NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039833

Metagenome / Metatranscriptome Family F039833

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039833
Family Type Metagenome / Metatranscriptome
Number of Sequences 163
Average Sequence Length 44 residues
Representative Sequence VTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Number of Associated Samples 136
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.48 %
% of genes near scaffold ends (potentially truncated) 95.71 %
% of genes from short scaffolds (< 2000 bps) 94.48 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.865 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.767 % of family members)
Environment Ontology (ENVO) Unclassified
(25.767 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.558 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 28.99%    Coil/Unstructured: 71.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 163 Family Scaffolds
PF02798GST_N 23.31
PF06823DUF1236 11.04
PF05175MTS 11.04
PF00082Peptidase_S8 3.68
PF12697Abhydrolase_6 2.45
PF03466LysR_substrate 1.84
PF02562PhoH 1.23
PF07581Glug 1.23
PF13589HATPase_c_3 0.61
PF05231MASE1 0.61
PF00313CSD 0.61
PF04226Transgly_assoc 0.61
PF16694Cytochrome_P460 0.61
PF00149Metallophos 0.61
PF05598DUF772 0.61
PF00872Transposase_mut 0.61
PF13419HAD_2 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 163 Family Scaffolds
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 1.23
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 1.23
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.61
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.61
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.61
COG3447Integral membrane sensor domain MASE1Signal transduction mechanisms [T] 0.61
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.87 %
UnclassifiedrootN/A6.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309004|prs_FHA1B5K04XYXSVAll Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria508Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10155833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium548Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10157396All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1040613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria605Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10094705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium632Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1063957All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300002074|JGI24748J21848_1014453All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300005163|Ga0066823_10074325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales658Open in IMG/M
3300005328|Ga0070676_10304485All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300005332|Ga0066388_101184894All Organisms → cellular organisms → Bacteria → Proteobacteria1304Open in IMG/M
3300005332|Ga0066388_107143622All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300005355|Ga0070671_100326790All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1307Open in IMG/M
3300005364|Ga0070673_101042302All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005434|Ga0070709_11302587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales586Open in IMG/M
3300005546|Ga0070696_100571029All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300005547|Ga0070693_101675342All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300005556|Ga0066707_10230877All Organisms → cellular organisms → Bacteria → Proteobacteria1202Open in IMG/M
3300005586|Ga0066691_10670672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria614Open in IMG/M
3300005591|Ga0070761_11051114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM3983518Open in IMG/M
3300005615|Ga0070702_101699496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria525Open in IMG/M
3300005713|Ga0066905_101438413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300005713|Ga0066905_102275041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria506Open in IMG/M
3300005718|Ga0068866_10753735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria673Open in IMG/M
3300005764|Ga0066903_103088517All Organisms → cellular organisms → Bacteria → Proteobacteria901Open in IMG/M
