NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F039998

Metagenome Family F039998

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039998
Family Type Metagenome
Number of Sequences 162
Average Sequence Length 43 residues
Representative Sequence TGKVDMREQRRELRLKFVSNVAGGDYQVGKVLLDADFGDVRPY
Number of Associated Samples 113
Number of Associated Scaffolds 162

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 3.09 %
% of genes near scaffold ends (potentially truncated) 94.44 %
% of genes from short scaffolds (< 2000 bps) 86.42 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (90.741 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(25.309 % of family members)
Environment Ontology (ENVO) Unclassified
(66.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(69.136 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.23%    β-sheet: 0.00%    Coil/Unstructured: 95.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 162 Family Scaffolds
PF10118Metal_hydrol 8.64
PF02801Ketoacyl-synt_C 2.47
PF00109ketoacyl-synt 1.23
PF07460NUMOD3 1.23
PF13946DUF4214 1.23
PF05866RusA 0.62
PF00128Alpha-amylase 0.62
PF11397GlcNAc 0.62

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 162 Family Scaffolds
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.62
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.62
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.62
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.62
COG4570Holliday junction resolvase RusA (prophage-encoded endonuclease)Replication, recombination and repair [L] 0.62


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.77 %
UnclassifiedrootN/A1.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2222084011|2225749127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4201Open in IMG/M
3300001838|RCM33_1080839All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300001839|RCM40_1036659Not Available1042Open in IMG/M
3300001850|RCM37_1361721All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300001851|RCM31_10141876All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300002142|M2t2FKB2_1593577All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300002835|B570J40625_100671622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage933Open in IMG/M
3300003394|JGI25907J50239_1007567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2590Open in IMG/M
3300003394|JGI25907J50239_1111395Not Available532Open in IMG/M
3300004054|Ga0063232_10007238All Organisms → Viruses → Predicted Viral2331Open in IMG/M
3300004096|Ga0066177_10218570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage787Open in IMG/M
3300004240|Ga0007787_10620037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300004448|Ga0065861_1100215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage946Open in IMG/M
3300004773|Ga0007795_10233557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300004807|Ga0007809_10208584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300005581|Ga0049081_10131213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage924Open in IMG/M
3300005581|Ga0049081_10349433All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300005584|Ga0049082_10266246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300005992|Ga0073924_1057804All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300006802|Ga0070749_10455085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage701Open in IMG/M
3300006875|Ga0075473_10158086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage911Open in IMG/M
3300006875|Ga0075473_10248359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage719Open in IMG/M
3300007276|Ga0070747_1340999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300007363|Ga0075458_10106406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage873Open in IMG/M
3300007640|Ga0070751_1247033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300007974|Ga0105747_1312742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300008107|Ga0114340_1063794All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1573Open in IMG/M
3300008116|Ga0114350_1129427All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage743Open in IMG/M
3300008448|Ga0114876_1022077All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3278Open in IMG/M
