NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F040051

Metagenome / Metatranscriptome Family F040051

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040051
Family Type Metagenome / Metatranscriptome
Number of Sequences 162
Average Sequence Length 46 residues
Representative Sequence MLDNLLDDIEAVLKKYSGTDWEIMDVDFADGGAVFTVSAGLKEEEE
Number of Associated Samples 112
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.60 %
% of genes near scaffold ends (potentially truncated) 45.68 %
% of genes from short scaffolds (< 2000 bps) 75.93 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (45.062 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(27.160 % of family members)
Environment Ontology (ENVO) Unclassified
(74.691 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.741 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.62%    β-sheet: 22.97%    Coil/Unstructured: 55.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF137592OG-FeII_Oxy_5 4.94
PF14090HTH_39 1.85
PF00004AAA 1.23
PF04304DUF454 0.62
PF01176eIF-1a 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 162 Family Scaffolds
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 0.62
COG2832Uncharacterized membrane protein YbaN, DUF454 familyFunction unknown [S] 0.62

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.31 %
UnclassifiedrootN/A24.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000224|SI34jun09_10mDRAFT_1044082All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium614Open in IMG/M
3300000265|LP_A_09_P04_10DRAFT_1009212All Organisms → Viruses → Predicted Viral2201Open in IMG/M
3300000928|OpTDRAFT_10029707All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1598Open in IMG/M
3300000928|OpTDRAFT_10034429Not Available1086Open in IMG/M
3300000928|OpTDRAFT_10042680All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300000947|BBAY92_12271415Not Available971Open in IMG/M
3300003216|JGI26079J46598_1014944All Organisms → Viruses → Predicted Viral2166Open in IMG/M
3300003345|JGI26080J50196_1009600All Organisms → Viruses → Predicted Viral2958Open in IMG/M
3300003345|JGI26080J50196_1042541Not Available911Open in IMG/M
3300003409|JGI26088J50261_1037790Not Available965Open in IMG/M
3300003409|JGI26088J50261_1077749All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium556Open in IMG/M
3300003410|JGI26086J50260_1010030All Organisms → cellular organisms → Bacteria3642Open in IMG/M
3300003580|JGI26260J51721_1006308All Organisms → Viruses → Predicted Viral3636Open in IMG/M
3300003583|JGI26253J51717_1006122All Organisms → Viruses → Predicted Viral3816Open in IMG/M
3300003583|JGI26253J51717_1016884All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1799Open in IMG/M
3300003617|JGI26082J51739_10091034All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300003621|JGI26083J51738_10109870All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300004279|Ga0066605_10014203All Organisms → cellular organisms → Bacteria4151Open in IMG/M
3300004279|Ga0066605_10242533Not Available677Open in IMG/M
3300004279|Ga0066605_10294096Not Available599Open in IMG/M
3300005837|Ga0078893_10648359Not Available5870Open in IMG/M
3300005941|Ga0070743_10021856All Organisms → Viruses → Predicted Viral2225Open in IMG/M
3300006752|Ga0098048_1037187All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1566Open in IMG/M
3300006752|Ga0098048_1125983Not Available768Open in IMG/M
3300006925|Ga0098050_1048063All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium1127Open in IMG/M
3300006925|Ga0098050_1179245Not Available530Open in IMG/M
3300007554|Ga0102820_1007860All Organisms → Viruses → Predicted Viral2758Open in IMG/M
3300008961|Ga0102887_1135120All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium767Open in IMG/M
3300008964|Ga0102889_1083413All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium954Open in IMG/M
3300008996|Ga0102831_1213952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium637Open in IMG/M
3300009024|Ga0102811_1261233All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300009059|Ga0102830_1123021All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium765Open in IMG/M
3300009077|Ga0115552_1413624All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium531Open in IMG/M