3300005764|Ga0066903_105613129All Organisms → cellular organisms → Bacteria → Proteobacteria660Open in IMG/M
3300005764|Ga0066903_108946461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300005937|Ga0081455_10574363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium740Open in IMG/M
3300006031|Ga0066651_10702414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300006032|Ga0066696_10101987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1726Open in IMG/M
3300006034|Ga0066656_10516068All Organisms → cellular organisms → Bacteria → Proteobacteria779Open in IMG/M
3300006049|Ga0075417_10486948All Organisms → cellular organisms → Bacteria → Proteobacteria619Open in IMG/M
3300006163|Ga0070715_11038271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300006800|Ga0066660_11578437All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300006847|Ga0075431_100976286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria815Open in IMG/M
3300006914|Ga0075436_100357144All Organisms → cellular organisms → Bacteria → Proteobacteria1054Open in IMG/M
3300007076|Ga0075435_101805818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. YR681537Open in IMG/M
3300009090|Ga0099827_10332283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1290Open in IMG/M
3300009137|Ga0066709_100180484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2747Open in IMG/M
3300009148|Ga0105243_10838563All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300009156|Ga0111538_11047707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1032Open in IMG/M
3300009553|Ga0105249_13263653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria522Open in IMG/M
3300010046|Ga0126384_10915502All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300010047|Ga0126382_12214128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium529Open in IMG/M
3300010321|Ga0134067_10274205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BRP22643Open in IMG/M
3300010325|Ga0134064_10288224All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300010326|Ga0134065_10215863All Organisms → cellular organisms → Bacteria → Proteobacteria701Open in IMG/M
3300010358|Ga0126370_11090177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium735Open in IMG/M
3300010359|Ga0126376_13219761All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300010360|Ga0126372_12639086All Organisms → cellular organisms → Bacteria → Proteobacteria554Open in IMG/M
3300010360|Ga0126372_12808832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium539Open in IMG/M
3300010360|Ga0126372_12961448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300010361|Ga0126378_12925702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300010362|Ga0126377_11073424All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales873Open in IMG/M
3300010366|Ga0126379_11891917All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300010366|Ga0126379_12166047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria657Open in IMG/M
3300010366|Ga0126379_13171521Not Available550Open in IMG/M
3300010366|Ga0126379_13884333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300010376|Ga0126381_103172709All Organisms → cellular organisms → Bacteria → Proteobacteria650Open in IMG/M
3300010376|Ga0126381_105051762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria506Open in IMG/M
3300011119|Ga0105246_11490902All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales635Open in IMG/M
3300012189|Ga0137388_11802628Not Available544Open in IMG/M
3300012202|Ga0137363_10330892All Organisms → cellular organisms → Bacteria → Proteobacteria1257Open in IMG/M
3300012212|Ga0150985_117729194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300012355|Ga0137369_10733393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300012361|Ga0137360_10494252All Organisms → cellular organisms → Bacteria → Proteobacteria1041Open in IMG/M
3300012361|Ga0137360_11047449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300012362|Ga0137361_11870969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria517Open in IMG/M
3300012683|Ga0137398_11140242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria535Open in IMG/M
3300012927|Ga0137416_10578660Not Available976Open in IMG/M
3300012948|Ga0126375_10733606All Organisms → cellular organisms → Bacteria → Proteobacteria773Open in IMG/M
