NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040128

Metagenome / Metatranscriptome Family F040128

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040128
Family Type Metagenome / Metatranscriptome
Number of Sequences 162
Average Sequence Length 161 residues
Representative Sequence LNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Number of Associated Samples 126
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.59 %
% of genes near scaffold ends (potentially truncated) 80.25 %
% of genes from short scaffolds (< 2000 bps) 98.77 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.75

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.383 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(25.309 % of family members)
Environment Ontology (ENVO) Unclassified
(62.963 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(79.012 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.82%    β-sheet: 0.00%    Coil/Unstructured: 51.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.75
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.250.1.1: IpaD-liked3nfta_3nft0.58561
a.24.2.0: automated matchesd4z9ha_4z9h0.56959
d.128.1.2: Guanido kinase catalytic domaind4am1a24am10.5688
a.24.12.0: automated matchesd7bmla_7bml0.56569
a.24.3.2: Cytochrome c'-liked2ykza_2ykz0.56526

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.38 %
UnclassifiedrootN/A0.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000136|KGI_S1_ANT02_95mDRAFT_c10126913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300005516|Ga0066831_10097748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani794Open in IMG/M
3300005599|Ga0066841_10032046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani832Open in IMG/M
3300006029|Ga0075466_1128625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani666Open in IMG/M
3300006355|Ga0075501_1217248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300006378|Ga0075498_1233220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300006390|Ga0075509_1461835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300006394|Ga0075492_1309827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300006396|Ga0075493_1497186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300006397|Ga0075488_1503851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani725Open in IMG/M
3300006403|Ga0075514_1639271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300006424|Ga0075497_1301941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300006803|Ga0075467_10325526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani813Open in IMG/M
3300007231|Ga0075469_10113229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani755Open in IMG/M
3300007545|Ga0102873_1131826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300007554|Ga0102820_1086291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300007642|Ga0102876_1107549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300007681|Ga0102824_1103100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani749Open in IMG/M
3300007716|Ga0102867_1105028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300007725|Ga0102951_1094982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani847Open in IMG/M
3300008919|Ga0103484_1012146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300009024|Ga0102811_1191863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300009079|Ga0102814_10393228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300009276|Ga0103879_10050474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300009466|Ga0126448_1013043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2055Open in IMG/M
3300009593|Ga0115011_11199930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani654Open in IMG/M
3300009606|Ga0115102_10533623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300009677|Ga0115104_10311959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1101Open in IMG/M
3300009677|Ga0115104_10400278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300009677|Ga0115104_10650432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300009679|Ga0115105_10042203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300010985|Ga0138326_10868325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani615Open in IMG/M
3300010987|Ga0138324_10425526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300012471|Ga0129334_1042908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani633Open in IMG/M
3300012471|Ga0129334_1093920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300012516|Ga0129325_1355191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani794Open in IMG/M
3300012522|Ga0129326_1434953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300012954|Ga0163111_11788577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300012962|Ga0129335_1102002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani623Open in IMG/M
3300016726|Ga0182045_1162176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani597Open in IMG/M
3300016731|Ga0182094_1248027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300016737|Ga0182047_1171263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300016749|Ga0182053_1432789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani542Open in IMG/M
3300016754|Ga0182072_1324049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300016882|Ga0186577_109280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300017735|Ga0181431_1062974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani836Open in IMG/M
