NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039652

Metagenome / Metatranscriptome Family F039652

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039652
Family Type Metagenome / Metatranscriptome
Number of Sequences 163
Average Sequence Length 46 residues
Representative Sequence MKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Number of Associated Samples 142
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 4.35 %
% of genes near scaffold ends (potentially truncated) 66.87 %
% of genes from short scaffolds (< 2000 bps) 96.32 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.773 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(22.086 % of family members)
Environment Ontology (ENVO) Unclassified
(40.491 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(55.215 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.86%    β-sheet: 16.22%    Coil/Unstructured: 68.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 163 Family Scaffolds
PF00026Asp 46.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.77 %
UnclassifiedrootN/A1.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001972|GOS2216_10030531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1877Open in IMG/M
3300002186|JGI24539J26755_10120110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium760Open in IMG/M
3300002835|B570J40625_100555096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1063Open in IMG/M
3300003802|Ga0007840_1008109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium654Open in IMG/M
3300003806|Ga0007864_1006792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani940Open in IMG/M
3300004112|Ga0065166_10073412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1192Open in IMG/M
3300004794|Ga0007751_10017762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300005043|Ga0071100_1076314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300005043|Ga0071100_1145530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300005516|Ga0066831_10016281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2032Open in IMG/M
3300005580|Ga0049083_10163472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium762Open in IMG/M
3300005941|Ga0070743_10034445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1744Open in IMG/M
3300005942|Ga0070742_10088453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium852Open in IMG/M
3300006390|Ga0075509_1398889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300006415|Ga0099654_10246427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum994Open in IMG/M
3300006419|Ga0075496_1306241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300006424|Ga0075497_1299066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani517Open in IMG/M
3300007513|Ga0105019_1074669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1923Open in IMG/M
3300007516|Ga0105050_10467064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium749Open in IMG/M
3300007523|Ga0105052_10261605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1155Open in IMG/M
3300007558|Ga0102822_1072918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium809Open in IMG/M
3300007558|Ga0102822_1174763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300007722|Ga0105051_10574567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum830Open in IMG/M
3300007864|Ga0105749_1166351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300007992|Ga0105748_10282416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium702Open in IMG/M
3300008117|Ga0114351_1399027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300008993|Ga0104258_1048838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300008996|Ga0102831_1123478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum861Open in IMG/M
3300009002|Ga0102810_1135269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium762Open in IMG/M
3300009003|Ga0102813_1046759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1484Open in IMG/M
3300009077|Ga0115552_1038678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2225Open in IMG/M
3300009079|Ga0102814_10181812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1148Open in IMG/M
3300009182|Ga0114959_10150734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1235Open in IMG/M
3300009432|Ga0115005_10437857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1039Open in IMG/M
3300009432|Ga0115005_10485973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium984Open in IMG/M
3300009432|Ga0115005_11017242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium671Open in IMG/M
3300009434|Ga0115562_1061199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1620Open in IMG/M
3300009441|Ga0115007_10370729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium934Open in IMG/M
3300009442|Ga0115563_1162130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium889Open in IMG/M
3300009466|Ga0126448_1015117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1888Open in IMG/M
3300009497|Ga0115569_10153661All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1100Open in IMG/M
3300009599|Ga0115103_1003113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1732Open in IMG/M
3300009677|Ga0115104_10769154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium505Open in IMG/M
3300009677|Ga0115104_10772287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium905Open in IMG/M
3300009677|Ga0115104_11262649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300009679|Ga0115105_10192394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium773Open in IMG/M
3300009785|Ga0115001_10196263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1307Open in IMG/M
3300010885|Ga0133913_11071537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2078Open in IMG/M
3300010885|Ga0133913_11720803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1575Open in IMG/M
3300010970|Ga0137575_10086408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300010981|Ga0138316_10284799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300010985|Ga0138326_10835460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300010987|Ga0138324_10293433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium776Open in IMG/M
3300011268|Ga0151620_1030299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1849Open in IMG/M
3300012417|Ga0138262_1329410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1138Open in IMG/M
3300012528|Ga0129352_10920237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium918Open in IMG/M
3300012713|Ga0157544_1087618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300012716|Ga0157605_1082559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium697Open in IMG/M
3300012718|Ga0157557_1066156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium727Open in IMG/M
3300012722|Ga0157630_1155074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300012733|Ga0157606_1112768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1406Open in IMG/M
3300012771|Ga0138270_1324801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1132Open in IMG/M
3300012780|Ga0138271_1345108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum794Open in IMG/M
3300012953|Ga0163179_10622545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium908Open in IMG/M
3300012954|Ga0163111_12579123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300012965|Ga0129346_1080790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium980Open in IMG/M
3300013309|Ga0157546_164532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300017751|Ga0187219_1113226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium811Open in IMG/M