3300012987|Ga0164307_10005288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6011Open in IMG/M
3300013500|Ga0120195_1008086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria718Open in IMG/M
3300014325|Ga0163163_11194038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria823Open in IMG/M
3300014325|Ga0163163_12688502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria555Open in IMG/M
3300014969|Ga0157376_11829574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria644Open in IMG/M
3300015372|Ga0132256_100272169All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300015372|Ga0132256_103473492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300015373|Ga0132257_100691645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1266Open in IMG/M
3300016270|Ga0182036_10669323All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300016294|Ga0182041_10707915All Organisms → cellular organisms → Bacteria → Proteobacteria893Open in IMG/M
3300016319|Ga0182033_11404890All Organisms → cellular organisms → Bacteria → Proteobacteria629Open in IMG/M
3300016371|Ga0182034_11813467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300017997|Ga0184610_1098499All Organisms → cellular organisms → Bacteria → Proteobacteria925Open in IMG/M
3300018468|Ga0066662_10252728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1442Open in IMG/M
3300018476|Ga0190274_10216783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1701Open in IMG/M
3300020579|Ga0210407_10475305All Organisms → cellular organisms → Bacteria → Proteobacteria977Open in IMG/M
3300021082|Ga0210380_10364782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria660Open in IMG/M
3300021082|Ga0210380_10521277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300021168|Ga0210406_10535716All Organisms → cellular organisms → Bacteria → Proteobacteria922Open in IMG/M
3300021178|Ga0210408_10792681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria742Open in IMG/M
3300021361|Ga0213872_10081657All Organisms → cellular organisms → Bacteria → Proteobacteria1452Open in IMG/M
3300021405|Ga0210387_11852958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300021478|Ga0210402_10506604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1121Open in IMG/M
3300024055|Ga0247794_10218443All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium620Open in IMG/M
3300025919|Ga0207657_11228312All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300025935|Ga0207709_11041261All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300026075|Ga0207708_11454750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria602Open in IMG/M
3300026075|Ga0207708_11799802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria537Open in IMG/M
3300026075|Ga0207708_11813376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria535Open in IMG/M
3300026304|Ga0209240_1052780All Organisms → cellular organisms → Bacteria → Proteobacteria1530Open in IMG/M
3300026355|Ga0257149_1040131All Organisms → cellular organisms → Bacteria → Proteobacteria668Open in IMG/M
3300027381|Ga0208983_1101534All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300027646|Ga0209466_1095003All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300027862|Ga0209701_10059951All Organisms → cellular organisms → Bacteria → Proteobacteria2426Open in IMG/M
3300027875|Ga0209283_10870133Not Available548Open in IMG/M
3300028536|Ga0137415_10484549Not Available1044Open in IMG/M
3300028589|Ga0247818_10588768All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300028720|Ga0307317_10135462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8824Open in IMG/M
3300028755|Ga0307316_10051464All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300028784|Ga0307282_10159134All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300028790|Ga0307283_10039902All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300028807|Ga0307305_10116637All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300028824|Ga0307310_10151761All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300028876|Ga0307286_10082926Not Available1114Open in IMG/M
3300028878|Ga0307278_10460936All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300029636|Ga0222749_10178360All Organisms → cellular organisms → Bacteria → Proteobacteria1050Open in IMG/M