3300017782|Ga0181380_1296693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300018565|Ga0188826_116240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300018765|Ga0193031_1062816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300018765|Ga0193031_1070591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani590Open in IMG/M
3300018974|Ga0192873_10369293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani588Open in IMG/M
3300018977|Ga0193353_10229784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300018980|Ga0192961_10137066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300018980|Ga0192961_10153648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300018980|Ga0192961_10161708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani680Open in IMG/M
3300018982|Ga0192947_10169040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300018982|Ga0192947_10216582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300018982|Ga0192947_10224552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300018982|Ga0192947_10267723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani544Open in IMG/M
3300018989|Ga0193030_10151100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300018989|Ga0193030_10153605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani746Open in IMG/M
3300018989|Ga0193030_10159083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani734Open in IMG/M
3300018989|Ga0193030_10163701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300018989|Ga0193030_10163742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani724Open in IMG/M
3300018989|Ga0193030_10168217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300018989|Ga0193030_10194259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300018989|Ga0193030_10200762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300018989|Ga0193030_10215905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300018989|Ga0193030_10236524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300018989|Ga0193030_10251396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300019022|Ga0192951_10272503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani636Open in IMG/M
3300019027|Ga0192909_10101500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300019031|Ga0193516_10181907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300019032|Ga0192869_10397995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300019036|Ga0192945_10186534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani668Open in IMG/M
3300019045|Ga0193336_10351878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani668Open in IMG/M
3300019050|Ga0192966_10168635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani781Open in IMG/M
3300019051|Ga0192826_10178337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani785Open in IMG/M
3300019051|Ga0192826_10296411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani591Open in IMG/M
3300019085|Ga0188830_1015484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300019103|Ga0192946_1049488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300019103|Ga0192946_1060356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani553Open in IMG/M
3300019103|Ga0192946_1062797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300019117|Ga0193054_1036309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani740Open in IMG/M
3300019117|Ga0193054_1036729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300019149|Ga0188870_10096773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani710Open in IMG/M
3300019149|Ga0188870_10116396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300019200|Ga0180036_1044693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300020013|Ga0182086_1280013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani620Open in IMG/M
3300020014|Ga0182044_1237434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300021348|Ga0206695_1172392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani728Open in IMG/M
3300021350|Ga0206692_1287271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300021872|Ga0063132_125343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300021885|Ga0063125_1017442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300021902|Ga0063086_1024161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani705Open in IMG/M
3300021922|Ga0063869_1022913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M
3300021924|Ga0063085_1006530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300021942|Ga0063098_1062200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300021950|Ga0063101_1056371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300021962|Ga0222713_10413842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300021962|Ga0222713_10473413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300021962|Ga0222713_10487770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani739Open in IMG/M
3300023696|Ga0228687_1025801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300023709|Ga0232122_1112033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani623Open in IMG/M
3300024346|Ga0244775_10783634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300025138|Ga0209634_1314226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300025869|Ga0209308_10226301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani815Open in IMG/M
3300025872|Ga0208783_10381712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M
3300025887|Ga0208544_10204967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani813Open in IMG/M
3300025897|Ga0209425_10395152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani663Open in IMG/M