3300009026|Ga0102829_1066359All Organisms → Viruses → Predicted Viral1097Open in IMG/M
3300009068|Ga0114973_10076163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1933Open in IMG/M
3300009081|Ga0105098_10233056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage862Open in IMG/M
3300009151|Ga0114962_10120683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1608Open in IMG/M
3300009151|Ga0114962_10308059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300009151|Ga0114962_10629520All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage554Open in IMG/M
3300009154|Ga0114963_10034161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3334Open in IMG/M
3300009154|Ga0114963_10234559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1047Open in IMG/M
3300009154|Ga0114963_10684474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300009158|Ga0114977_10160478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1335Open in IMG/M
3300009161|Ga0114966_10279962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1017Open in IMG/M
3300009161|Ga0114966_10441992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage752Open in IMG/M
3300009161|Ga0114966_10456015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage737Open in IMG/M
3300009161|Ga0114966_10678620All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage566Open in IMG/M
3300009164|Ga0114975_10568612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300009180|Ga0114979_10743307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300009182|Ga0114959_10272229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae853Open in IMG/M
3300009182|Ga0114959_10627935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300009184|Ga0114976_10024689All Organisms → Viruses → Predicted Viral3644Open in IMG/M
3300009184|Ga0114976_10090287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1757Open in IMG/M
3300009184|Ga0114976_10673183All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300009187|Ga0114972_10467050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage718Open in IMG/M
3300009684|Ga0114958_10415279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300010158|Ga0114960_10129796All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1374Open in IMG/M
3300010160|Ga0114967_10448895All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300010885|Ga0133913_10230904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4920Open in IMG/M
3300010885|Ga0133913_10830115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2406Open in IMG/M
3300010885|Ga0133913_12013708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1434Open in IMG/M
3300010885|Ga0133913_12805713All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1173Open in IMG/M
3300010885|Ga0133913_13221612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1078Open in IMG/M
3300011184|Ga0136709_1048845All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage587Open in IMG/M
3300012012|Ga0153799_1039699All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage883Open in IMG/M
3300012017|Ga0153801_1056198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage692Open in IMG/M
3300012666|Ga0157498_1037661All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage744Open in IMG/M
3300013004|Ga0164293_10163318All Organisms → Viruses → Predicted Viral1642Open in IMG/M
(restricted) 3300013126|Ga0172367_10185351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1328Open in IMG/M
(restricted) 3300013128|Ga0172366_10737403All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
(restricted) 3300013131|Ga0172373_10846280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
(restricted) 3300013133|Ga0172362_10367727All Organisms → Viruses → Predicted Viral1006Open in IMG/M
3300013295|Ga0170791_11029967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage823Open in IMG/M
3300013372|Ga0177922_10154302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage936Open in IMG/M
3300013372|Ga0177922_10985018All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1810Open in IMG/M
3300013372|Ga0177922_11058187All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage918Open in IMG/M