3300031093|Ga0308197_10304811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria589Open in IMG/M
3300031170|Ga0307498_10078825All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300031474|Ga0170818_110906085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1384Open in IMG/M
3300031545|Ga0318541_10731113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium552Open in IMG/M
3300031561|Ga0318528_10571668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium606Open in IMG/M
3300031561|Ga0318528_10634349All Organisms → cellular organisms → Bacteria → Proteobacteria573Open in IMG/M
3300031573|Ga0310915_11018027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium577Open in IMG/M
3300031679|Ga0318561_10473423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium689Open in IMG/M
3300031679|Ga0318561_10655922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria577Open in IMG/M
3300031680|Ga0318574_10504953All Organisms → cellular organisms → Bacteria → Proteobacteria708Open in IMG/M
3300031680|Ga0318574_10529700All Organisms → cellular organisms → Bacteria → Proteobacteria690Open in IMG/M
3300031713|Ga0318496_10162754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium1220Open in IMG/M
3300031763|Ga0318537_10306591Not Available587Open in IMG/M
3300031768|Ga0318509_10701797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300031769|Ga0318526_10094639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium1188Open in IMG/M
3300031771|Ga0318546_11308918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300031780|Ga0318508_1003669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3052Open in IMG/M
3300031792|Ga0318529_10332381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria707Open in IMG/M
3300031794|Ga0318503_10262546All Organisms → cellular organisms → Bacteria → Proteobacteria560Open in IMG/M
3300031796|Ga0318576_10352485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria695Open in IMG/M
3300031796|Ga0318576_10468872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium594Open in IMG/M
3300031797|Ga0318550_10604264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300031805|Ga0318497_10100102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1554Open in IMG/M
3300031805|Ga0318497_10116191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium1445Open in IMG/M
3300031819|Ga0318568_10982282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria521Open in IMG/M
3300031879|Ga0306919_10357961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1115Open in IMG/M
3300031879|Ga0306919_11466489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300031894|Ga0318522_10006969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3251Open in IMG/M
3300031896|Ga0318551_10451182All Organisms → cellular organisms → Bacteria → Proteobacteria735Open in IMG/M
3300031896|Ga0318551_10763711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300031896|Ga0318551_10816058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300031942|Ga0310916_10231115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1554Open in IMG/M
3300032000|Ga0310903_10068866All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300032035|Ga0310911_10279061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium959Open in IMG/M
3300032041|Ga0318549_10513800Not Available538Open in IMG/M
3300032043|Ga0318556_10039749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2233Open in IMG/M
3300032094|Ga0318540_10057233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1764Open in IMG/M
3300032094|Ga0318540_10214518All Organisms → cellular organisms → Bacteria → Proteobacteria928Open in IMG/M
3300032163|Ga0315281_11928729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria566Open in IMG/M
3300032174|Ga0307470_11834778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300032180|Ga0307471_100113774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2499Open in IMG/M
3300032261|Ga0306920_103864746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium546Open in IMG/M
3300033289|Ga0310914_10230760All Organisms → cellular organisms → Bacteria → Proteobacteria1659Open in IMG/M
3300033551|Ga0247830_10614633All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales861Open in IMG/M