3300026130|Ga0209961_1047607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani844Open in IMG/M
3300026182|Ga0208275_1031318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1101Open in IMG/M
3300026434|Ga0247591_1064974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300026458|Ga0247578_1089460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300026468|Ga0247603_1072804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani701Open in IMG/M
3300026468|Ga0247603_1138148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani505Open in IMG/M
3300026470|Ga0247599_1082427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani675Open in IMG/M
3300026471|Ga0247602_1108715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300026500|Ga0247592_1101605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300026503|Ga0247605_1110483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300027240|Ga0208444_1029312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300027366|Ga0208556_1083116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300027571|Ga0208897_1117479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300027906|Ga0209404_10626104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani721Open in IMG/M
3300028106|Ga0247596_1072667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani773Open in IMG/M
3300028106|Ga0247596_1086309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300028134|Ga0256411_1239234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300028137|Ga0256412_1243169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300028233|Ga0256417_1088865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani834Open in IMG/M
3300028233|Ga0256417_1157271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300028282|Ga0256413_1232700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300028335|Ga0247566_1054287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300030699|Ga0307398_10530061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani650Open in IMG/M
3300030780|Ga0073988_10011854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300030780|Ga0073988_12366284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300030781|Ga0073982_11743688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300030857|Ga0073981_11730557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani694Open in IMG/M
3300030912|Ga0073987_11219311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300031004|Ga0073984_11263346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300031032|Ga0073980_11351143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300031038|Ga0073986_12033187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani578Open in IMG/M
3300031062|Ga0073989_13262402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
3300031522|Ga0307388_10279223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1048Open in IMG/M
3300031522|Ga0307388_10739598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300031522|Ga0307388_10854994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300031626|Ga0302121_10149680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300031710|Ga0307386_10563731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300031710|Ga0307386_10635830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300031725|Ga0307381_10181362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani731Open in IMG/M
3300031725|Ga0307381_10243480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300031738|Ga0307384_10489895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300031738|Ga0307384_10568367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300031739|Ga0307383_10540273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300031743|Ga0307382_10335763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani682Open in IMG/M
3300031743|Ga0307382_10609535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300031750|Ga0307389_10136805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1372Open in IMG/M
3300032521|Ga0314680_10767922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300032708|Ga0314669_10663760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300032746|Ga0314701_10334002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300032752|Ga0314700_10431537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300033572|Ga0307390_10943954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani546Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.31%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine25.31%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.11%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater10.49%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.17%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.47%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.47%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.23%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.23%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.23%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.23%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.62%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.62%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.62%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.62%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.62%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.62%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.62%