3300009079|Ga0102814_10250354All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300009086|Ga0102812_10061422All Organisms → Viruses → Predicted Viral2082Open in IMG/M
3300009420|Ga0114994_10176696All Organisms → Viruses → Predicted Viral1442Open in IMG/M
3300009438|Ga0115559_1197581All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300009495|Ga0115571_1174564All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium890Open in IMG/M
3300009599|Ga0115103_1362903All Organisms → cellular organisms → Bacteria2776Open in IMG/M
3300017706|Ga0181377_1018700All Organisms → Viruses → Predicted Viral1537Open in IMG/M
3300017713|Ga0181391_1020367All Organisms → Viruses → Predicted Viral1654Open in IMG/M
3300017713|Ga0181391_1035027All Organisms → Viruses → Predicted Viral1214Open in IMG/M
3300017717|Ga0181404_1013453All Organisms → Viruses → Predicted Viral2140Open in IMG/M
3300017719|Ga0181390_1007818All Organisms → cellular organisms → Bacteria3874Open in IMG/M
3300017719|Ga0181390_1110146All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium727Open in IMG/M
3300017725|Ga0181398_1013692All Organisms → Viruses → Predicted Viral2051Open in IMG/M
3300017726|Ga0181381_1005509All Organisms → Viruses → Predicted Viral3123Open in IMG/M
3300017727|Ga0181401_1007503All Organisms → Viruses → Predicted Viral3614Open in IMG/M
3300017727|Ga0181401_1027831All Organisms → Viruses → Predicted Viral1641Open in IMG/M
3300017727|Ga0181401_1065874All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes965Open in IMG/M
3300017727|Ga0181401_1108992All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium699Open in IMG/M
3300017727|Ga0181401_1130135Not Available624Open in IMG/M
3300017727|Ga0181401_1163519Not Available537Open in IMG/M
3300017727|Ga0181401_1177194Not Available509Open in IMG/M
3300017728|Ga0181419_1057532All Organisms → Viruses → Predicted Viral1002Open in IMG/M
3300017728|Ga0181419_1148951All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium560Open in IMG/M
3300017737|Ga0187218_1018406All Organisms → cellular organisms → Bacteria1837Open in IMG/M
3300017737|Ga0187218_1150399Not Available550Open in IMG/M
3300017741|Ga0181421_1200889Not Available510Open in IMG/M
3300017742|Ga0181399_1005048All Organisms → cellular organisms → Bacteria4104Open in IMG/M
3300017742|Ga0181399_1082403All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium808Open in IMG/M
3300017742|Ga0181399_1103280All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium704Open in IMG/M
3300017749|Ga0181392_1008635All Organisms → cellular organisms → Bacteria3389Open in IMG/M
3300017749|Ga0181392_1071340All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300017749|Ga0181392_1089514All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300017749|Ga0181392_1128026Not Available750Open in IMG/M
3300017749|Ga0181392_1215589Not Available547Open in IMG/M
3300017751|Ga0187219_1124385Not Available762Open in IMG/M
3300017751|Ga0187219_1179755All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300017756|Ga0181382_1035081All Organisms → Viruses → Predicted Viral1502Open in IMG/M
3300017762|Ga0181422_1214237Not Available577Open in IMG/M
3300017763|Ga0181410_1011258All Organisms → Viruses → Predicted Viral3108Open in IMG/M
3300017763|Ga0181410_1209008All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium532Open in IMG/M
3300017764|Ga0181385_1006892All Organisms → cellular organisms → Bacteria3763Open in IMG/M
3300017768|Ga0187220_1185549Not Available627Open in IMG/M
3300017770|Ga0187217_1001622All Organisms → cellular organisms → Bacteria9310Open in IMG/M
3300017770|Ga0187217_1010348All Organisms → Viruses → Predicted Viral3426Open in IMG/M
3300017771|Ga0181425_1250931Not Available547Open in IMG/M
3300017772|Ga0181430_1250343All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium500Open in IMG/M
3300017776|Ga0181394_1023113All Organisms → Viruses → Predicted Viral2223Open in IMG/M
3300017776|Ga0181394_1130408All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300017776|Ga0181394_1258542All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium520Open in IMG/M