3300034149|Ga0364929_0079056All Organisms → cellular organisms → Bacteria1021Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.29%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.68%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.84%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.23%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.23%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.23%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.23%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.61%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.61%
Green-Waste CompostEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost0.61%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.61%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.61%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.61%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.61%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.61%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309004Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto RicoEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013500Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300027381Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
prs_066893402070309004Green-Waste CompostPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
AF_2010_repII_A1DRAFT_1015583323300000597Forest SoilSVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
AF_2010_repII_A1DRAFT_1015739613300000597Forest SoilAMQDLPAGVTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP*
AP72_2010_repI_A10DRAFT_104061323300000651Forest SoilMQDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
AF_2010_repII_A001DRAFT_1009470523300000793Forest SoilEIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP*
AP72_2010_repI_A100DRAFT_106395733300000837Forest SoilAGVPMQDLPAAVTRDIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP*
JGI24748J21848_101445313300002074Corn, Switchgrass And Miscanthus RhizosphereDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP*
Ga0066823_1007432513300005163SoilVTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP*
Ga0070676_1030448513300005328Miscanthus RhizosphereLHDLPAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP*
Ga0066388_10118489433300005332Tropical Forest SoilPLRDLPVSVIRQVPLVEGHQFVKFDDRILVVNPASRIVVAMIPRYKLLQ*
Ga0066388_10714362213300005332Tropical Forest SoilGVTREIPLVGGHKFVKFDDRIVVVDPRNRVVVAMIPRYKLLP*
Ga0070671_10032679023300005355Switchgrass RhizosphereVPLHDLPAGVTRDVPLVEGHKFVKFDDRILVVDSASRVVVAMIPRYKLLP*
Ga0070673_10104230213300005364Switchgrass RhizospherePLHDLPAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP*
Ga0070709_1130258713300005434Corn, Switchgrass And Miscanthus RhizosphereGVPLQDLPPGIAEEIPVVRDHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP*
Ga0070696_10057102913300005546Corn, Switchgrass And Miscanthus RhizosphereVPLHDLPAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP*
Ga0070693_10167534223300005547Corn, Switchgrass And Miscanthus RhizosphereDLPAGVTRDVPLVEGHKFVKFDDRILVVDSASRVVVAMIPRYKLLP*
Ga0066707_1023087713300005556SoilGVPMQDLPAAVTRDIPLVQGHKFVKFDDRIVVIEPASRLVVAMIPRYKLLP*
Ga0066691_1067067213300005586SoilMQDLPASLTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP*
Ga0070761_1105111413300005591SoilMQDLPAEVSQDVPLVQGHKFVKFDDRILIVHPSNRLVVAMIPRYKL
Ga0070702_10169949613300005615Corn, Switchgrass And Miscanthus RhizosphereDIIREIPLIRGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP*
Ga0066905_10143841323300005713Tropical Forest SoilVPLQDLPAGMAQEVPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP*
Ga0066905_10227504113300005713Tropical Forest SoilLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0068866_1075373523300005718Miscanthus RhizosphereDLPAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP*
Ga0066903_10308851713300005764Tropical Forest SoilTREIPLVRGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0066903_10561312923300005764Tropical Forest SoilREIPLVQGHKFVKFDDRILVVNPASRLVVAMIPRYKLLP*
Ga0066903_10894646123300005764Tropical Forest SoilPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP*
Ga0081455_1057436313300005937Tabebuia Heterophylla RhizospherePLVRGHKFVKFDDRIVVVDPKSRVVVAMMPRYKLLP*
Ga0066651_1070241413300006031SoilMAQEIPQVEGHKFVKFEDRIVVVNPRSRVVAAMIPRYKPLP*
