | TAWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF* |
Ga0137399_108029432 | 3300012203 | Vadose Zone Soil | LAKTATWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF* |
Ga0137362_114532501 | 3300012205 | Vadose Zone Soil | VVYFRLARTTAWRGARASRLCIFNFVVVVLSFTVVNLYLSHSHRYF* |
Ga0137380_114335352 | 3300012206 | Vadose Zone Soil | AWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF* |
Ga0137378_110556072 | 3300012210 | Vadose Zone Soil | YVAYFRLARTTAWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF* |
Ga0137387_111541092 | 3300012349 | Vadose Zone Soil | VVTLLVLLLYVLYFRLARTATWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF* |
Ga0137398_107369341 | 3300012683 | Vadose Zone Soil | AYLQLSRTTTWRGARASRLCIFNFVIVVLSFTVVNLYLSHSHRYF* |
Ga0137396_102906192 | 3300012918 | Vadose Zone Soil | LLYVLYFRLARTATWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF* |
Ga0137396_103544062 | 3300012918 | Vadose Zone Soil | TLFVLLLYVLYFRLAKTATWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF* |
Ga0137394_102985882 | 3300012922 | Vadose Zone Soil | VLLLYVLYFRLAKAAAWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF* |
Ga0137359_106490432 | 3300012923 | Vadose Zone Soil | WRGARASQLCIFNFAIVIFSFTVVNLFFSRSHRYF* |
Ga0137419_106607201 | 3300012925 | Vadose Zone Soil | LSRTTSWRGARASRLCIFNFVIVILSFTVVNLYLSHSHRYF* |
Ga0137419_110999931 | 3300012925 | Vadose Zone Soil | YVVTLLVLLLYLLYFRLARTTTWRGARASKLCIFNFVVVVLSFTVVNLYLAHSHRYI* |
Ga0137404_100779211 | 3300012929 | Vadose Zone Soil | YFRLAGTAAWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF* |
Ga0137404_114497152 | 3300012929 | Vadose Zone Soil | VTLFVLLLYVLYFRLARTATWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF* |
Ga0137407_123348301 | 3300012930 | Vadose Zone Soil | RNPSWRGARASQLCIFNFAIVIFSFTVVNLFFSHAHRYF* |
Ga0182015_108486621 | 3300014495 | Palsa | TTWRGARASRLCIFNFVIVVLSFTVVNLYLSHSHRYF* |
Ga0137405_10492771 | 3300015053 | Vadose Zone Soil | AAGIGVVRALLYALYFRLAGTAAWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF* |
Ga0167638_10911441 | 3300015197 | Glacier Forefield Soil | YLLYFQLARTTAWRGARASKLCVFNFFVVVLSFTVVNLYLSHSHRYF* |
Ga0137412_103593441 | 3300015242 | Vadose Zone Soil | LARTTAWRGARASKLCVFNFFVVVLSFTVVNLYLSHSHRYF* |
Ga0182037_110814441 | 3300016404 | Soil | TAAWRGARASKLCVFNFVLVVLSFTVVNLYFSQHHRYF |
Ga0187807_10649612 | 3300017926 | Freshwater Sediment | YFQLARTTAWRGARASKLCVFNFVLVILSFTVVNLYFSQHHRYF |
Ga0187803_100345971 | 3300017934 | Freshwater Sediment | AVYAVYLLLSRTASWRGARASVLCVLSFVLVVLSFTVVNVYLSRSHRFF |
Ga0187778_109844292 | 3300017961 | Tropical Peatland | AAWRGARASKLCVFNFVLVVLSFTVVNLYLSPHHRYF |
Ga0187780_108829692 | 3300017973 | Tropical Peatland | LYAAYLLIGRSANWRGARASRFCVFNFAVVILSFTVVNLFLTKAHRYF |
Ga0187805_100014429 | 3300018007 | Freshwater Sediment | VVLLLYVVYFQLARTASWRGARASKLCIFNFFVVVMSFTVVNLYLSQSHRYF |
Ga0187805_104379272 | 3300018007 | Freshwater Sediment | MYVAYFRLSRTAAWRGARASKLCVFNFVLVVLSFTVVNLYFSQHHRYF |