Bay WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005599Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91AEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300008919Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NA1EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016726Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016882Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with 33 psu seawater, 19 C, 33 psu salinity and 331 ?mol photons light - Strombidium rassoulzadegani ras09 (MMETSP0449_2)Host-AssociatedOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300018565Metatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dTEnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023709Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027240Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027366Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030781Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S7_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KGI_S1_ANT02_95mDRAFT_1012691313300000136MarineKNMKYSLVLVALLGMTQAATNLNQLKAEPCEEALDVSQEELDIQLDYFSRRLDMKYYENAMKIYSELKKQGKNPKVAIHTFELYDAGFSFPRVRRYDFVNQALEAVQHYQDNLNQNFTNGLHVANFLKAAKATQKSLNDKYHDGEFSDPANFDPLEEHKVTWSNVKL*
Ga0066831_1009774813300005516MarineMKFYTILALVGMATAINQKSVMTLNEPCEPALEVSEKQLYIELDYFSRSFDIKHYNNAIKIYDELKKEGKNPKLFVHSWELYDNAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFIKVAKAAQKALNEKYHDGEFADPSLFDP*
Ga0066841_1003204623300005599MarineLYNIFDKIIMKFIALAAIALFGVSAVTLEHKSAAHLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNFNQNFMNSQHLANFIKVGKSAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI*
Ga0075466_112862513300006029AqueousMKYSLVLVAHLGLTQAINRQSSQTLLQLNDPCEEALDVSVEELNIQLDYFSRRLDMKYYDNAMKIYGELKKQGKDPKVNVHTWELYDASFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFLQVAKAAQKALNEKYHDGEFSDPANFDPLDEHKVTWATVKL*
Ga0075501_121724813300006355AqueousMRFSSLLVAIGVASAASLAQRPIRLSATGEPCEEALEVSPEELAIQLDYFSRRLDIKYYNNAMNIAGELAKQGKHPQLAVHTWELYDKAFSFPRVRRYDFVQERMDEIQHYQDNLNQNFANGLHVKNFLVAAKKAEKELNEKYHDGEFADPANFDPEEDHPVTWSNVKL*
Ga0075498_123322013300006378AqueousSSLLVAIGVASAASLAQRPIRLSATGEPCEEALEVSPEELAIQLDYFSRRLDIKYYNNAMNIAGELAKQGKHPQLAVHTWELYDKAFSFPRVRRYDFVQERMDEIQHYQDNLNQNFANGLHVKNFLVAAKKAEKELNEKYHDGEFADPANFDPEEDHPVTWSNVKL*
Ga0075509_146183513300006390AqueousLLGANQAATVSQHDAKHTLGCDEALEVSEEELGIQLDFLSRRLDVKYYENAMKIYDELKKMGKNPKVSVHTWELYDKAFSFPRVRRYDLVQQHMDLIQHFQDNLNQNFTNSLALTNFLRAAKAAQKDLNTKYHDGEFSDPANFDPTDEHPVTWANVKL*
Ga0075492_130982713300006394AqueousFVNKFVMKYSLVLVALLGLTQAINRQSSQTLLQLNDPCEEALDVSVEELNIQLDYFSRRLDMKYYDNAMKIYGELKKQGKDPKVNVHTWELYDASFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFLQVAKAAQKALNEKYHDGEFSDPANFDPLDEHKVTWATVKL*
Ga0075493_149718613300006396AqueousKFVMKYSLVLVALLGLTQAINRQSSQTLLQLNDPCEEALDVSVEELNIQLDYFSRRLDMKYYDNAMKIYGELKKQGKDPKVNVHTWELYDASFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFLQVAKAAQKALNEKYHDGEFSDPANFDPLDEHKVTWATVKL*
Ga0075488_150385123300006397AqueousMDIELDYFSRTFDEKRYRNAKIIYNALLEKGQHPRVSVHTWQLYDNAFAFPRVRRYDLVQHHMDLIQHMEDNLNQNFTNGQHLANFIQICKAAQTELNAKYHNGEFSDPALFDPEADHPVTWANVKL*
Ga0075514_163927113300006403AqueousMRFSLVLVALLGSTMAATNLNQLRAEPCEEALDVSQEELEIQLDYFSRRLDMKYYQNAMKIYGELKKQGKDPKVDIHTYELYDKAFTFPRVRRYDFVNQQLDSVQHYQDNLNQNFTNGLHVANFLKAAKAAQKALNEKYHDGEFSDPAKFDPQEEHKVTWSNVKL*RTTKSH*
Ga0075497_130194113300006424AqueousYSLVLVALLGLTQAINRQSSQTLLQLNDPCEEALDVSVEELNIQLDYFSRRLDMKYYDNAMKIYGELKKQGKDPKVNVHTWELYDASFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFLQVAKAAQKALNEKYHDGEFSDPANFDPLDEHKVTWATVKL*
Ga0075467_1032552613300006803AqueousMKFSFALVALLGLTQAVTLTQQSVPCEEALEVSEAELNIQLDYFSRKFDMKHYDNAMKIYGELKKQGKNPKLQVTTWELYDKAFSFPRVRRYDLVQQHMDLIQHMEDNLNQNFSNGQHLAAFIQVAKAAQTAMNAKYHDGEFSDPALYDPLEDHPTTWSNVKL*
Ga0075469_1011322913300007231AqueousMKYSLVLVALLGLTQAINRQSSQTLLQLNDPCEEALDVSVEELNIQLDYFSRRLDMKYYDNAMKIYGELKKQGKDPKVNVHTWELYDASFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFLQVAKAAQKALNEKYHDGEFSDPANFDPLDEHKVTWATVKL*
Ga0102873_113182613300007545EstuarinePQNPKTPLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFSDPANFDPQEEHPTTWSNVKL*
Ga0102820_108629113300007554EstuarinePQNPKTPLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPTTWSNVKL*
Ga0102876_110754913300007642EstuarinePQNPKTPLNWNNIIKMKYSIVLIALLGLASGLRIKEALKDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPTTWSNVKL*
Ga0102824_110310013300007681EstuarineLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPTTWSNVKL*
Ga0102867_110502813300007716EstuarinePQNPKTPLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFSDPANYDPQEEHPTTWSNVKL*
Ga0102951_109498213300007725WaterMKFAAAIALVGLTQGIKLEQPCEEALEVSEENLNVELDYFSRRCDRKHYDNAMKIYGELTKQGKNPRVFVNTWELYDNSFSFPRVRRYDLVQQHMDLIQHFEDNLNQNFTNGQHVANFIQVCKAAQKALNHKYHNGEFSDPANFDPEEEHPVTWATAKI*
Ga0103484_101214613300008919Bay WaterLLGMTQAVSIKQLETPAPCEEPLEVSQEELEIQLDYFSRRLDMKYYENAMKIYGELLKQGKNPTLQIHTFELYDKAFSFPRVRRYDQVNQILNDIQHYQDNLNQNFTNALHVRNFLATAKKAQKELNTKYHDGEFSDPASFDPLEDHPVTWSNVKL*
Ga0102811_119186313300009024EstuarinePPKPQNPKTPLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPTTWSNVKL*
Ga0102814_1039322813300009079EstuarinePQNPKTPLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPSTWSNVKL*
Ga0103879_1005047413300009276Surface Ocean WaterMLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNQQHVDNFIRVDKAAQKALNDKYHDGEFSDPAGFDPEDEHPVTWATVKL*
Ga0126448_101304313300009466Meromictic PondMKFYAALALVGLTQGIKLEQPCEEALEVSVENLNVELDYFSRRCDRKHYDNAMKIYGELLKQGKNPRVFVNTWELYDNAFSFPRVRRYDLVQQHMDLIQHFEDNLNQNFTNQQHVANFIQVCKAAQSALNHKYHNGEFADPANFDPEEEHPVTWATANI*