3300017781|Ga0181423_1264064All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300017783|Ga0181379_1045809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1690Open in IMG/M
3300019077|Ga0188868_1002631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium526Open in IMG/M
3300019214|Ga0180037_1025579All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium616Open in IMG/M
3300020347|Ga0211504_1034208All Organisms → Viruses → Predicted Viral1271Open in IMG/M
3300020347|Ga0211504_1074889All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium777Open in IMG/M
3300020352|Ga0211505_1004160All Organisms → cellular organisms → Bacteria4146Open in IMG/M
3300020438|Ga0211576_10168845All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300020438|Ga0211576_10394056Not Available709Open in IMG/M
3300021085|Ga0206677_10016372All Organisms → Viruses → Predicted Viral4682Open in IMG/M
3300021085|Ga0206677_10049192All Organisms → Viruses → Predicted Viral2201Open in IMG/M
3300021085|Ga0206677_10065279All Organisms → Viruses → Predicted Viral1824Open in IMG/M
3300021169|Ga0206687_1154164All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium686Open in IMG/M
3300021169|Ga0206687_1854792Not Available763Open in IMG/M
3300021185|Ga0206682_10123339All Organisms → Viruses → Predicted Viral1252Open in IMG/M
3300021185|Ga0206682_10202327All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300021185|Ga0206682_10285155Not Available723Open in IMG/M
3300021957|Ga0222717_10252585All Organisms → Viruses → Predicted Viral1023Open in IMG/M
3300021957|Ga0222717_10538857All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium622Open in IMG/M
3300021959|Ga0222716_10562952Not Available629Open in IMG/M
(restricted) 3300022920|Ga0233426_10036728All Organisms → Viruses → Predicted Viral2452Open in IMG/M
(restricted) 3300023109|Ga0233432_10032197All Organisms → Viruses → Predicted Viral3565Open in IMG/M
(restricted) 3300023109|Ga0233432_10098596All Organisms → Viruses → Predicted Viral1650Open in IMG/M
(restricted) 3300023109|Ga0233432_10123565All Organisms → Viruses → Predicted Viral1407Open in IMG/M
(restricted) 3300023109|Ga0233432_10319991Not Available708Open in IMG/M
(restricted) 3300023109|Ga0233432_10434931All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium564Open in IMG/M
3300023693|Ga0232112_1026443Not Available647Open in IMG/M
3300024226|Ga0228667_1070274Not Available665Open in IMG/M
3300024247|Ga0228675_1033967All Organisms → Viruses → Predicted Viral1153Open in IMG/M
(restricted) 3300024255|Ga0233438_10014156All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5304Open in IMG/M
(restricted) 3300024255|Ga0233438_10053082All Organisms → Viruses → Predicted Viral2049Open in IMG/M
(restricted) 3300024255|Ga0233438_10125108All Organisms → Viruses → Predicted Viral1135Open in IMG/M
(restricted) 3300024257|Ga0233442_1199835All Organisms → cellular organisms → Bacteria506Open in IMG/M
(restricted) 3300024260|Ga0233441_1184759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium635Open in IMG/M
(restricted) 3300024264|Ga0233444_10165780All Organisms → Viruses → Predicted Viral1054Open in IMG/M
3300024294|Ga0228664_1044396All Organisms → Viruses → Predicted Viral1105Open in IMG/M
3300024297|Ga0228658_1158265Not Available541Open in IMG/M
3300024320|Ga0233398_1127688Not Available576Open in IMG/M
3300024326|Ga0228652_1063701All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300024329|Ga0228631_1103202All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium674Open in IMG/M
3300024346|Ga0244775_10055884All Organisms → Viruses → Predicted Viral3423Open in IMG/M
3300024348|Ga0244776_10441909All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium853Open in IMG/M
3300024359|Ga0228628_1020710All Organisms → Viruses → Predicted Viral1615Open in IMG/M
3300025070|Ga0208667_1011094Not Available2042Open in IMG/M
3300025083|Ga0208791_1034847All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium935Open in IMG/M
3300025085|Ga0208792_1009832All Organisms → Viruses → Predicted Viral2200Open in IMG/M
3300025108|Ga0208793_1188674All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium523Open in IMG/M
3300025483|Ga0209557_1001459All Organisms → cellular organisms → Bacteria13024Open in IMG/M
3300025608|Ga0209654_1028687All Organisms → Viruses → Predicted Viral1934Open in IMG/M