Ga0187883_104312161 | 3300018037 | Peatland | TAAWRGARASKLCVFNFVLVVVNFWVVNLFFSQHHRYF |
Ga0187890_108584522 | 3300018044 | Peatland | AWRGARASKLCVFNFVLVVVNFWVVNLFFSQHHRYF |
Ga0187766_107064151 | 3300018058 | Tropical Peatland | FQLARTAAWRGARASKLCVFNFVLVILSFTVVNLYFSQHHRYF |
Ga0187769_107524011 | 3300018086 | Tropical Peatland | TTAWRGARASKLCIFNFVIVFLSFTVVNLYLSHNHRFF |
Ga0187771_114593822 | 3300018088 | Tropical Peatland | RTAAWRGARASRLCVFNFFLVVVNFWVVNLFFSQHHRYF |
Ga0066662_101924563 | 3300018468 | Grasslands Soil | RTTAWRGARASRLCIFNFVVVVLSFTVVNLYLSHSHRYF |
Ga0066662_111038742 | 3300018468 | Grasslands Soil | WRGARASQLCIFNFAIVIFSFTVVNLFFSRSHRYF |
Ga0193731_10762601 | 3300020001 | Soil | VLFLYLLYFQLARTTAWRGARASRLCVFNFFVVVASFTVVNLYLSHTHRYF |
Ga0193726_10730613 | 3300020021 | Soil | NPGWRGARASQLCIFNFAIVIFSFTVVNLFFSRAHRYF |
Ga0179590_11677862 | 3300020140 | Vadose Zone Soil | FQLARTTAWRGARASKLCVFNFVLVVLSFTVVNLYFSSHHRYF |
Ga0210407_110477081 | 3300020579 | Soil | RTTAWRGARASKLNVFNFGVVVLSFTVVNFYFSHSHRYF |
Ga0210401_100817761 | 3300020583 | Soil | LLVLFLYVLYLRLSRTTAWRGGRASKLCVFNFAIVVLSFTVVNLYLSHSHRYF |
Ga0210404_107351662 | 3300021088 | Soil | VVVVLLYAVYWLLARTTAWRGVRASRLCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0210404_107955232 | 3300021088 | Soil | TAWRGARASKLNVFNFGVVVLSFTVVNFYFSHSHRYF |
Ga0210406_107433152 | 3300021168 | Soil | LARNPGWRGARASQLCIFNFAIVIFSFTVVNLFLSHAHRYF |
Ga0210408_103214982 | 3300021178 | Soil | GAAAWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0210408_106752941 | 3300021178 | Soil | YLQLSRTTSWRGARASRLCIFNFVIVILSFTVVNLYLSHSHRYF |
Ga0210396_104524431 | 3300021180 | Soil | AWRGARASKLCVFNFVLVVLSFTVVNLFLSAHHRYF |
Ga0210396_105353962 | 3300021180 | Soil | RTTAWRGARASKLCVFNFVLVVLSFTVVNLYFSAHHRYF |
Ga0213876_104169121 | 3300021384 | Plant Roots | AAYWLLARTTTWRGARASLFCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0210393_109415341 | 3300021401 | Soil | LMLYAVYWLLSRTTTWRGVRASRLCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0210397_102810071 | 3300021403 | Soil | FRLARTASWRGARASKLCIFNFVLVVLSFTVVNLYLSHSHRYF |
Ga0210386_114775391 | 3300021406 | Soil | TAAWRGARASRLCVFNFVLVILNFAVVNLFFSQSHRYF |
Ga0210384_100416531 | 3300021432 | Soil | TWRGARASRLCIFNFVVVILSFTVVNLYLSHTHRYF |
Ga0210391_102904972 | 3300021433 | Soil | RTTTWRGARASRLCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0210391_106706841 | 3300021433 | Soil | KYVITLVVLFLYLLYFQLARSTAWRGARASKLCVFNFFVVVMSFTVVNLYLSHSHRYF |
Ga0210410_101790451 | 3300021479 | Soil | LLLYLVYFQLARTASWRGARASRLCIFNFFVVVMSFTVVNLYLSQSHRYF |
Ga0210409_102222701 | 3300021559 | Soil | ARTTAWRGARASKLCVFNFFVVVMSFTVVNLYLSHSHRYF |
Ga0224520_11266292 | 3300023075 | Soil | YFRLARTAAWRGARASKLCVFNFVLVVVNFWVVNLFFSQHHRYF |
Ga0247666_11080981 | 3300024323 | Soil | YAAYFQLARTTAWRGARASKLCVFNFVLVVLSFTVVNLYFSTHHRYF |