3300013372|Ga0177922_11293955All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2318Open in IMG/M
3300017700|Ga0181339_1035716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300017701|Ga0181364_1002208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3462Open in IMG/M
3300017716|Ga0181350_1081209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300017716|Ga0181350_1099461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage717Open in IMG/M
3300017747|Ga0181352_1048195All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1245Open in IMG/M
3300017747|Ga0181352_1159177All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300017754|Ga0181344_1023108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1920Open in IMG/M
3300017754|Ga0181344_1115048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300017754|Ga0181344_1158269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300017754|Ga0181344_1160275All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300017754|Ga0181344_1184890All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage587Open in IMG/M
3300017761|Ga0181356_1067001All Organisms → Viruses → Predicted Viral1211Open in IMG/M
3300017761|Ga0181356_1089941All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1010Open in IMG/M
3300017761|Ga0181356_1242391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300017777|Ga0181357_1045965All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1711Open in IMG/M
3300017777|Ga0181357_1060461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1467Open in IMG/M
3300017777|Ga0181357_1165512All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage807Open in IMG/M
3300017778|Ga0181349_1116335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage988Open in IMG/M
3300017778|Ga0181349_1218434All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300017778|Ga0181349_1264350All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300017778|Ga0181349_1290666All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300017784|Ga0181348_1005375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5655Open in IMG/M
3300017785|Ga0181355_1089391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1281Open in IMG/M
3300017785|Ga0181355_1166318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage883Open in IMG/M
3300018416|Ga0181553_10160307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1331Open in IMG/M
3300018416|Ga0181553_10745575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage509Open in IMG/M
3300019784|Ga0181359_1094742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1102Open in IMG/M
3300020159|Ga0211734_10736473All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2471Open in IMG/M
3300020550|Ga0208600_1020168All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1065Open in IMG/M
3300021133|Ga0214175_1007388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1699Open in IMG/M
3300021963|Ga0222712_10067619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2596Open in IMG/M
3300022190|Ga0181354_1197535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300022407|Ga0181351_1086241All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1241Open in IMG/M
3300022407|Ga0181351_1165783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300022407|Ga0181351_1181074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage725Open in IMG/M
3300022407|Ga0181351_1198615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage673Open in IMG/M
3300022407|Ga0181351_1215538All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300023179|Ga0214923_10459280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300025369|Ga0208382_1001468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6411Open in IMG/M
3300025732|Ga0208784_1000037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage56663Open in IMG/M
3300025872|Ga0208783_10036228All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus2322Open in IMG/M
3300025889|Ga0208644_1277487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300027538|Ga0255085_1059460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage823Open in IMG/M
3300027621|Ga0208951_1018643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2219Open in IMG/M
3300027708|Ga0209188_1063631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1587Open in IMG/M