3300025608|Ga0209654_1038889All Organisms → Viruses → Predicted Viral1555Open in IMG/M
3300025617|Ga0209138_1131857Not Available672Open in IMG/M
3300025636|Ga0209136_1020302All Organisms → cellular organisms → Bacteria2671Open in IMG/M
3300025636|Ga0209136_1070548All Organisms → Viruses → Predicted Viral1093Open in IMG/M
3300025668|Ga0209251_1004213All Organisms → cellular organisms → Bacteria9006Open in IMG/M
3300025668|Ga0209251_1169066Not Available554Open in IMG/M
3300025684|Ga0209652_1054569All Organisms → Viruses → Predicted Viral1404Open in IMG/M
3300025695|Ga0209653_1153133All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium676Open in IMG/M
3300025767|Ga0209137_1139185Not Available901Open in IMG/M
3300025767|Ga0209137_1178688All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300025849|Ga0209603_1060911All Organisms → Viruses → Predicted Viral1901Open in IMG/M
3300026453|Ga0228644_1094718Not Available517Open in IMG/M
3300026466|Ga0247598_1116690All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300026500|Ga0247592_1064376All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300026503|Ga0247605_1034514All Organisms → Viruses → Predicted Viral1266Open in IMG/M
3300027192|Ga0208673_1063659All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium582Open in IMG/M
3300027612|Ga0209037_1067814Not Available878Open in IMG/M
3300027751|Ga0208304_10091153All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300027833|Ga0209092_10340386All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300027833|Ga0209092_10376886All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium748Open in IMG/M
3300028008|Ga0228674_1006916All Organisms → cellular organisms → Bacteria5499Open in IMG/M
3300028109|Ga0247582_1095307Not Available777Open in IMG/M
3300028110|Ga0247584_1155589Not Available562Open in IMG/M
3300028130|Ga0228619_1093777Not Available727Open in IMG/M
3300028134|Ga0256411_1217155Not Available599Open in IMG/M
3300028134|Ga0256411_1272579All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium516Open in IMG/M
3300028196|Ga0257114_1010813All Organisms → Viruses → Predicted Viral4806Open in IMG/M
3300028273|Ga0228640_1117818All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium510Open in IMG/M
3300028287|Ga0257126_1154834All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300031851|Ga0315320_10664205Not Available674Open in IMG/M
3300032088|Ga0315321_10254975All Organisms → Viruses → Predicted Viral1132Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater27.16%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine15.43%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater12.35%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.41%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater7.41%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine7.41%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.56%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.94%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.47%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.85%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine1.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.23%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine1.23%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.23%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.62%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.62%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.62%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.62%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000224Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10mEnvironmentalOpen in IMG/M
3300000265Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003345Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNAEnvironmentalOpen in IMG/M
3300003409Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNAEnvironmentalOpen in IMG/M
3300003410Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNAEnvironmentalOpen in IMG/M
3300003580Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNAEnvironmentalOpen in IMG/M
3300003583Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNAEnvironmentalOpen in IMG/M