Ga0137417_14762524 | 3300024330 | Vadose Zone Soil | LYALYFRLARTTVWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0208563_10422071 | 3300025501 | Peatland | AAWRGARASKLCVFNFVLVVVNFWVVNLFFSQHHRYF |
Ga0207663_103582022 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ARTAAWRGARASRLCVFNFVLVILNFAVVNLFFSQSHRYF |
Ga0207646_118760572 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RSATWRGARASKLCIFNFGIVVLSFTVVNFYLSHSHRYF |
Ga0209471_12138641 | 3300026318 | Soil | LARNPGWRGARASQLCIFNFAIVIFSFTVVNLFFSRAHRYF |
Ga0257173_10234131 | 3300026360 | Soil | YVVTLLVLLLYVLYFRLARTATWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF |
Ga0257176_10528721 | 3300026361 | Soil | ALYVLYFRLARTTGWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0209690_12145061 | 3300026524 | Soil | VLALYALYFRLARTTAWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0209160_13579752 | 3300026532 | Soil | FLARSAAWRGARASKLCVFNFLLVIFSFTAVNLFFSHSHRYF |
Ga0208983_10539052 | 3300027381 | Forest Soil | FVLLLYVLYFRLARTATWRGARASKLCIFNFAVVVLSFTVVNLYLSHSHRYF |
Ga0209622_10276392 | 3300027502 | Forest Soil | TTAWRGARASKLCVFNFVLVVLSFTVVNLYFSQHHRYF |
Ga0209106_11308201 | 3300027616 | Forest Soil | TTAWRGARASKLCVFNFFVVVLSFTVVNLYLSHSHRYF |
Ga0209117_10896871 | 3300027645 | Forest Soil | AYLQLSRTTSWRGARASRLCIFNFVIVILSFTVVNLYLSHSHRYF |
Ga0209420_11952272 | 3300027648 | Forest Soil | KYVVTLFVVLLYAIYWLLSRTTAWRGVRASRLCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0209736_11625302 | 3300027660 | Forest Soil | TGWRGARASKLCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0209588_10312283 | 3300027671 | Vadose Zone Soil | RTTSWRGARASRLCIFNFVIVILSFTVVNLYLSHSHRYF |
Ga0209118_10778572 | 3300027674 | Forest Soil | TATWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF |
Ga0209178_11973822 | 3300027725 | Agricultural Soil | YFRLARTASWRGARASKLCIFNFFVVVMSFTVVNLYLSQSHRYF |
Ga0209073_102944172 | 3300027765 | Agricultural Soil | LLYVVYFRLARTASWRGARASKLCIFNFFVVVMSFTVVNLYLSQSHRYF |
Ga0209655_101278212 | 3300027767 | Bog Forest Soil | LYAVYFFVARTAAWRGARASKFCVFNFVIVILSFTVVNLYLSQSHRYF |
Ga0209040_100740663 | 3300027824 | Bog Forest Soil | VAYFQLARTAAWRGARASKLCVFNFVLVVLSFTVVNLYFSQHHRYF |
Ga0209180_105595162 | 3300027846 | Vadose Zone Soil | AVYGAYFLLGRSSSWRGARASALCVFNFVFVMLSYTVVNLYLSHYHRYF |
Ga0209167_104199451 | 3300027867 | Surface Soil | SASWRGARASKLCIFNFFVVVMSFTVVNLYLSQSHRYF |
Ga0209283_109296921 | 3300027875 | Vadose Zone Soil | VYFRLARTTAWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF |
Ga0209067_108797601 | 3300027898 | Watersheds | FHLARTTAWRGARASKLCVFNFVLVVLSFTVVNLYFSAHHRYF |
Ga0209067_109479801 | 3300027898 | Watersheds | VLYVIYFRLARTAAWRGARASKLCIFNFAIVVLSFTVVNLYLSHSHRYF |
Ga0209415_106647362 | 3300027905 | Peatlands Soil | VYFRLARTAAWRGARASKLCVLNFVLVVVNFWVVNLFFSQHHRYF |
Ga0209006_101674151 | 3300027908 | Forest Soil | AWRGARASKLCVFNFVLVVLSFTVVNLYFSAHHRYF |
Ga0311348_113338772 | 3300030019 | Fen | TTAWRGARASRLCVFNFALVILSFTVVNLFLSPHHRFL |
Ga0302310_103592011 | 3300030737 | Palsa | LVLLLYAVYFFVSRTAAWRGARASKFCIFNFVIVILSFTVVNLYISHSHRYF |