3300027732|Ga0209442_1280966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300027733|Ga0209297_1164008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage904Open in IMG/M
3300027741|Ga0209085_1223326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae753Open in IMG/M
3300027763|Ga0209088_10153049All Organisms → Viruses → Predicted Viral1018Open in IMG/M
3300027763|Ga0209088_10190979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage881Open in IMG/M
3300027770|Ga0209086_10157278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1091Open in IMG/M
3300027782|Ga0209500_10254382All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300027785|Ga0209246_10003123All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6267Open in IMG/M
3300027785|Ga0209246_10044094All Organisms → Viruses → Predicted Viral1712Open in IMG/M
3300027785|Ga0209246_10328731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300027808|Ga0209354_10004678All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5608Open in IMG/M
3300027971|Ga0209401_1229685All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage676Open in IMG/M
3300028025|Ga0247723_1018863All Organisms → Viruses → Predicted Viral2376Open in IMG/M
3300028025|Ga0247723_1124314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300028178|Ga0265593_1056714All Organisms → Viruses → Predicted Viral1108Open in IMG/M
3300028392|Ga0304729_1173316All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300031772|Ga0315288_11474398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300031787|Ga0315900_10291873All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1358Open in IMG/M
3300031787|Ga0315900_11130431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300031951|Ga0315904_10591651All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage957Open in IMG/M
3300031952|Ga0315294_10816399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage801Open in IMG/M
3300031952|Ga0315294_11562767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300031999|Ga0315274_10732388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1062Open in IMG/M
3300031999|Ga0315274_11494268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300032050|Ga0315906_10663512All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage845Open in IMG/M
3300032053|Ga0315284_11316283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage783Open in IMG/M
3300032562|Ga0316226_1271953All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300032676|Ga0316229_1262770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300032722|Ga0316231_1325661All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300033233|Ga0334722_11326962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300033984|Ga0334989_0623323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300034061|Ga0334987_0349174All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage958Open in IMG/M
3300034062|Ga0334995_0614630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300034062|Ga0334995_0675503All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300034062|Ga0334995_0767717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300034092|Ga0335010_0642039All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300034096|Ga0335025_0650281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300034104|Ga0335031_0030121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3957Open in IMG/M
3300034112|Ga0335066_0087851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1984Open in IMG/M
3300034112|Ga0335066_0537710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300034118|Ga0335053_0079420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2299Open in IMG/M
3300034120|Ga0335056_0553553All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300034121|Ga0335058_0346770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage858Open in IMG/M