Ga0066696_1010198733300006032SoilVSRDIPLVQGHKFAKFDDRIVLVDPATRVVVAMIPRYKLLLQ*
Ga0066656_1051606813300006034SoilVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0075417_1048694813300006049Populus RhizospherePADVPMQDLPAGLTREIPLVHGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0070715_1103827123300006163Corn, Switchgrass And Miscanthus RhizosphereDLPSGITRDIPAVRGHKFVKFDDRILVVSSEGRLVVAMIPRYKLLP*
Ga0066660_1157843733300006800SoilLPSGVPLHDLPTGMAQEIPQVEGHKFVKFEDRIVVVNPRSRVVVAMIPRYKLLP*
Ga0075431_10097628633300006847Populus RhizospherePAGVTQDIPLAQGHKFVKFDDRILIVNPSSRLVVALIPRYKLVP*
Ga0075436_10035714413300006914Populus RhizosphereMQDLPAAVARDVPPVQGHKFAKFDDRIVVIDPASRLVVAMIPRYRLLP*
Ga0075435_10180581813300007076Populus RhizosphereADDIEMQDLPLSVVRRLPQVEGYKFAKFDDRIVVVNPASRLVVAMIPRYKLMP*
Ga0099827_1033228343300009090Vadose Zone SoilVVREIPQVRGHKFVKFDDRILVVDPASRLVVAMIPRYKLMD*
Ga0066709_10018048423300009137Grasslands SoilPQVEGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP*
Ga0105243_1083856323300009148Miscanthus RhizospherePAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP*
Ga0111538_1104770713300009156Populus RhizospherePLVSGHKFVKFDDRILVISATSRLVVAMIPRYKLLQ*
Ga0105249_1326365323300009553Switchgrass RhizosphereDVPLHDLPAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP*
Ga0126384_1091550223300010046Tropical Forest SoilVTREIPLVRGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0126382_1221412813300010047Tropical Forest SoilEVPMQDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0134067_1027420513300010321Grasslands SoilGMAQEIPQVEGHKFVKFEDRIVVVDPRSRVVVAMIPRYKLLP*
Ga0134064_1028822413300010325Grasslands SoilTRDIPLVQGHKFVKFDDRIVVIEPASRLVVAMIPRYKLLP*
Ga0134065_1021586323300010326Grasslands SoilAVTRDIPLVQGHKFVKFDDRIVVIEPASRLVVAMIPRYKLLP*
Ga0126370_1109017713300010358Tropical Forest SoilDLPASVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP*
Ga0126376_1321976113300010359Tropical Forest SoilPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0126372_1263908623300010360Tropical Forest SoilPQVRGHKFVKFDDRILVIDPASRLVVAMIPRYKLMD*
Ga0126372_1280883223300010360Tropical Forest SoilTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP*
Ga0126372_1296144823300010360Tropical Forest SoilMAQEIPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP*
Ga0126378_1292570223300010361Tropical Forest SoilQEIPQVRGHKFVKFDDRVVVVDPKSRVVVAMIARYKLLP*
Ga0126377_1107342423300010362Tropical Forest SoilVALQDLPAGVTREIPLVDGHKFVKFDDRIVVVEPASRVVVAMIPRYRLLP*
Ga0126379_1189191723300010366Tropical Forest SoilMQDLPASVTREIPLVQGHKFVKFDDRILVVNPASRLVVAMIPRYKLLP*
Ga0126379_1216604723300010366Tropical Forest SoilRDIPPVQGHKFVKFDDRIVVVDPASRLVVAMIPRYRLLP*
Ga0126379_1317152113300010366Tropical Forest SoilLPGEVPMQDLPTSVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0126379_1388433313300010366Tropical Forest SoilADALPQGVPMQDLPPGVTREIPLARGHKFVKFDDRIVVVDPLSCLVVAMIPRYKLLP*
Ga0126381_10317270923300010376Tropical Forest SoilEIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP*
Ga0126381_10505176223300010376Tropical Forest SoilLPASVTREIPLVRGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0105246_1149090213300011119Miscanthus RhizosphereRDIPLVEGHQFAKFDDRILVVNSSSRVVVAMIPRYKLLP*
Ga0137388_1180262823300012189Vadose Zone SoilLQDLPMSVTRKLPLIKDYKFVKFDDRILVVNPASRVVVAMIPRYKLLQ*
Ga0137363_1033089213300012202Vadose Zone SoilPAGVPMQDLPAAVTRDIPLVQGHKFVKFDDRIVVIDPASRLVVAMIPRYRLLP*
Ga0150985_11772919413300012212Avena Fatua RhizosphereTQDLPDDIIREIPLIRGHKFVKFDDRILVVSSSRLVVAMIPRYKLLP*
Ga0137369_1073339323300012355Vadose Zone SoilSGVPLQDLPFGIAQEIPLVRDHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP*
Ga0137360_1049425213300012361Vadose Zone SoilALPGEVPMQDLPVSVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0137360_1104744923300012361Vadose Zone SoilPAAVTRDIPLVQGHKFVKFDDRIVVIDPASRLVVAMIPRYKLLP*
Ga0137361_1187096913300012362Vadose Zone SoilTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0137398_1114024213300012683Vadose Zone SoilTRDVPLVRGHQFAKFDDRILVVDSASRVVVAMIPRYKLLP*
Ga0137416_1057866023300012927Vadose Zone SoilADALPSEVLLQDMPMSVTRKLPLIKDYKFVKFDDRILVVNPASRVVVAMIPRYKLLQ*
Ga0126375_1073360623300012948Tropical Forest SoilQDLPAGVTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP*