Ga0073994_123213741 | 3300030991 | Soil | TWRGARASRLCIFNFVVVILSFTVVNLYLSHAHRYF |
Ga0170834_1095617742 | 3300031057 | Forest Soil | AFYLRMARYPAWRGARASQLCIFNFAIVIFSFTVVNLFFSRAHRYF |
Ga0170823_151274441 | 3300031128 | Forest Soil | RNPSWRGARASQLCIFNFAIVIFSFTVVNLFFSHAHRYF |
Ga0302325_120382451 | 3300031234 | Palsa | ARTAAWRGARASKFCIFNFVIVILSFTVVNLYLSQSHRYF |
Ga0302324_1033322752 | 3300031236 | Palsa | WRGARASKFCIFNFVIVILSFTVVNLYLSQSHRYF |
Ga0170820_130068292 | 3300031446 | Forest Soil | WRGARASQLCIFNFAIVIFSFTIVNLFFSRAHRYF |
Ga0318538_103277341 | 3300031546 | Soil | RTAAWRGARASKLCVFNFVLVVLSFTVVNLYFSQHHRYF |
Ga0310915_100807961 | 3300031573 | Soil | FQLARTAAWRGARASKLCVFNFVLVVLSFTVVNLYFSQHHRYF |
Ga0307469_100971601 | 3300031720 | Hardwood Forest Soil | YLRLARNPSWRGARASQLCIFNFAIVIFSFTVVNLFFSHAHRYF |
Ga0307477_107998732 | 3300031753 | Hardwood Forest Soil | YLLYFGLARTTAWRGGRASKLCIFNFVIVVLSFTVVNLYLSHSHRYF |
Ga0307475_100502371 | 3300031754 | Hardwood Forest Soil | TSWRGARASRLCIFNFVIVILSFTVVNLYLSHSHRYF |
Ga0307475_103014171 | 3300031754 | Hardwood Forest Soil | YLQLSRTTTWRGARASRLCIFNFVIVILSFTVVNLYLSHSHRYF |
Ga0307475_104814731 | 3300031754 | Hardwood Forest Soil | SYAVYFRLARTTGWRGARASKLCVLNFLIVFLSFTVVNFYFSPSHRFF |
Ga0307475_109129151 | 3300031754 | Hardwood Forest Soil | RTTGWRGARASKLCIFNFAIVVLSFTVVNLYLSHSHRYF |
Ga0318498_102391192 | 3300031778 | Soil | ARTAAWRGARASKLCVFNFVLVVLSFTVVNLYFSQHHRYF |
Ga0307478_100160951 | 3300031823 | Hardwood Forest Soil | YAIYFQLSRTTAWRGARASRLCVFNFFLVVFSFTVVNLYLSHSHRYF |
Ga0306925_101784163 | 3300031890 | Soil | WRGARASKLCVFNFVLVVLSFTVVNLYFSQHHRYF |
Ga0306925_104902061 | 3300031890 | Soil | VVYYLLARTAAWRGARASLLCVFNFLLVLLSFTVVNYISPNHRYF |
Ga0318551_108597751 | 3300031896 | Soil | AWRGARASLLCVFNFLLVLLSFTVVNYISPNHRYF |
Ga0310916_105727571 | 3300031942 | Soil | RLARTAAWRGARASKLCVFNFVLVVLSFTVVNLFLTQHHRYF |
Ga0307479_114640031 | 3300031962 | Hardwood Forest Soil | TWRGARASKLCVFNFVIVVLNFTVVGFFLSHSHRYF |
Ga0306922_115494171 | 3300032001 | Soil | ARTAAWRGARASRFCVFNFVLVVLSFTVVNLYFSPHHKYF |
Ga0307470_106153722 | 3300032174 | Hardwood Forest Soil | WRGARASQLCIFNFVIVIFSFTVVNLFFSHAHRYF |
Ga0307471_1016178012 | 3300032180 | Hardwood Forest Soil | RLARTATWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF |
Ga0307472_1015774722 | 3300032205 | Hardwood Forest Soil | LYFRLARSAAWRGARASKLCIFNFVVVVLSFTVVNLYLSHSHRYF |
Ga0306920_1044409591 | 3300032261 | Soil | LYVIYYLLARTAAWRGARASLLCVFNFLLVLLSFTVVNYISPNHRYF |
Ga0335085_102590231 | 3300032770 | Soil | VAYFRLARTAAWRGARASKLCIFNFVLVILSFTVVNLYLSQHHRYF |
Ga0335071_100309711 | 3300032897 | Soil | ASWRGARASKLCVFNFALVILSFTVVNLYFSQHHRYF |
Ga0335076_100868361 | 3300032955 | Soil | FQLARTAAWRGARASKLCVFNFALVILSFTVVNLYLSQHHRYF |
Ga0335076_103900451 | 3300032955 | Soil | LARTAAWRGARASKLCIFNFVVVILNFAVVGYWSHSHRYF |
Ga0335076_107694462 | 3300032955 | Soil | LYVVYLRVAQTALWRGARASILCVFNFILVVLSFTVVNLYLSSHHRYF |
⦗Top⦘ |