3300034166|Ga0335016_0124517All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1802Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake25.31%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake22.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater11.11%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.56%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.94%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.47%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton2.47%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.47%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.85%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.23%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.23%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment1.23%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.62%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.62%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.62%
Coastal LagoonEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon0.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.62%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.62%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.62%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.62%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.62%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.62%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.62%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.62%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.62%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2222084011Coastal lagoon microbial communities from Albufera, Spain - Sample 1EnvironmentalOpen in IMG/M
3300001838Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2aEnvironmentalOpen in IMG/M
3300001839Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3bEnvironmentalOpen in IMG/M
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300001851Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3bEnvironmentalOpen in IMG/M
3300002142M2t3t2 FKB2 (115f)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004096Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004773Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1MEnvironmentalOpen in IMG/M
3300004807Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07EnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005992Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011184Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaGEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017700Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.DEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021133Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnionEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027538Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8dEnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027770Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028178Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36mEnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032676Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023EnvironmentalOpen in IMG/M
3300032722Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
22251503992222084011Coastal LagoonTNKIDMREQRRELRLKCRSNVVGGDYQLGKIILNADVGDVRGY
RCM33_108083913300001838Marine PlanktonKIDLREQRRELRLIFTSNVQGGNYQLGKVLLHANVGDVRP*
RCM40_103665913300001839Marine PlanktonLREQRRELRVKFESNVVRGDYQTGNVILHGEIGDVRGTS*
RCM37_136172133300001850Marine PlanktonKVDLREQRRELRLIFVSDVQDGEYQLGRIMLSANVGDVRPY*
RCM31_1014187633300001851Marine PlanktonDTGKIDMREQRRELRLKFVSNVAGGDYQLGRVILNADIGDVRPY*
M2t2FKB2_159357713300002142MarineFDPDTGKIDMRQQRREIRLLFRSNVSGGDYEMGKVLLSVTLGDSRPYGS*
B570J40625_10067162213300002835FreshwaterKEQRRLLRLKFVSNVADGNYQAGKVIVDADVGDVRGYSTS*
JGI25907J50239_100756713300003394Freshwater LakeIDMREQRRELRLKFESNVVGGDYQLGYILLSADIGDVRP*
JGI25907J50239_111139513300003394Freshwater LakeKIDMKEQRREMRLKFVSNTLNGNYQVGRLLLNATFGDVRGY*
Ga0063232_1000723813300004054Freshwater LakeKISDAFVFTPTTGKIDMKEQRREMRLRFVSNIAGGDYQLGKVLLSGAIGDVRGYE*
Ga0066177_1021857013300004096Freshwater LakeAFVFTPTTGKIDMKEQRREMRLIFVSDIAGGDYQLGKVMLSGAIGDVRGYE*
Ga0007787_1062003713300004240Freshwater LakeETSTAYVFAPSTNKIDMKEQRRELRVKFVSNVAGGDYQLGKVLLNATIGDVRGY*
Ga0065861_110021543300004448MarinePDTGKIDMRQQRREIRLRFKSNVQGGTYQLGRVLLSVTFGDSRPY*
Ga0007795_1023355713300004773FreshwaterTGKIDMREQRRELRLRFISNVAGGNYQLGRVLLDADIGDTRPYG*
Ga0007809_1020858413300004807FreshwaterLKVDMREQRRELRLRFTSNVVGGNYFMGKVLVSLDTGDVRSTANP*