3300003617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNAEnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300019077Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p8EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023693Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024226Seawater microbial communities from Monterey Bay, California, United States - 81DEnvironmentalOpen in IMG/M
3300024247Seawater microbial communities from Monterey Bay, California, United States - 36D_rEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024257 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_150_MGEnvironmentalOpen in IMG/M
3300024260 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MGEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024320Seawater microbial communities from Monterey Bay, California, United States - 38DEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024359Seawater microbial communities from Monterey Bay, California, United States - 34DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025668Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025695Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025767Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300026453Seawater microbial communities from Monterey Bay, California, United States - 56DEnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027612Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028130Seawater microbial communities from Monterey Bay, California, United States - 22DEnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028273Seawater microbial communities from Monterey Bay, California, United States - 51DEnvironmentalOpen in IMG/M
3300028287Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120mEnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SI34jun09_10mDRAFT_104408223300000224MarineMKKKRRLLMLDDLLDDIAAVLKKYSGTDWEIMDVDFDDGGAVFTVSAGNIKDCED*
LP_A_09_P04_10DRAFT_100921283300000265MarineMLDALLDDIEAVLKKYSGTDWEIMDVDFDQGGAVFTVSAGNLGVDNEEE*
OpTDRAFT_1002970773300000928Freshwater And MarineMLDALLDDIEAVLKKYSGTDWEIMDVDFDQGGAVFTV
OpTDRAFT_1003442923300000928Freshwater And MarineMLDALLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV*
OpTDRAFT_1004268033300000928Freshwater And MarineMLDALLDDIEAVLKKYSGTDWEIMDVDFADGGAVFTVSAGQLGVDNEE
BBAY92_1227141543300000947Macroalgal SurfaceDALLDDIEVVLKKYSGTDWEIMDVDFSDGGAVFTVSAGIKEEEDV*
JGI26079J46598_101494473300003216MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFADGGAVFTVSAGNISEEE*
JGI26080J50196_100960073300003345MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGNISDEDE*
JGI26080J50196_104254133300003345MarineMLDNLLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEDV*
JGI26088J50261_103779033300003409MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGNISEEEV*
JGI26088J50261_107774923300003409MarineMLDALLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGNISDEELAN*
JGI26086J50260_101003043300003410MarineMLDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV*
JGI26260J51721_100630823300003580MarineMLDDLLDDIETVLKKYSGTDWEIMDIDFADGGAVFTISAGSIKDEE*
JGI26253J51717_100612223300003583MarineMLDDLLDDIETVLKKYSGTDWEIMDIDFADGGAVFTISAGSXXXEE*
JGI26253J51717_101688463300003583MarineMLDDLLDDIETVLKKYSGTDWEIMDIDFADGGAVFTISAGSI
JGI26082J51739_1009103413300003617MarineDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV*
JGI26083J51738_1010987013300003621MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGLKEEEDV*
Ga0066605_1001420363300004279MarineMLDDLLDDIETVLKKYSGTDWEIMDIDFADGGAVFTISAGSIELEE*
Ga0066605_1024253323300004279MarineMLDNLLDDIEAVLNKYSGSDWEIMDVDYADGGAVFTVSAGNITEESE*
Ga0066605_1029409613300004279MarineMLDNLLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAG
Ga0078893_1064835973300005837Marine Surface WaterMLDALLDDIEVVLKKYSGTDWEIMDVDFSDGGAVFTVSAGIKEEEDV*
Ga0070743_1002185683300005941EstuarineMLDALLDDIEAVLKKYSGTDWEIMDVDFDQGGAVFTVSA
Ga0098048_103718753300006752MarineMLDDLLDDIEQVLKKYSGEDWEIMDVDFADGGAVFTISAGSISLEE*
Ga0098048_112598323300006752MarineMLDDLLDDIEQVLKKYSGKDWEIMDVDFADGGAVFTISAGSISLEE*
Ga0098050_104806323300006925MarineMLDDLLDDIEQVLKKYSGKDWEIMDVDFSDGGAVFTISAGSISLEE*
Ga0098050_117924513300006925MarineSVMLDDLLDDIEQVLKKYSGEDWEIMDVDFADGGAVFTISAGSISLEE*