Ga0164307_1000528873300012987SoilPLVEGHRFAKFEDRILVVNSASRLVVAMIPRYKLLP*
Ga0120195_100808623300013500TerrestrialMQDLPAGLAREIPLVHGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP*
Ga0163163_1119403813300014325Switchgrass RhizosphereDIIHEIPMVRGHRFVKFDDRILVVSSTSRLVVAMIPRYKLLP*
Ga0163163_1268850213300014325Switchgrass RhizosphereIPLARGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP*
Ga0157376_1182957413300014969Miscanthus RhizosphereRLPQVEGYKFAKFDDRIVVVNPASRLVVAMIPRYRLMP*
Ga0132256_10027216913300015372Arabidopsis RhizosphereDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP*
Ga0132256_10347349223300015372Arabidopsis RhizosphereAGIVREIPRVRGHKFVKFDDRIVVVDPKSRVVVAMMPRYKLLP*
Ga0132257_10069164513300015373Arabidopsis RhizosphereLPAGIVREIPLVRGHKFVKFDDRIVVVDPKSRVVVALMPRYKLLP*
Ga0182036_1066932313300016270SoilDLPASVTREIPLVQGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0182041_1070791523300016294SoilLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
Ga0182033_1140489013300016319SoilPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0182034_1181346713300016371SoilEVPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0184610_109849913300017997Groundwater SedimentLPAGIVREIPLVRGHKFVKFDDRIVVVDPKSRVVVAMMPRYKLLP
Ga0066662_1025272813300018468Grasslands SoilSRGIRLVQGHKFVKFDDRIVLVDPATRLVVAMIPRYKLLQ
Ga0190274_1021678353300018476SoilNDIIREIPLVRGHKFVKFDDRILVVSSASRLVIAMIPRYKLLP
Ga0210407_1047530513300020579SoilPMQDLPAAVARDVPLVQGHKFVKFDDRIVVVDPASRLVVAMIPRYRLLP
Ga0210380_1036478223300021082Groundwater SedimentPLPEEVPMQELPTDIIDEIPLVRGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP
Ga0210380_1052127713300021082Groundwater SedimentQGEIPMQDLPVRITEDIPMVQGHKFVKFEDRILIVNPSSQLVVAMIPRYRLLP
Ga0210406_1053571623300021168SoilPAAVARDVPLVQGHKFVKFDDRIVVVDPASRLVVAMIPRYRLLP
Ga0210408_1079268113300021178SoilANVTADIPLVRGHKFMKLEDRILLVEPASRVVVAMIPRYKLLP
Ga0213872_1008165713300021361RhizosphereEIPLVRGHKFVKFDDRIVVVEPASRVVVAMIPRYKLLP
Ga0210387_1185295813300021405SoilAVARDVPLVQGHKFVKFDDRIVVVDPASRLVVAMIPRYRLLP
Ga0210402_1050660423300021478SoilMQDLPAAVARDVPLVQGHKFVKFDDRIVVVDPASRLVVAMIPRYRLLP
Ga0247794_1021844323300024055SoilLHDLPAGVTRDVPLVEGHKFVKFDDRILVVDSASRVVVAMIPRYKLLP
Ga0207657_1122831223300025919Corn RhizosphereTRDVPLVEGHKFVKFDDRILVVDSASRVVVAMIPRYKLLP
Ga0207709_1104126113300025935Miscanthus RhizosphereDLPAGVTRDVPLVEGHQFAKFDDRILVVNAESRVVVAMIPRYKLLP
Ga0207708_1145475013300026075Corn, Switchgrass And Miscanthus RhizosphereSAVPLQDLPAGIAREIPPVQGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0207708_1179980233300026075Corn, Switchgrass And Miscanthus RhizosphereNDIIREIPPVRGHKFVKFDDRILVVSSASRLVIAMIPRYKLLP
Ga0207708_1181337623300026075Corn, Switchgrass And Miscanthus RhizosphereIIHEIPLVRGHKFVKFDDRILVVSSASRLVVAMIPRYKLLP
Ga0209240_105278013300026304Grasslands SoilGVPLQDLPASLTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0257149_104013123300026355SoilVPLQDLPASLTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0208983_110153413300027381Forest SoilDVPLHDLPAGVTRDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP
Ga0209466_109500323300027646Tropical Forest SoilTSVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
Ga0209701_1005995113300027862Vadose Zone SoilVAMQDLPAGVVREIPQVRGHKFVKFDDRILVVDPASRLVVAMIPRYKLMD
Ga0209283_1087013323300027875Vadose Zone SoilGVVREIPQVRGHKFVKFDDRILVVDPASRLVVAMIPRYKLMD
Ga0137415_1048454913300028536Vadose Zone SoilADALPSEVLLQDMPMSVTRKLPLIKDYKFVKFDDRILVVNPASRVVVAMIPRYKLLQ
Ga0247818_1058876823300028589SoilSRVTLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP
Ga0307317_1013546213300028720SoilHEIPLVRGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP
Ga0307316_1005146433300028755SoilTRDVPLVEGHQFAKFDDRILVVNSTSRVVVAMIPRYKLLP
Ga0307282_1015913413300028784SoilVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKILP
Ga0307283_1003990213300028790SoilPAGVTRDVPLVEGHKFAKFDDRILVVNSTSRVVVAMIPRYKLLP
Ga0307305_1011663713300028807SoilVPLHDLPAGVTRDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP
Ga0307310_1015176133300028824SoilTRDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP
Ga0307286_1008292613300028876SoilPTDIIHEIPLVRGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP
Ga0307278_1046093623300028878SoilVPMQDLPAGLAREIPLMHGHKFVKFDDRIVAVNPASRLVVAMIPRYKLLP