Ga0049081_1013121343300005581Freshwater LenticRELRLRFTSNVAGGNYQLGRVLVSATIGDVRGYE*
Ga0049081_1034943333300005581Freshwater LenticFGPNTGKIDMREQRRELRLRFTSDVAGGNYQLGKLVLNAEIGDVRPYGP*
Ga0049082_1026624613300005584Freshwater LenticMREQRREIRLFFKSNVEGGNYQMGRVLLSATVGDVRP*
Ga0073924_105780433300005992SandTNKIDMREQRRLGRLKFGSNVQGGNYQMGRILISANFGDVRGF*
Ga0070749_1045508523300006802AqueousMREQRRELRLKFRSNVTGGDYQLGKVILNADVGDVRGY*
Ga0075473_1015808643300006875AqueousQRREMRLKFVSNTLNGNYQVGRLLLNATFGDVRGY*
Ga0075473_1024835933300006875AqueousREQRREMRLKFVSNVAGGNYQAGKILADADFGDVRGY*
Ga0070747_134099933300007276AqueousTGKIDLREQRRELRLKFVSNVAGGNYQMGKVIVNADFGDVRGY*
Ga0075458_1010640613300007363AqueousRRELRLIFRSNVVGGDYQTGRVILSADIGDVRGY*
Ga0070751_124703313300007640AqueousKIDMKEQRRELRLKFESNEAGGNYQLGRTLLNATIGDVRGY*
Ga0105747_131274233300007974Estuary WaterDMREQRRELRLIFTSNVAGGDYQLGKVLLHANVGDVRP*
Ga0114340_106379413300008107Freshwater, PlanktonPNTHKIDMKEQRRELRLKFESNVVGGDYQLGYLLLSADIGDVRGY*
Ga0114350_112942713300008116Freshwater, PlanktonSTGKIDMRQQRREIRLIFKSNVQGGDYQMGKVLLTVTLGDSRPYGS*
Ga0114876_102207733300008448Freshwater LakeELRLKFESNVVGGDYQMGRILLSLDMGDVRGYTP*
Ga0102829_106635913300009026EstuarineTFTPSTGKVDMREQRRELRLKFVSNVTGGNYQLGKLLLDADFGDVRPY*
Ga0114973_1007616353300009068Freshwater LakeVFGPNTGKVDMREQRRELRLKFISNTAGGDYQLGKLLLSAEVGDARPYGP*
Ga0105098_1023305633300009081Freshwater SedimentEQRRELRLRFTSNIVGGNYQLGKLLLNADLGDVRGFGS*
Ga0114962_1012068313300009151Freshwater LakeIDLREQRREIRFRFVSDVAGGNYQLGKVIVTAEIGDTRPYGS*
Ga0114962_1030805913300009151Freshwater LakePNTGKVDMREQRRELRIRFRSNVAGGNYQLGRVLLSAAFGDVRPY*
Ga0114962_1062952033300009151Freshwater LakeIDLREQRREIRFRFVSDVAGGNYQLGKVIVTAEIGDTRPYGA*
Ga0114963_1003416113300009154Freshwater LakeNTGKVDMREQRRELRIRFRSNVAGGNYQLGRVLLSAAFGDVRPY*
Ga0114963_1023455913300009154Freshwater LakeRELRLKFISNTAGGDYQLGKLLLSAEVGDARPYGP*
Ga0114963_1068447433300009154Freshwater LakeKVDMREQRREIRLRFRSNVVGGDYQLGKLLLSATIGDVRPY*
Ga0114977_1016047833300009158Freshwater LakeYNFGENTGKIDMREQRREIRFRFVSDVAGGNYQLGRVIVTAEIGDTRPYGA*
Ga0114966_1027996213300009161Freshwater LakeEQRRELRLRFISDVAGGNYQLGKLLLTAEIGDVRPYGP*
Ga0114966_1044199213300009161Freshwater LakeHKIDMKEQRRELRLRFTSNVQGGDYQMGRVLLSADTGDVRGY*
Ga0114966_1045601533300009161Freshwater LakeAEFTFSPDTGKVDMREQRRELRIRFRSNVAGGNYQLGKLLLNATIGDVRPY*
Ga0114966_1067862033300009161Freshwater LakeMREQRRELRLRFVSNTQGGNYQMGRVIIDAEFGDTRPYGS*
Ga0114975_1056861233300009164Freshwater LakeQTTGRIDLREQRRELRLRFRSNVQGGDYQLGRLLLNADTGDVRPY*
Ga0114979_1074330733300009180Freshwater LakeNTGKIDMKEQRREMRLRFTSNTLNGDYQLGKTLLSAEIGDVRGY*
Ga0114959_1027222913300009182Freshwater LakeNTNKIDMKEQRRELRLKFVSNEAGGDYQLGRVLLNADLAGDTRGY*
Ga0114959_1062793533300009182Freshwater LakeEQRRELRLRFRSNIAGGNYQLGKILLNATIGDVRPY*
Ga0114976_1002468913300009184Freshwater LakeNFGENTGKIDMREQRREIRFRFVSDVAGGNYQLGRVIVTAEIGDTRPYGA*
Ga0114976_1009028743300009184Freshwater LakeRELRLKFVSNVQGGNYQLGKVIVNAELGDVRGYST*
Ga0114976_1067318313300009184Freshwater LakeNKIDMREQRRELRLKFVSNVQGGNYQLGKVIITADLGDVRGYSS*
Ga0114972_1046705013300009187Freshwater LakeVFDPDTKKIDLREQRRELRLIFTSNVQGGNYQLGKVLLSANVGDVRP*
Ga0114958_1041527913300009684Freshwater LakeGPNTGKVDMREQRREIRLRFRSNTVGGNYQLGKLLLSAAIGDVRPY*
Ga0114960_1012979613300010158Freshwater LakeVDMREQRRELRIRFRSNVAGGNYQLGRVLLSAAFGDVRPY*
Ga0114967_1044889533300010160Freshwater LakeRELRLKFTSDVAGGNYQLGKVLLSGEVGDARPYGS*
Ga0133913_1023090413300010885Freshwater LakePDTHKIDMKEQRRELRLRFTSNVQGGDYQMGRVLLSADTGDVRGY*
Ga0133913_1083011513300010885Freshwater LakePNTGKIDMREQRREIRLRFTSNVQGGNYQMGKILLSANVGDVRPYGS*
Ga0133913_1201370813300010885Freshwater LakeTNKIDMREQGRELRLRFVSNVTGGNYQVGRVIVNVDFGDVRGY*
Ga0133913_1280571333300010885Freshwater LakeGKIDLREQRRELRLRFVSNTQNGNYQLGVLLLSADIGDVRP*
Ga0133913_1322161243300010885Freshwater LakeSKIDMREQGRELRLKFVSNEAGGDYQTGRILLNANVGDVRGYS*
Ga0136709_104884513300011184FreshwaterFDPDTNKIDMREQRRELRVRIVSNVAGGNYQLGRLLLSANVGDVRGY*
Ga0153799_103969923300012012FreshwaterVFDGTTNKIDMKEQRRELRLKFRSNTAGGNYQTGRVIVSADIGDVRGY*
Ga0153801_105619833300012017FreshwaterTFSPTTGKVDMREQRRELRLKFVSNVAGGNYQVGKILLDADLGDVRP*
Ga0157498_103766123300012666Freshwater, Surface IceMREQRRELRLKFVSNVAGGNYQVGKILLDAEFGDVRP*
Ga0164293_1016331813300013004FreshwaterTNKIDIREQRREFRLKFVSNVSGGDYQLGRLLLSANVGDVRGY*