Ga0102820_100786043300007554EstuarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFDQGGAVFTVSAGNLGVDNEEE*
Ga0102887_113512023300008961EstuarineMLDALLDDIEAVLKKYSGTDWEIMDVDFDDGGAVFTVSAGNLGVDNEEE*
Ga0102889_108341313300008964EstuarineMLDALLDDIEAVLKKYSGTDWEIMDVDFADGGAVFTVSAGQLGVDNEEE*
Ga0102831_121395223300008996EstuarineMLDALLDDSEAVLKKYSGTDWEIMDVDFDQGGAVFTVSA
Ga0102811_126123333300009024EstuarineLPMLDALLDDIEAVLKKYSGSDWEIMDVDFDDGGAVFTVSAGNLGVDNEEE*
Ga0102830_112302123300009059EstuarineMLDALLDDIEAVLKKYSGSDWEIMDVDFDDGGAVFTVSAGNLGVDNEEE*
Ga0115552_141362413300009077Pelagic MarineMLDALLDDIEVVLKKYSGTDWEIMDVDFSDGGAVFTVSAGLKEEEDV*
Ga0102814_1025035413300009079EstuarineKTKKRRLPMLDALLDDIEAVLKKYSGSDWEIMDVDFDDGGAVFTVSAGNLGVDNEEE*
Ga0102812_1006142213300009086EstuarinePMLDALLDDIEAVLKKYSGTDWEIMDVDFDDGGAVFTVSAGNLGVDNEEE*
Ga0114994_1017669643300009420MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGNIKESED*
Ga0115559_119758123300009438Pelagic MarineLKKYSGTDWEIMDVDFSDGGAVFTVSAGLKEEEDV*
Ga0115571_117456433300009495Pelagic MarineMLDALLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEDD*
Ga0115103_136290363300009599MarineLDALLDDIQEVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEEE*
Ga0181377_101870033300017706MarineMLDALLDDIEAVLNKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV
Ga0181391_102036753300017713SeawaterGSRVMLDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEDECTS
Ga0181391_103502713300017713SeawaterGSRVMLDNLLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0181404_101345323300017717SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGNISEEE
Ga0181390_100781893300017719SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDIDYADGGAVFTVSAGNITEESE
Ga0181390_111014623300017719SeawaterMLDALLDDIEVVLKKYSGTDWEIMDVDFSDGGAVFTVSAGIKEEEDV
Ga0181398_101369263300017725SeawaterMLDNLLDDIEAVLNKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0181381_100550923300017726SeawaterMLDALLEDIEAVLKNYSGRDREVMDVDFSDGGAVFTVSAGLKEEEDV
Ga0181401_100750393300017727SeawaterMLDNLLDDIEAVLNKYSGSDWEIMDIDYADGGAVFTVSAGNITEESE
Ga0181401_102783143300017727SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEE
Ga0181401_106587443300017727SeawaterDNLLDDIEAVLKKYSGSDWEIMDVDYADGGAVFTVSAGNITEEEV
Ga0181401_110899223300017727SeawaterMLDDLLDDIETVLKKYSGEDWEIMDVDFADGGAVFTISAGSIELEE
Ga0181401_113013533300017727SeawaterMLDNLLDDIEAVLNKYSGSDWEIMDVDYADGGAVFT
Ga0181401_116351923300017727SeawaterDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGNISEEE
Ga0181401_117719433300017727SeawaterLLDDIEVVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV
Ga0181419_105753213300017728SeawaterRRLGGSRVMLDNLLAHIEAVLKKYSSSDWEIMDVDFADGGAVFTVSAGLKEEEDV
Ga0181419_114895113300017728SeawaterMLDALLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEE
Ga0187218_101840613300017737SeawaterKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEDECTS
Ga0187218_115039933300017737SeawaterDNLLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0181421_120088913300017741SeawaterALLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV
Ga0181399_1005048103300017742SeawaterLLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEEE
Ga0181399_108240333300017742SeawaterMLDALLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVD
Ga0181399_110328023300017742SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVD
Ga0181392_100863593300017749SeawaterGSRVMLDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGNITEELE
Ga0181392_107134043300017749SeawaterMKKRRLLMLDALLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEEE
Ga0181392_108951443300017749SeawaterLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEDV
Ga0181392_112802623300017749SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDVDYADGGAVFTVSAGNITEEEV
Ga0181392_121558913300017749SeawaterLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0187219_112438513300017751SeawaterMLDALLDDIEAVLKKYSGSDWEIMDIDFSDGGAVLTVSAGLKEEEDV
Ga0187219_117975523300017751SeawaterSSQSMKKRSLLMLDNLLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGNISEEE
Ga0181382_103508113300017756SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDIDYADGGAVFTVSAGNITEESE
Ga0181422_121423733300017762SeawaterLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV
Ga0181410_101125813300017763SeawaterLLDDIEAVLKKYSGTDWAIMDVDFSDGGAVFTVSAGNIKEDED
Ga0181410_120900823300017763SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQL
Ga0181385_100689213300017764SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLK
Ga0187220_118554923300017768SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGNITEESE
Ga0187217_1001622143300017770SeawaterMLDALLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEEE
Ga0187217_101034813300017770SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGNITEELE
Ga0181425_125093113300017771SeawaterRSIGGIVMLDNLLDDIEAVLNKYSGTDWEIMDVDYADGGAVFTVSAGNITEEEV
Ga0181430_125034313300017772SeawaterMLDALLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSA
Ga0181394_102311363300017776SeawaterVMLDNLLDDIEAVLKKYSGSDWEIMDVDYADGGAVFTVSAGNITEEEV
Ga0181394_113040813300017776SeawaterIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0181394_125854213300017776SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDVDFADGGAVFTVSAG
Ga0181423_126406413300017781SeawaterGDKGGGLLDDIQEVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEEE
Ga0181379_104580953300017783SeawaterMLDKLLDDIEAVLKKYSGSDWEIMDVDYADGGAVFTVSAGNITEEEV
Ga0188868_100263113300019077Freshwater LakeMLDALLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEDD
Ga0180037_102557913300019214EstuarineMLDNLLDDIEAVLKKYSGTDWAIMDVDFSDGGAVFTVSAGNISEEDDGES
Ga0211504_103420833300020347MarineMLDALLDDIEAVLKKHSGTDWEIMDIDFAEGGAVFTVSAGNIGDDDDLL
Ga0211504_107488923300020347MarineMLDALLDDIQEVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEDD
Ga0211505_100416023300020352MarineMSKMKKRRLLMLDALLDDIQEVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEDD
Ga0211576_1016884543300020438MarineMLDNLLDDIEAVLKKYSGTDWAIMDVDFSDGGAVFTVSAGNIKEDED
Ga0211576_1039405613300020438MarineMLDNLLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0206677_1001637233300021085SeawaterMLDALLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV
Ga0206677_1004919253300021085SeawaterMLDALLDDIEAVLKKYSGSDWEIMDIDFSDGGAVFTVSAGIKEEEDV
Ga0206677_1006527913300021085SeawaterLDALLDDIQEVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEEE
Ga0206687_115416423300021169SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDVDFDQGGAVFTVSAGNLG
Ga0206687_185479233300021169SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEDV
Ga0206682_1012333943300021185SeawaterMKKRRLLMLDALLDDIQEVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEEE
Ga0206682_1020232723300021185SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDVDFDQGGAVFTVSAGNLGVDNEEE
Ga0206682_1028515533300021185SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGNITEEEV
Ga0222717_1025258513300021957Estuarine WaterMLDNLLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEDEE
Ga0222717_1053885713300021957Estuarine WaterMLDNLLDDIEAVLKKYSGTDWAIMDVDFSDGGAVFTVSAGNIK
Ga0222716_1056295233300021959Estuarine WaterMLDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGNIT
(restricted) Ga0233426_1003672823300022920SeawaterMLDALLDDIEAVLKKYSGTDWEIMDVDFDQGGAVFTVSAGNLGVDNEEE
(restricted) Ga0233432_10032197113300023109SeawaterMLDALLDDIEAVLKKYSGTDWEIMDVDFADGGAVFTVSAGQLGVDNEEE
(restricted) Ga0233432_1009859623300023109SeawaterMLDALLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGNIKESED
(restricted) Ga0233432_1012356553300023109SeawaterMLDALLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGN
(restricted) Ga0233432_1031999123300023109SeawaterMLDALLDDIEAVLNKYSGTDWEIMDVDYADGGAVFTVSAGNITEESE
(restricted) Ga0233432_1043493113300023109SeawaterMLDNLLDDIEEVLKKYSGTDWEIMDVDFDDGGAVFTVS
Ga0232112_102644343300023693SeawaterEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0228667_107027433300024226SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV
Ga0228675_103396723300024247SeawaterMLDALLDDIEVVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV
(restricted) Ga0233438_1001415643300024255SeawaterMLDALLDDIQEVLKKYSGTDWEIMDVDFDDGGAVFTVSAGNLGVDNEEE
(restricted) Ga0233438_1005308283300024255SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGNIKESED
(restricted) Ga0233438_1012510853300024255SeawaterMLDNLLDDIEEVLKKYSGTDWEIMDVDFDDGGAVFTVSAGNIKESED
(restricted) Ga0233442_119983523300024257SeawaterSMRMRKKRRLLMLDALLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGNIKESED
(restricted) Ga0233441_118475923300024260SeawaterMLDALLDDIEAVLKKYSGTDWEIMDVDFDQGGAVFTVSAGNL
(restricted) Ga0233444_1016578063300024264SeawaterMLDNLLDDIEEVLKKYSGTDWEIMDVDFDNGGAVFTVSAGNIKESED
Ga0228664_104439613300024294SeawaterDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0228658_115826513300024297SeawaterSCRMLDALLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV
Ga0233398_112768813300024320SeawaterMLDNLLDDIEAVLKKYSGSDWEILDVDFADGGAVFTVSAGNIKEDED
Ga0228652_106370133300024326SeawaterLLDDIQEVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEEE
Ga0228631_110320213300024329SeawaterMLDNLLDDIEAVLKKYSGTDWAIMDVDFSDGGAVFTVS
Ga0244775_1005588423300024346EstuarineMSKTKKRRLPMLDALLDDIEAVLKKYSGTDWEIMDVDFDQGGAVFTVSAGNLGVDNEEE
Ga0244776_1044190913300024348EstuarineMLDALLDDIEAVLKKYSGTDWEIMDVDFADGGAVFTVSAGQ
Ga0228628_102071083300024359SeawaterEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGLKEEEDV
Ga0208667_101109423300025070MarineMLDDLLDDIEQVLKKYSGEDWEIMDVDFADGGAVFTISAGSISLEE
Ga0208791_103484723300025083MarineMLDDLLDDIEQVLKKYSGKDWEIMDVDFADGGAVFTISAGSISLEE
Ga0208792_100983243300025085MarineMLDDLLDDIEQVLKKYSGKDWEIMDVDFSDGGAVFTISAGSISLEE
Ga0208793_118867413300025108MarineMLDDLLDDIEQVLKKYSGKDWEIMDVDFSDGGAVF
Ga0209557_1001459343300025483MarineMLDDLLDDIETVLKKYSGTDWEIMDIDFADGGAVFTISAGSIKDEE
Ga0209654_102868743300025608MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGNISEEEV
Ga0209654_103888923300025608MarineMLDALLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGNISDEELAN
Ga0209138_113185713300025617MarineTVMLDNLLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEDV
Ga0209136_102030263300025636MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFADGGAVFTVSAGNISEEE
Ga0209136_107054843300025636MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGNISDEDE
Ga0209251_100421353300025668MarineMLDDLLDDIETVLKKYSGTDWEIMDIDFADGGAVFTISAGSIELEE
Ga0209251_116906633300025668MarineMLDNLLDDIEAVLNKYSGTDWEIMDVDFADGGAVFTVSAGNITEESE
Ga0209652_105456963300025684MarineIEAVLKKYSGTDWEIMDVDFDQGGAVFTVSAGNLGVDNEEE
Ga0209653_115313323300025695MarineMLDALLDDIEAVLKKYSGTDWEIMDVDFDDGGAVFTVSAGNLGVDNEEE
Ga0209137_113918543300025767MarineMLDNLLDDIEAVLKKYSGSDWEIMDVDFSDGGAVFTVSAGL
Ga0209137_117868813300025767MarineISWQSMRKRKRRLLMLDALLDDIEAVLKKYSGTDWEIMDVDFDQGGAVFTVSAGNLGVDNEEE
Ga0209603_106091123300025849Pelagic MarineMRKRRLLMLDALLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEDD
Ga0228644_109471813300026453SeawaterVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0247598_111669033300026466SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEE
Ga0247592_106437633300026500SeawaterLDNLLDDIEAMLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0247605_103451423300026503SeawaterMLDNLLDDIEAVLKKYSGSDWEIMDVDYADGGAVFTVSAGLKEEEE
Ga0208673_106365923300027192EstuarineMLDALLDDIQEVLKKYSGTDWEIMDVDFDQGGAVFTVSAGNLGVDNEEE
Ga0209037_106781423300027612MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGNITEEEV
Ga0208304_1009115343300027751EstuarineMSKTKKRRLPMLDALLDDIEAVLKKYSGTDWEIMDVDFDDGGAVFTVSAGNLGVDNEEE
Ga0209092_1034038633300027833MarineKKKRRLLMLDALLDDIQEVLKKYSGTDWEIMDVDFDDGGAVFTVSAGNLGVDNEEE
Ga0209092_1037688613300027833MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFDDGGAVFTVSAGNLGVDNEEE
Ga0228674_100691663300028008SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEEE
Ga0247582_109530733300028109SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0247584_115558933300028110SeawaterEAVLNKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEE
Ga0228619_109377743300028130SeawaterAVLKKYSGSDWEIMDVDFADGGAVFTVSAGLKEEEDV
Ga0256411_121715513300028134SeawaterPTRGDSVMLDNLLDDIEAVLKKYSGSDWEILDVDFADGGAVFTVSAGNIKEDED
Ga0256411_127257913300028134SeawaterMLDNLLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVS
Ga0257114_1010813163300028196MarineMLDALLDDIEAVLKKYSGTDWEIMDVDFSDGGAVFTVSAGIKEDEDV
Ga0228640_111781813300028273SeawaterMLDALLDDIEAVLKKYSGSDWEIMDVDFSDGGAVF
Ga0257126_115483413300028287MarineMLDNLLDDIEAVLKKYSGTDWEIMDVDFADGGAVFT
Ga0315320_1066420533300031851SeawaterSCRMLDALLDDIEAVLKKYSGSDWEIMDIDFSEGGAVFTVSAGIKEEEDV
Ga0315321_1025497543300032088SeawaterMKKRRLLMLDNLLDDIEAVLKKYSGTDWEIMDIDFADGGAVFTVSAGQLGVDNEEE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.