Ga0115011_1119993013300009593MarineMKFFALAAIALLGASAVTIQHKTAAALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0115102_1053362313300009606MarineVNILLIIIMKFSTVIALVGLASAVSLDRHDTSMLAQMSQPCEEALEVSQDELNIQLDYLSRRLDVKYYNNAMKIYAELKKQGKDPKVNVHTWELYDQSFSFPRVRRYDLVQQHMDLVQHMEDNLNQNFTNGQHLANFLQVAKAAQAALNAKYHDGEFSDPANFDPQEEHPVTWSNAVL*
Ga0115104_1031195913300009677MarineMLNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIRVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI*
Ga0115104_1040027813300009677MarineLEQKSAALINEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKGFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNDKYHDGEFSDPALYDPEADHPTTWSNVKI*
Ga0115104_1065043213300009677MarineQTNKMKYIVFAALALMSVSAIEQKTASSVNNEVMLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKKDGLNPRMFVTTWELYDKSFSFPRVRRYDLVQQHMDLIQHFEDNLNQNFMNSQHLANYIKVCKAAQAALNAKYHDGEFSDPALFDPEAPHPTTWSNVKL*
Ga0115105_1004220313300009679MarineGPTLNLGCEEALEVSQEELNIQLDYFSRRLDMKYYDNAMKIYAELKKMGKDPQVNVHTWELYDQAFSFPRVRRYELVQSHMDQLEHFQDNLNQNFTNQQHVANFLRIAKAAQSDLNTKYSNGEFSDPSNYDPLDDHPTTWSNVKL*
Ga0138326_1086832513300010985MarineLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI*
Ga0138324_1042552613300010987MarineKFFALASIALLGVSAVTLEQKSAALINEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI*
Ga0129334_104290823300012471AqueousLSKAEPCEEALPVTEEELKIQLDYFSRRLDIKYYDNAMKIYGELTKQGKNPQLAVHTFELYDKAFSFPRVRRYDLVNEHLNEIQHFQDNLNQNFTNALAVKRFLDYAQKARAELNHKYHDGEFADPANFDPEEDHPVTWATVKL*
Ga0129334_109392013300012471AqueousEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHVDNFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPVTWSNVKL*
Ga0129325_135519123300012516AqueousMKFYTALALVGIASAVKITNNEPDFELNVQLDSTLNKPCEEALEVSVENLNVELDYFSRRCDRKHYDNAMKIYTELVKEKGLNPRVFVNTWELYDNAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQNLANFIQVCKAAQKALNKKYHNGEFSDPANYDPEEEHPVTWATAKI*
Ga0129326_143495313300012522AqueousISALLASAQSIGLRLLPEGSLVELQPESIQLLQTNEPCETLEMSAAQLAIELDYFSIRCDRKHYDNAMKIYGELSKNGSPPQLKINTWELYDKAFSFARVRRFELVQHHMDLLQHFEDNLNQNFTNGQAVANFIEVCKKASSELNAKYHDGEFNDPAKTDPQEDAPVTWATAKV*
Ga0163111_1178857713300012954Surface SeawaterMKFIALAAIALLGVSAVTLDQKSAVHVNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPA
Ga0129335_110200213300012962AqueousSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHVDNFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPVTWSNVKL*
Ga0182045_116217613300016726Salt MarshMKFYTALALVGIASAVKITNNEPDFELNVQLDSTLNKPCEEALEVSVENLNVELDYFSRRCDRKHYDNAMKIYTELVKEKGLNPRVFVNTWELYDNAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQNLANFIQVCKAAQKALNKKYHNGEFSDPANYDPEEEHPVTWATAKI
Ga0182094_124802713300016731Salt MarshFSFVLVALLGLTQAATNLNQLRAEPCEEALDVSQEELDIQLDYFSRRLDIKYYDNAMKIYAELKKQGKDPKVSIHTFELYDKAFAFPRVRRYEFVNQQLDQIQHFQDNLNQNFTNGLHVHNFLNAAKAAQKALNEKYHDGEFADPAGFDPEEEHKVTWSNVKL
Ga0182047_117126313300016737Salt MarshVLVALLGLTQAINRQSSQTLLQLNDPCEEALDVSVEELNIQLDYFSRRLDMKYYDNAMKIYGELKKQGKDPKVNVHTWELYDASFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFLQVAKAAQKALNEKYHDGEFSDPANFDPLDEHKVTWATVKL
Ga0182053_143278913300016749Salt MarshYSLVLVALLGLTQAINRQSSQTLLQLNDPCEEALDVSVEELNIQLDYFSRRLDMKYYDNAMKIYGELKKQGKDPKVNVHTWELYDASFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFLQVAKAAQKALNEKYHDGEFSDPANFDPLDEHKVTWATVKL
Ga0182072_132404913300016754Salt MarshVKVRQASCGEALATHVPEEGVTLIQIAEPCDDLEVSEEELKAQLDYFSRNFDIKHYNNAMKIHDELEKKGQHPSTKMAVHTWELYDKAFSFDRVRRFNEVNEQMDHLQHFEDNLNLNFKNKHHVQAFIDVAKAAQKTLNTKYHDGEFADPANFDPQAEHKTTWANVKL
Ga0186577_10928013300016882Host-AssociatedTMKFAQLALFFAGAAQALKLTSNSQQTALEQVADPCEEALEVSKEELEIQLDYFSRTFDRKFYDNAMKIHEELVKQGQNPKLSVHSWELYDQSFAFPRVRRYDLVQQQMDLLQHFEDNLNQNFTNLQHLANFIRVGKQAESTLNEKYHDGEFSDPAGFDPQDEHKTTWATVKL
Ga0181431_106297423300017735SeawaterMINEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0181380_129669313300017782SeawaterGVSAVTLEHKSAAMLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0188826_11624013300018565Freshwater LakeALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFSDPANFDPQEEHPTTWSNVKL
Ga0193031_106281613300018765MarineNLNTQVLLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKKDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQAALNGKYHDGEFADPALFDPEAPHPTTWSNVKL
Ga0193031_107059123300018765MarineNGPASFNLGCEEALEVSQTELDIQLDYFSRRLDMKYYDNAMKIYAELKKLGQDPQVNVHTYELYDQAFSFPRVRRYELVQSHMDQLEHFQDNLNQNFTNQQHVANFLRIAKAAQSDLNSKYHNGEFSDPSQYDPLEEHPTTWSNVKL
Ga0192873_1036929313300018974MarineASLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0193353_1022978413300018977MarineASNLNTQVLLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKKDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQAALNAKYHDGEFSDPALFDPEAPHPTTWSNVKL
Ga0192961_1013706613300018980MarineRGLHKIIMKFIALAVAFLGVSAVSLDQKSAASLAEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNAKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0192961_1015364813300018980MarineMGIIKMKYSVVILALLGVQAVKINGPASFNLGCEEALEVSQVELDIQLDYFSRRLDMKYYDNAMKIYAELKKMGQDPQVNVHTYELYDQSFSFPRVRRYELVQSHMDQLEHFQDNLNQNFTNQQHVANFLRIAKAAQSDLDSKYHNGEFSDPAQYDPLEEHPTTWSNVKL
Ga0192961_1016170823300018980MarineSPAKADAAAADAAPAKAALIQLEDPCEPALDVSQKQMDIELDAFSRTFDRKRYNQARIIYDELLKQGKKPRVAIHTWELYDNAFSFPRVRRYELVQHHMDLLQHFEDNLNENFTNGQHVANFITVAKAAQDALNAKYHNGEFADPANFDPEADHPVTWANVKLXEMHXL
Ga0192947_1016904013300018982MarineHGDNIFDKIIMKFIALAAIALLGVSAVTLEHKSAALLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKAMNDKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0192947_1021658213300018982MarineTNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRGFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKAMNDKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0192947_1022455213300018982MarineGMTQASTNLNQLRAEPCEEALDVSQEELEIQLDYFSRRLDMKYYQNAMKIYDELKKQGKDPKVQIHTFELYDKAFTFPRVRRYDMVNQALDAVQHYQDNLNQNFTNGLHVASFLKAAKATQKTLNEKYHDGEFSDPANFDPLEEHKVTWSNVKL