(restricted) Ga0172367_1018535113300013126FreshwaterPYMFAPGTGKVDMKEQRRELRLKFVSNVAGGNYQLGKVLISADEGDVRGYST*
(restricted) Ga0172366_1073740333300013128SedimentDMKEQRRELRLKFVSNQAGGNYQMGKVIVSADLGDVRGYST*
(restricted) Ga0172373_1084628033300013131FreshwaterTFASGTGKVDMKEQRRELRLKFVSNVAGGNYQLGKILISADEGDVRGYST*
(restricted) Ga0172362_1036772723300013133SedimentMKEQRREMRIRFVSNEAGGNYQMGKVILNATFGDVRGY*
Ga0170791_1102996733300013295FreshwaterLPDTHKIDMREQRRELRLRFVSNVQGGDYQLGRIIINADFGDVRPY*
Ga0177922_1015430213300013372FreshwaterAYTFTSTTGKVDMREQRRELRLKFVSNVTGGNYQVGKILLDADFGDVRP*
Ga0177922_1098501833300013372FreshwaterVFDANIGKIDMKEQRRELRLRFTSNIVGGNYQLGKLLLNADLGDVRGFGS*
Ga0177922_1105818713300013372FreshwaterKIDIREQRRELRLRFLSNVVNGDYQVGRIVLNANTGDVRPYGA*
Ga0177922_1129395513300013372FreshwaterFDSVTGKVDMKEQRRLLRLQFVSNQVDADYQAGKILVDADIGDVRGYTV*
Ga0181339_103571633300017700Freshwater LakePTTGKIDLREQRREIRLIFTSNVAGGDYQLGKILLHANVGDVRP
Ga0181364_100220813300017701Freshwater LakeVDMREQRRELRLKFVSNVAGGTYQVGKILLDADFGDVRP
Ga0181350_108120933300017716Freshwater LakeGPYPFDPDTGKVDMRAQRRELRLKFVSNVAGGNYQVGKIILDADLGDVRP
Ga0181350_109946113300017716Freshwater LakePFDPDTGKVDMREQRRELRLKFVSNVAGGNYQVGKIILDADLGDVRP
Ga0181352_104819513300017747Freshwater LakeTGKVDMREQRRELRLKFVSNVAGGDYQVGKVLLDADFGDVRPY
Ga0181352_115917713300017747Freshwater LakeSPDTGKVDMREQRRELRLKFVSNVAGGDYQVGKVILDADLGDVRP
Ga0181344_102310813300017754Freshwater LakeREQRRELRLKFESNVVGGDYQLGYLLLSADIGDVRP
Ga0181344_111504843300017754Freshwater LakeGKIDMREQRCECRLKFVSNTVNGNYQLGRLLLSANVGDVRGY
Ga0181344_115826913300017754Freshwater LakeKIDVREQRRELRVIFGSNVAGGDYQLGKLLLDADFGDTRGY
Ga0181344_116027533300017754Freshwater LakeKIDLREQRRELRLQFVSDVQDGDYQLGRVLLSATLGDVRPY
Ga0181344_118489013300017754Freshwater LakeAFTPTTGKVDMREQRRELRLKFVSNVTGGNYQVGKIILDADFGDVRPY
Ga0181356_106700113300017761Freshwater LakeGKVDMREQRRELRLKFVSNVAGGNYQVGKIILDADLGDVRP
Ga0181356_108994113300017761Freshwater LakeTGKIDMREQRREIRLFFKSNVEGGNYQMGRVLLSATIGDVRP
Ga0181356_124239133300017761Freshwater LakeGPNNGKIDMREQRRELRLKFTSDVAGGDYQLGKVLLSAEIGDVRPYGP
Ga0181357_104596543300017777Freshwater LakeKIDMREQRRELRLKFESNVVGGDYQLGYLLLSADIGDVRP
Ga0181357_106046113300017777Freshwater LakeEQRRELRLRFTSDVAGGNYQLGKLVLNAEIGDVRPYGP
Ga0181357_116551233300017777Freshwater LakeQRREMRLRFVSNIAGGDYQLGKVLLSGAIGDVRGYE
Ga0181349_111633533300017778Freshwater LakeDPDTGKIDMREQRREIRLFFKSNVEGGNYQMGRVLLSATIGDGRP
Ga0181349_121843413300017778Freshwater LakeMREQRRELRLKFVSNVAGGDYQVGKILLDADVGDSRPYG
Ga0181349_126435033300017778Freshwater LakeVFSPTTGKIDMKEQRRELRIKIVSNVLGGDYQLGKILLNADVGDVRGYG
Ga0181349_129066633300017778Freshwater LakeGKIDMREQRRELRLRFTSDVAGGNYQMGKVLLTADVGDARPYGS
Ga0181348_100537553300017784Freshwater LakeFDPETHRVDMREQRRELRLKFLSNTQGGDYQLGRLLLAANIGDVRGY
Ga0181355_108939113300017785Freshwater LakeQRRELRLRFTSNVAGGNYQLGRVLVSATIGDVRGYE
Ga0181355_116631813300017785Freshwater LakeKEQRRELRLQFRSNVVGGDYQTGKIVISADIGDVRGY
Ga0181553_1016030743300018416Salt MarshEQRREIRLRFVSNVVGGNYQLGKLLVTAEIGDTRPYGS
Ga0181553_1074557533300018416Salt MarshPGTGKIDMKEQRRILRLKFVSNVAGGDYQVGKIIVDADTGDVRGYST
Ga0181359_109474213300019784Freshwater LakeFGPNNGKIDMREQRRELRLKFTSDVAGGDYQLGKILLSAEIGDVRPYGP
Ga0211734_1073647363300020159FreshwaterVFTPSTGKIDMRQQRREIRLRFASNVQGGDYQMGKVLLTVTLGDSRPYGS
Ga0208600_102016833300020550FreshwaterVKIDMREQRRELRLKFTSDVAGGDYQLGKILLSAEIGDSRPYGS
Ga0214175_100738833300021133FreshwaterREPRLKFNSNVVGGDYQMGNVLISAEISDVRGTGNP
Ga0222712_1006761933300021963Estuarine WaterQRRELRIKIVSNVLGGDYQLGKILLNADVGDVRGYG
Ga0181354_119753533300022190Freshwater LakeKIDMREQRRELRLKFISDVAGGDYQLGKILLSAEIGDVRPYGP
Ga0181351_108624143300022407Freshwater LakeEQRRELRLQFRSNVVGGDYQTGKIVISADIGDVRGY
Ga0181351_116578333300022407Freshwater LakeGKIDMREQRREIRLFFKSNVEGGNYQMGRVLLSATVGDVRP
Ga0181351_118107413300022407Freshwater LakeGKIDMRQQRREIRLIFKSNVQGGDYQMGKVLLTVTLGDSRPYGS
Ga0181351_119861513300022407Freshwater LakeKIDMREQRRELRLKFTSDVAGGDYQLGKVLLSAEIGDVRPYGS
Ga0181351_121553813300022407Freshwater LakeDKQSDAYVFSPTTGKIDMKEQRRELRIKIVSNVLGGDYQLGKILLNADVGDVRGYG
Ga0214923_1045928033300023179FreshwaterKEQRRILRLKFVSNIANGDYQTGKIIVDADMGDVRGYST
Ga0208382_100146863300025369FreshwaterFDMSTGKIDMKEQRRELKLQFVSNQQNGDYQCGRILVDADFGDVRGY
Ga0208784_100003713300025732AqueousPGTSKIDMKEQRRLLRLKFVSNVAGGDYQTGKIIVDADTGDVRGYTV