Ga0222749_1017836023300029636SoilASVTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0308197_1030481113300031093SoilREIPLVRGHKFVKFDDRILVVSSASRLVVAMIPRYKLLP
Ga0307498_1007882533300031170SoilVTRDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP
Ga0170818_11090608513300031474Forest SoilLIRGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP
Ga0318541_1073111313300031545SoilDLPATVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP
Ga0318528_1057166823300031561SoilMQDLPATVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP
Ga0318528_1063434913300031561SoilVTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0310915_1101802723300031573SoilEIPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0318561_1047342323300031679SoilSGVAMQDLPATVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP
Ga0318561_1065592213300031679SoilLQDLPAGMAQEVPQVLGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0318574_1050495313300031680SoilSVTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0318574_1052970023300031680SoilTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
Ga0318496_1016275413300031713SoilGVAMQDLPASVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP
Ga0318537_1030659123300031763SoilDLPASVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP
Ga0318509_1070179723300031768SoilMQDLPASVTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0318526_1009463913300031769SoilLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
Ga0318546_1130891813300031771SoilVPLHDLPAGIVQAIPLVQGHKFVKFDDQIVVVDPKSRVVVAMIPRYKLLP
Ga0318508_100366923300031780SoilGMAQEVPQVLGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0318529_1033238123300031792SoilVPMQDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
Ga0318503_1026254613300031794SoilVAMQDLPAGVTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0318576_1035248513300031796SoilMQDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
Ga0318576_1046887213300031796SoilAMQDLPATVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP
Ga0318550_1060426423300031797SoilAQEIPQVEGHTFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0318497_1010010213300031805SoilAEVAMQDLPAGVTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0318497_1011619123300031805SoilSSEVPMQDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
Ga0318568_1098228223300031819SoilGMAQEVPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0306919_1035796123300031879SoilEIPQVEGHTFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0306919_1146648923300031879SoilAQEVPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0318522_1000696913300031894SoilSGVAMQDLPASVTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0318551_1045118213300031896SoilTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0318551_1076371113300031896SoilAGMAQEVPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0318551_1081605813300031896SoilEIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
Ga0310916_1023111513300031942SoilDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0310910_1040125533300031946SoilIPLLRGHKFMKLEDRILLVEPATRAVVAMFPRYKLLP
Ga0310903_1006886613300032000SoilVTRDVPLVEGHQFAKFDDRILVVNAASRVVVAMIPRYKLLP
Ga0310911_1027906123300032035SoilPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0318549_1051380023300032041SoilAMQDLPASVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP
Ga0318549_1055829313300032041SoilLLSAYKFMKLEDRILLIEPAARVVVAMIPRYKLLP
Ga0318556_1003974933300032043SoilRVTLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
Ga0318540_1005723313300032094SoilEIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0318540_1021451823300032094SoilVTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP
Ga0315281_1192872913300032163SedimentIREVPLVNDHKFVKFDDRILVVDPASRLVVAMIPRYKLLP
Ga0307470_1183477813300032174Hardwood Forest SoilVPLQDLPAGIVREIPLVRGHKFVKFDDRIVVVDPKSRVVVAMMPRYKLLP
Ga0307471_10011377413300032180Hardwood Forest SoilTRDIPLVQGHKFVKFDDRIVVVDPASRLIVAMIPRYKLLP
Ga0306920_10386474623300032261SoilQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP
Ga0310914_1023076033300033289SoilDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP
Ga0247830_1061463313300033551SoilREVPLHDLPAGVTRDVPLVEGHKFVKFDDRILVVDSASRVVVAMIPRYKLLP
Ga0364929_0079056_886_10203300034149SedimentPAGVTRDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.