Ga0192947_1026772313300018982MarineLDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNAKYHDGEFSDPSLYDPEADHPTTWSNVKI
Ga0193030_1015110013300018989MarineHGDNIFDKLIMKFIALAAIALLGVSAVTLEHKSAALLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0193030_1015360513300018989MarineHGDNIFDKLIMKFIALAAIALLGVSAVTLEHKSAALLNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0193030_1015908313300018989MarineVLLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKKDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQAALNGKYHDGEFADPALFDPEAPHPTTWSNVKL
Ga0193030_1016370113300018989MarineMGNCNNFKSIIKMKYSVVILALLGVQAVKINGPASFNLGCEEALEVSQTELDIQLDYFSRRLDMKYYDNAMKIYAELKKLGQDPQVNVHTYELYDQAFSFPRVRRYELVQSHMDQLEHFQDNLNQNFTNQQHVANFLRIAKAAQSDLNSKYHNGEFSDPSQYDPLEEHPTTWSNVKL
Ga0193030_1016374213300018989MarineHGDNIFDKLIMKFIALAAIALLGVSAVTLEHKSAALLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0193030_1016821723300018989MarineMGNCNNFKSIIKMKYSVVILALLGVQAVKINGPASFNLGCEEALEVSQTELDIQLDYFSRRLDMKYYDNAMKIYAELKKLGQDPQVNVHTYELYDQAFSFPRVRRYELVQSHMDQLEHFQDNLNQNFTNQQHCANFLRIAKAAQADLNTKYHNGEFSDPAQYDPLEEHPTTWANVKL
Ga0193030_1019425913300018989MarineTAASVSNEVMLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKKDGLNPRMFVTTWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANYIKVGKAAQAALNAKYHDGEFSDPALFDPEAPHPTTWSNVKL
Ga0193030_1020076213300018989MarineMKFIALAAIALLGVSAVTLEHKTAAALNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0193030_1021590513300018989MarineMGNCNNFKSIIKMKYSVVILALLGVQAVKINGPASFNLGCEEALEVSQTELDIQLDYFSRRLDMKYYDNAMKIYAELKKLGQDPQVNVHTYELYDQAFSFPRVRRYELVQSHMDQLEHFQDNLNQNFTNQQHVANFLRIAKAAQADLNTKYHNGEFSDPASYDPLEEHPTTWANVKL
Ga0193030_1023652413300018989MarineKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0193030_1025139613300018989MarineMGNCNNFKSIIKMKYSVVILALLGVQAVKINGPASFNLGCEEALEVSQTELDIQLDYFSRRLDMKYYDNAMKIYAELKKLGQDPQVNVHTYELYDQAFSFPRVRRYELVQSHMDQLEHFQDNLNQNFTNQQHVANFLRIAKAAQSDLNTKYHNGEFSDPAQYDPLEEHPTTWSNVKL
Ga0192951_1027250313300019022MarineMGKFSLILVALLGLTQASTNLNQLKAEPCEEALEVSQEELQIQLDYFSRRLDMKYYQNAMKIYEELKKQGKDPKVAVHTYELYDKSFSFPRVRRYDFVNQNLELIEHFQDNLNQNFTNGLHLTNFLKAAQAARKTLNDKYHDGEFSDPANFDPQEEHKVTWSNVKI
Ga0192909_1010150013300019027MarineHGDNIFDKLLMKFFALAAIALLGASAVTLEHKSAAALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0193516_1018190723300019031MarineVLLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKKDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQAALNAKYHDGEFSDPALFDPEAPHPTTWSNVKL
Ga0192869_1039799513300019032MarineMGLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNEKYHDGEFSDPALYDPEAEHPTTWSNVKI
Ga0192945_1018653413300019036MarineMGNNFKSIIKMKYSVVILALLGVQAVKINGPASFNLGCEEALEVSQVELDIQLDYFSRRLDMKYYDNAMKIYAELKKMGQDPQVNVHTYELYDQSFSFPRVRRYELVQSHMDQLEHFQDNLNQNFTNQQHVANFLRIAKAAQSDLDTKYHNGEFSDPAQYDPLEEHPTTWSNVKL
Ga0193336_1035187813300019045MarineSAVTLEQKSAALINEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNV
Ga0192966_1016863513300019050MarineTWALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRGFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0192826_1017833713300019051MarineLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0192826_1029641113300019051MarineKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0188830_101548413300019085Freshwater LakeSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFSDPANFDPQEEHPTTWSNVKL
Ga0192946_104948813300019103MarineTNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRGFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQKALNEKYHDGEFADPALYDPEADHPTTWSNVKI
Ga0192946_106035613300019103MarineMKFSLVLVALLGMTQASTNLNQLRAEPCEEALDVSQEELEIQLDYFSRRLDMKYYQNAMKIYDELKKQGKDPKVQIHTFELYDKAFTFPRVRRYDMVNQALDAVQHYQDNLNQNFTNGLHVASFLKAAKATQKTLNEKYHDGEFSDPANFDPLEEHKVTWSNVKLXRPXLMRF
Ga0192946_106279713300019103MarineSAALLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKAMNDKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0193054_103630913300019117MarineMGNIFDKLLMKFFALAAIALLGVSAVTLEHKSAAALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0193054_103672913300019117MarineGNIFDKLLMKFFALEAIALLGVSAVTLEHKSAAALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0188870_1009677313300019149Freshwater LakeMKFIALAAIALLGVSAVTLEQKSAALINEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0188870_1011639613300019149Freshwater LakeEINMKFSLVLVAFLGLTMGSTNLNQLRAEPCEEALDVSQEELEIQLDYFSRRLDMKYYQNAMKIYGELKKQGKDPKVAIHTFELYDKSFTFPRVRRYDFVNQQLDSVQHYQDNLNQNFTNGLHVANFLKAAKSAQKALNEKYHDGEFSDPAKFDPQEEHKVTWSNVKL
Ga0180036_104469313300019200EstuarineIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPTTWSNVKL
Ga0182086_128001313300020013Salt MarshMKFSFVLVALLGLTQAATNLNQLRAEPCEEALDVSQEELDIQLDYFSRRLDIKYYDNAMKIYAELKKQGKDPKVSIHTFELYDKAFAFPRVRRYEFVNQQLDQIQHFQDNLNQNFTNGLHVHNFLNAAKAAQKALNEKYHDGEFADPAGFDPEEEHKVTWSNVKL
Ga0182044_123743413300020014Salt MarshKYSLVLVALLGLTQAINRQSSQTLLQLNDPCEEALDVSVEELNIQLDYFSRRLDMKYYDNAMKIYGELKKQGKDPKVNVHTWELYDASFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFLQVAKAAQKALNEKYHDGEFSDPANFDPLDEHKVTWATVKL
Ga0206695_117239213300021348SeawaterMKFIALAVAFLGVSAVSLDQKSAASLAEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNAKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0206692_128727123300021350SeawaterLNFLIVFVNYCNNFKSIIKMKYSVVILALLGVQAVKINGPASFNLGCEEALEVSQTELDIQLDYFSRRLDMKYYDNAMKIYAELKKMGQDPQVNVHTYELYDQSFSFPRVRRYELVQSHMDQLEHFQDNLNQNFTNQQHVANFLRIAKAAQSALNSKYHNGEFSDPSQYDPLEEHPTTWSNVKL