Ga0208783_1003622833300025872AqueousRELRLKFESNIIGGDYQMGRILLSLDMGDVRGYTP
Ga0208644_127748733300025889AqueousKIDMKEQRRELRLKFESDEAGGNYQLGRVLLSATTGDVRGY
Ga0255085_105946013300027538FreshwaterDLREQRRELRLIFTSNVQGGDYQLGRVLLSANVGDVRP
Ga0208951_101864313300027621Freshwater LenticGKIDMRQQRREIRLIFKSNVQGGDYQMGKVLLSVTLGDVRPFGS
Ga0209188_106363143300027708Freshwater LakeGPNTGKVDMREQRRELRIRFRSNVAGGNYQLGRVLLSAAFGDVRPY
Ga0209442_128096613300027732Freshwater LakeIDMREQRRELRLKFESNVVGGDYQLGYLLLSADIGDVRP
Ga0209297_116400813300027733Freshwater LakeEQRREIRFRFVSDVAGGNYQLGRVIVTAEIGDTRPYGA
Ga0209085_122332633300027741Freshwater LakeVFDANTNKIDMKEQRRELRLKFVSNEAGGDYQLGRVLLNADLAGDTRGY
Ga0209088_1015304933300027763Freshwater LakeFSPSTGKIDMREQRRELRLRFVSNVAGGTYQVGKILLDADVGDSRPYG
Ga0209088_1019097933300027763Freshwater LakeYTFSPTTGKIDVREQRRELRLKFRSNVLNGDYQLGRMLLNADTGDVRPYGS
Ga0209086_1015727843300027770Freshwater LakeEKVDLKEQRRELRVRIRSNVSGGDYQLGKMLLDAETGDVRG
Ga0209500_1025438233300027782Freshwater LakeDMREQRRELRLKFVSNVAGGTYQLGKVILDADLGDVRPY
Ga0209246_1000312353300027785Freshwater LakeDMREQRRELRLKFISDVAGGDYQLGKILLSAEIGDVRPYGP
Ga0209246_1004409413300027785Freshwater LakeREQRRELRLKFVSNVAGGDYQMGKVIVSADLGDTRGYNT
Ga0209246_1032873133300027785Freshwater LakeDTRKIDLREQRRELRLIFTSNTQGGDYQLGKVLLHANVGDVRP
Ga0209354_1000467813300027808Freshwater LakeRRELRLKFTSDVAGGDYQLGKILLSAEIGDVRPYGP
Ga0209401_122968513300027971Freshwater LakeDMREQRRELRLKFISNTAGGDYQLGKLLLSAEVGDARPYGP
Ga0247723_101886333300028025Deep Subsurface SedimentIDMREQRREIRLRFTSNVQGGNYQMGRILLSANVGDVRPFGG
Ga0247723_112431433300028025Deep Subsurface SedimentDMREQRRELRLKFVSNVQGGNYQLGKVIVNAELGDVRGYST
Ga0265593_105671443300028178Saline WaterDPDTHKIDMKEQRREMRLKFVSNTLNGNYQVGRLLLNATFGDVRGY
Ga0304729_117331633300028392Freshwater LakeTEYVFGPNTGKVDMREQRRELRIRFRSNVAGGNYQLGRVLLSAAFGDVRPY
Ga0315288_1147439833300031772SedimentKIDMKEQRRELRIKIVSNVLGGDYQLGKILLNADVGDVRGYG
Ga0315900_1029187313300031787FreshwaterQRRELRVKFVSNVAGGDYQLGKVLLNATIGDVRGY
Ga0315900_1113043113300031787FreshwaterPYPFDPDTGKVDMREQRRELRLKFVSNVAGGNYQVGKVVLDADVGDVRP
Ga0315904_1059165113300031951FreshwaterRRLLRLKFVSNVANGNYQVGKIIVDADIGDVRGYST
Ga0315294_1081639913300031952SedimentVTSESYVFDPDTKKIDLREQRRELRLIFTSNVQGGDYQLGKVLLSANVGDVRP
Ga0315294_1156276713300031952SedimentKIDMRQQRREIRLRFRSNEQGGNYQMGKVLLSVTLGDVRPFGN
Ga0315274_1073238843300031999SedimentTGKIDMREQRRELRLKFESNVVGGDYQLGYLLLSADIGDVRP
Ga0315274_1149426813300031999SedimentTGKIDMKEQRRELRIKVVSNVLGGDYQLGKMLLNADVGDVRGYG
Ga0315906_1066351243300032050FreshwaterTSDPFVFAPNTNKIDMKEQRRELRMKFVSNVAGGDYQLGKVLLNATIGDVRGY
Ga0315284_1131628343300032053SedimentTGKIDMRQQRREIRLRFRSNVSGGDYQMGKVLLSVTIGDSRPYGT
Ga0316226_127195313300032562FreshwaterQRREMRLKFVSNVAGGNYQLGRIMLDADVGDVRGYS
Ga0316229_126277013300032676FreshwaterIDLKEQRREMRLRFVSNVAGGNYQLGRIMLDADVGDVRGYS
Ga0316231_132566133300032722FreshwaterSSTLKIDLREQRRELRLRFESNVQGGNYQVGKILLSIDAGDIRGTGNP
Ga0334722_1132696233300033233SedimentSTGKVDMREQRRELRLKFVSNVAGGNYQLGKIILDADLGDVRP
Ga0334989_0623323_330_4523300033984FreshwaterMREQRRELRLKFTSDVAGGNYQLGKLLLDAEIGDVRPYGP
Ga0334987_0349174_3_1583300034061FreshwaterYPFEPGTTKIDLREQRRELRLKFVSNVSGGDFQMGKVIVNADLGDVRGYST
Ga0334995_0614630_2_1573300034062FreshwaterTGPYVFSPDTGKVDMREQRRELRLKFVSNVAGGNYQVGKVILDADLGDVRP
Ga0334995_0675503_3_1433300034062FreshwaterNTGKIDLREQRRELRLKFTSDVAGGNYQLGKLLLSAEIGDVRPYGS
Ga0334995_0767717_385_5313300034062FreshwaterSPTTGKIDIREQRRELRLRFLSNVVNGDYQVGRIVLNANTGDVRPYGA
Ga0335010_0642039_415_5313300034092FreshwaterLREQRRELRLRFRSNVQGGNYQLGRLLLNADTGDVRPY
Ga0335025_0650281_403_5133300034096FreshwaterRRLLRLKFVSNQVDGDYQTGKVIVDADFGDVRGYTV
Ga0335031_0030121_18_1403300034104FreshwaterMKEQRRVLQLKFVSDTVGGDYQAGKIILDADFGDVRGYTV
Ga0335066_0087851_1_1533300034112FreshwaterPYVFDGNTNKIDMKEQRRELRLQFRSNVVGGDYQTGKIIISADIGDVRGY
Ga0335066_0537710_26_1393300034112FreshwaterMLEQRRELRLKFVSNVAGGNYQLGKVILNADLGDVRP
Ga0335053_0079420_47_1693300034118FreshwaterMKEQRRELRLKFVSNVAGGNYQLGKILISADEGDVRGYST
Ga0335056_0553553_436_5973300034120FreshwaterPSDPYVFDGNTNKIDMKEQRRELRLQFRSNVVGGDYQTGKIIISADIGDVRGY
Ga0335058_0346770_732_8573300034121FreshwaterGKVDMREQRRELRLKFVSNVAGGDYQVGKVILDADLGDVRP
Ga0335016_0124517_47_1633300034166FreshwaterMREQRRELRLLFRSDVQGGNYQMGRVIISADFGDVRGF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.