Ga0063132_12534313300021872MarineIALAAIALLGVSAVTLEHKTAAALNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0063125_101744213300021885MarineKFFALAAIALLGVSAVTLEHKTAAALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKGFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0063086_102416113300021902MarineMKFIALAVAFLGVSAVSLDQKSAASLAEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNAKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0063870_104336013300021921MarineNTEGQLWLYPNGDVVNLDEDGCDDGLELSEKQLYIELDYFSRKFDRKNYNNAMKIYDELKKLGKNPKLSVHTWELYDDAFAFPRVRRYDLVQQHMDLIQHFEDNLNENFSNGQLVSNYIKVCKDAETAFNAKYHDGEFSDPAEYDPEEEHKTTWSNIKL
Ga0063869_102291313300021922MarineLDEDGCDDGLELSEKQLYIELDYFSRKFDRKNYNNAMKIYDELKKLGKNPKLSVHTWELYDDAFAFPRVRRYDLVQQHMDLIQHFEDNLNENFSNGQLVSNYIKVCKDAETAFNAKYHDGEFSDPAEYDPEEEHKTTWSNIKL
Ga0063085_100653013300021924MarineKFIALAVAFLGVSAVSLDQKSAASLAEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNAKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0063098_106220013300021942MarineCDDGLELSEKQLYIELDYFSRKFDRKNYNNAMKIYDELKKLGKNPKLSVHTWELYDDAFAFPRVRRYDLVQQHMDLIQHFEDNLNENFSNGQLVSNYIKVCKDAETAFNAKYHDGEFSDPAEYDPEEEHKTTWSNIKL
Ga0063101_105637113300021950MarineMASTNLNQLSAEPCVEALDVSQMELEIQLDYFSRRLDMKYYQNAMKIYEELKKQGKDPKVDIHTFELYDKAFTFPRVRRYDDVNQQLDSIQHYQDNLNQNFTNGLHVTNFLRVAKAAQKALNEKYHDGEFSDPSKFDPEEEHKTTWSNIKLXRPXNLMSIAINSILSTSDGFYKLIL
Ga0222713_1041384213300021962Estuarine WaterLSKAEPCEEALPVTEEELKIQLDYFSRRLDIKYYDNAMKIYGELTKQGKNPQLAVHTFELYDKAFSFPRVRRYDLVNEHLNEIQHFQDNLNQNFTNALAVKRFLDYAQKARAELNHKYHDGEFADPANFDPEEDHPVTWATVKL
Ga0222713_1047341313300021962Estuarine WaterPQNPKTPLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPTTWSNVKL
Ga0222713_1048777013300021962Estuarine WaterPKTPKPLDNQSLIFYYNNNMKYSLVLLAFLGIASAINSKQSPATTLAQLNEPCEEALEVSKEELDIQLDYFSRRLDIKYYNNAMKIYDELKKKGQNPKVNVHTWELYDQAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHVANFLQVAKAAQKALNEKYHDGEFSDPANFDPQEEHPVTWATKKF
Ga0228687_102580113300023696SeawaterALAAIALLGVSAVTLEHKSAVALNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0232122_111203313300023709Salt MarshVMKYSLVLVALLGLTQAINRQSSQTLLQLNDPCEEALDVSVEELNIQLDYFSRRLDMKYYDNAMKIYGELKKQGKDPKVNVHTWELYDASFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFLQVAKAAQKALNEKYHDGEFSDPANFDPLDEHKVTWATVKL
Ga0244775_1078363413300024346EstuarinePPKPQNPKTPLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPTTWSNVKL
Ga0209634_131422613300025138MarineLYNIFDKIIMKFFALAAIALLGVSAVTLDHKSATALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELRGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNSKY
Ga0209308_1022630133300025869Pelagic MarineNLDENGCDDGLEISEAQLYIELDYFSRKFDRKNYDNAMKIYDELKKLGKNPKLFVNTWELYDAAFSFPRVRRYDLVQQHMDLIQHFEDNLNQNMSNGQLVSNYIKVCKDAQTAFNAKYHDGEFSDPAGFDPQEEHKTTWSNVKL
Ga0208783_1038171213300025872AqueousMRFSSLLVAIGVASAASLAQRPIRLSATGEPCEEALEVSPEELAIQLDYFSRRLDIKYYNNAMNIAGELAKQGKHPQLAVHTWELYDKAFSFPRVRRYDFVQERMDEIQHYQDNLNQNFANGLHVKNFLVAAKKAEKELNEKYHDGEFADPANFDP
Ga0208544_1020496713300025887AqueousMKFSFALVALLGLTQAVTLTQQSVPCEEALEVSEAELNIQLDYFSRKFDMKHYDNAMKIYGELKKQGKNPKLQVTTWELYDKAFSFPRVRRYDLVQQHMDLIQHMEDNLNQNFSNGQHLAAFIQVAKAAQTAMNAKYHDGEFSDPALYDPLEDHPTTWSNVKL
Ga0209425_1039515213300025897Pelagic MarineLDEDGCDDGLELSEKQLYIELDYFSRKFDRKNYNNAMKIYDELKKLGKNPKLSVHTWELYDDAFAFPRVRRYDLVQQHMDLIQHFEDNLNENFSNGQLVSNYIKVCKDAETAFNAKYHDGEFSDPAEYDPEEEHKTTWSNIKLXTLNNSNELFXLRLMNCR
Ga0209961_104760713300026130WaterMKFAAAIALVGLTQGIKLEQPCEEALEVSEENLNVELDYFSRRCDRKHYDNAMKIYGELTKQGKNPRVFVNTWELYDNSFSFPRVRRYDLVQQHMDLIQHFEDNLNQNFTNGQHVANFIQVCKAAQKALNHKYHNGEFSDPANFDPEEEHPVTWATAKIXMIKKXKNDLK
Ga0208275_103131813300026182MarineMKFYTILALVGMATAINQKSVMTLNEPCEPALEVSEKQLYIELDYFSRSFDIKHYNNAIKIYDELKKEGKNPKLFVHSWELYDNAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFTNGQHLANFIKVAKAAQKALNEKYHDGEFADPSLFDP
Ga0247591_106497413300026434SeawaterKFIALAAIALLGVSAVTLEHKSAVALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0247578_108946013300026458SeawaterKIIMKFIALAAIALLGVSAVTLEHKVAASLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0247603_107280413300026468SeawaterKFFALAAIALLGVSAVTLEQKSAALINEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELRGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0247603_113814813300026468SeawaterFIALAVALLGVSAVNLDQKSAASLAEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTTWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0247599_108242723300026470SeawaterLLGVSAVNLDQKSAASLAEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTTWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNTKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0247602_110871513300026471SeawaterIMKFIALAAIALLGVSAVTLEHKSAVALNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0247592_110160513300026500SeawaterMKFIALAVALLGVSAVNLDQKSAASLAEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTTWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNTKYHDGELSDPALYDPEADHPTTWSNVKI
Ga0247605_111048313300026503SeawaterKFIALAVALLGVSAVNLDQKSAASLAEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTTWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNTKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0208444_102931213300027240EstuarinePQNPKTPLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFSDPANFDPQEEHPTTWSNVKL
Ga0208556_108311613300027366EstuarinePQNPKTPLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFTDPATVDPTDEK
Ga0208897_111747913300027571EstuarinePLNWNNIIKMKYSIVLIALLGLASGLRIKEALQDPPTFINNCEEALEVSVEELNIQLDYFSRNFDKKYYNNAMKIYDELKKQGKNPKVSVHTWELYDNAFSFPRVRRYDLVQQHMELLQHFEDNLNQNFTNQQHLENFIQVAKAAQAALNAKYHDGEFADPANFDPQEEHPTTWSNVKL
Ga0209404_1062610423300027906MarineMKFFALAAIALLGASAVTIQHKTAAALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKAMNEKYHDGEFDDPALYDP
Ga0247596_107266713300028106SeawaterMLNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0247596_108630913300028106SeawaterFIALAVALLGVSAVNLDQKSAASLAEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTTWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNTKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0256411_123923413300028134SeawaterALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0256412_124316913300028137SeawaterLGVSAVTLEHKVAASLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0256417_108886523300028233SeawaterMLNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0256417_115727113300028233SeawaterVNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRSFAFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0256413_123270013300028282SeawaterSAVTLEHKSAVALNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0247566_105428713300028335SeawaterALLGVSAVTLEHKSAAMLNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0307398_1053006113300030699MarineMRISIILVALLGFSSAATLKQMASAEPCEEALAVTTEELEIQLDYFSRRLDMKYYENAMKIYGELLKQGKNPTLDIHTYELYDKAFTFPRVRRYDFVETHLNQIQHYQDNLNQNFTTGLAVKRFLEVAKLAQKEINAKYHDGEFTDPANFDPLEEHPVTWSNVKL
Ga0073988_1001185413300030780MarineALAAIALLGASAVTLEHKSAAALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0073988_1236628413300030780MarineEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0073982_1174368813300030781MarineKFFALAAIALLGVSAVTLEHKTAAALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0073981_1173055713300030857MarineMKFIALAAIALLGVSAVTLDQKAAAHVNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0073987_1121931113300030912MarineMLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0073984_1126334613300031004MarineLMKFFALAAIALLGVSAVTLEHKSAAALNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0073980_1135114313300031032MarineMKFIALAAIALLGVSAVTLEHKVAASLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0073986_1203318713300031038MarineNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0073989_1326240213300031062MarineMNIELDYFSRTFDIVHYTNAMNIYAELVKKGQSPKCSVHSWELYDKAFSFPRVRRYDLVQQGMDMLQHFQDNLNENFDNSLHVKNFIEVGKKVQAQFNEKYHDGEFSDPALFDPEEEHKPTWATVTI
Ga0307388_1027922323300031522MarineEAALVMLNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRGFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0307388_1073959823300031522MarineADAAAPAKAEAAPAKAALIQLDDPCEPALDVSQKQMDIELDAFSRTFDRKRYNQARIIYDELLKQGKKPRVAIHTWELYDNAFSFPRVRRYELVQHHMDLLQHFEDNLNENFTNGQHVSNFITVAKAAQDALYAKYHNGEFADPANFDPEADHPTTWSNVRLXEMHXL
Ga0307388_1085499413300031522MarineKMRFSLVLVAMLGMTQASTNLNQLRAEPCEEALDVSQEELEIQLDYFSRRLDMKYYQNAMKIYDELKKQGKDPKVAIHTFELYDKAFTFPRVRRYDMVNEALNLIQHYQDNLNENFTNGLAVSNFLKAAKSTQKSLNAKYHDGEFSDPAQFDPLEEHKVTWSNVKL
Ga0302121_1014968013300031626MarineVNLDEDGCDDGLELSEKQLYIELDYFSRKFDRKNYNNAMKIYDELKKLGKNPKLSVHTWELYDDAFAFPRVRRYDLVQQHMDLIQHFEDNLNENFSNGQLVSNYIKVCKDAETAFNAKYHDGEFSDPAEYDPEEEHKTTWSNIKL
Ga0307386_1056373113300031710MarineAAGLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQVALNSKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0307386_1063583013300031710MarineIKMKFSLVLVALLGMTQASTNLNQLRAEPCEEALDVSQMELEIQLDYFSRRLDMKYYQNAMKIYDELKKQGKDPKVQIHTFELYDKAFTFPRVRRYDFVNNALDAVQHYQDNLNQNFTNGLHVASFLKAAKATQKALNEKYHDGEFSDPANFDPLEEHKVNWSNVKL
Ga0307381_1018136213300031725MarineMLNEPCEPALDVSEKQLYIELDYFSRSYDIHHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNSKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0307381_1024348013300031725MarineMLNEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELRGDGLNPRMFVTSWELYDHSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKAMNEKYHDGEFSDPALYDPEAAHPTTWSNVKI
Ga0307384_1048989513300031738MarineKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRGFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0307384_1056836713300031738MarineEKQLYIELDYFSRSYDIHHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNSKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0307383_1054027313300031739MarineKFIALAAIALLGVSAVTLEHKTAAALNEPCEPALDVSEKQLYIELDYFSRSYDIHHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNSKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0307382_1033576313300031743MarineKIIMKFIALAAIALLGVSAVTLEHKTAAALNEPCEPALDVSEKQLYIELDYFSRSYDIHHYNNAVKIYNELKGDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAAQKALNSKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0307382_1060953513300031743MarineLLGVSAINLDQKSAASLAEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKKDGLNPRMFVTSWELYDKSFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKAA
Ga0307389_1013680543300031750MarineMLNEPCEPALDVSEKQLYIELDYFSRSYDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRGFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVGKSAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0314680_1076792223300032521SeawaterCDDGLEISEAQLYIELDYFSRKFDRKNYDNAMKIYDELKKLGKNPKLFVNTWELYDAAFSFPRVRRYDLVQQHMDLIQHFEDNLNQNMSNGQLVSNYIKVCKDAQTAFNAKYHDGEFSDPAGFDPQEEHKTTWSNVKL
Ga0314669_1066376013300032708SeawaterSAVTLEQKSAALINEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0314701_1033400213300032746SeawaterKFIALAAIALLGVSAVTLEQKSAALINEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0314700_1043153713300032752SeawaterIMKFIALAAIALLGVSAVTLEQKSAALINEPCEPALDVSEKQLYIELDYFSRSFDIKHYNNAVKIYNELKGDGLNPRMFVTSWELYDRAFSFPRVRRYDLVQQHMDLLQHFEDNLNQNFMNSQHLANFIKVAKAAQKALNEKYHDGEFSDPALYDPEADHPTTWSNVKI
Ga0307390_1094395413300033572MarineRISIILVALLGFSSAATLKQMASAEPCEEALPVTAEELEIQLDYFSRRLDMKYYENAMKIYEELRKQGQNPTLDVHTFELYDKAFSFPRVRRYDFVEKHLNQIQHYQDNLNQNFTTGLAVKRFLEVSKLAQKEINAKYHDGEFSDPAKFDPLEEHPITWSNVVL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.