3300017763|Ga0181410_1129412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300018410|Ga0181561_10430123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300018725|Ga0193517_1036711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium922Open in IMG/M
3300018905|Ga0193028_1115523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300018913|Ga0192868_10092409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300018982|Ga0192947_10016174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1902Open in IMG/M
3300018982|Ga0192947_10017063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1870Open in IMG/M
3300019032|Ga0192869_10205249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium840Open in IMG/M
3300019036|Ga0192945_10027433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1452Open in IMG/M
3300019085|Ga0188830_1008762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300019117|Ga0193054_1014623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1086Open in IMG/M
3300019281|Ga0182077_1340182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium799Open in IMG/M
3300020014|Ga0182044_1160872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300020048|Ga0207193_1209741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1526Open in IMG/M
3300020074|Ga0194113_10204733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1575Open in IMG/M
3300020205|Ga0211731_10956457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2175Open in IMG/M
3300021355|Ga0206690_10141110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum758Open in IMG/M
3300021355|Ga0206690_10360266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani875Open in IMG/M
3300021365|Ga0206123_10423450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium544Open in IMG/M
3300021389|Ga0213868_10318489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium885Open in IMG/M
3300021902|Ga0063086_1009618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1910Open in IMG/M
3300021913|Ga0063104_1064826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300021924|Ga0063085_1028293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1859Open in IMG/M
3300021942|Ga0063098_1076445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300022752|Ga0214917_10191928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1019Open in IMG/M
3300023179|Ga0214923_10257120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium980Open in IMG/M
3300023179|Ga0214923_10520609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300023184|Ga0214919_10616962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium636Open in IMG/M
3300023701|Ga0228685_1078254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300024346|Ga0244775_10168370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1845Open in IMG/M
3300025138|Ga0209634_1247516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium647Open in IMG/M
3300025369|Ga0208382_1025746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani761Open in IMG/M
3300025387|Ga0207959_1070245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300025620|Ga0209405_1092289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani889Open in IMG/M
3300025640|Ga0209198_1095767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani936Open in IMG/M
3300025704|Ga0209602_1192934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300025810|Ga0208543_1096630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium706Open in IMG/M
3300025886|Ga0209632_10493442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300026449|Ga0247593_1093629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium587Open in IMG/M
3300026471|Ga0247602_1111234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium686Open in IMG/M
3300026500|Ga0247592_1085710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300026504|Ga0247587_1186651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300026513|Ga0247590_1196678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium513Open in IMG/M
3300027708|Ga0209188_1191809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium741Open in IMG/M
3300027833|Ga0209092_10183891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1185Open in IMG/M
3300027849|Ga0209712_10691627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300027906|Ga0209404_11112020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300027976|Ga0209702_10285772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium674Open in IMG/M
3300028110|Ga0247584_1041186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1157Open in IMG/M
3300028110|Ga0247584_1176431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300028137|Ga0256412_1080443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1168Open in IMG/M
3300028282|Ga0256413_1089621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1106Open in IMG/M
3300028282|Ga0256413_1170537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium786Open in IMG/M
3300028282|Ga0256413_1340884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300028290|Ga0247572_1100246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium714Open in IMG/M
3300028334|Ga0247597_1025665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium772Open in IMG/M
3300028575|Ga0304731_11145516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300030702|Ga0307399_10091408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1263Open in IMG/M
3300030702|Ga0307399_10214008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani893Open in IMG/M
3300030709|Ga0307400_10134131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1490Open in IMG/M
3300030709|Ga0307400_10257976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1101Open in IMG/M
3300030709|Ga0307400_10268191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1080Open in IMG/M
3300030709|Ga0307400_10883419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300030720|Ga0308139_1012928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1168Open in IMG/M
3300030856|Ga0073990_12052411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium733Open in IMG/M
3300030948|Ga0073977_1440146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300031036|Ga0073978_1018776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium546Open in IMG/M
3300031269|Ga0307983_1042784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani882Open in IMG/M
3300031569|Ga0307489_10240764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1143Open in IMG/M
3300031613|Ga0307978_1106151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani862Open in IMG/M
3300031710|Ga0307386_10038231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1744Open in IMG/M
3300031710|Ga0307386_10349510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium753Open in IMG/M
3300031738|Ga0307384_10027006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1851Open in IMG/M
3300031739|Ga0307383_10158381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1047Open in IMG/M
3300031739|Ga0307383_10313361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum760Open in IMG/M
3300032050|Ga0315906_10712774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium803Open in IMG/M
3300032462|Ga0335396_10430533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum847Open in IMG/M
3300032462|Ga0335396_10517171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium755Open in IMG/M
3300032481|Ga0314668_10681495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300032707|Ga0314687_10776913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300032708|Ga0314669_10213017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium998Open in IMG/M
3300032713|Ga0314690_10267951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium841Open in IMG/M
3300032714|Ga0314686_10263594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum855Open in IMG/M
3300032727|Ga0314693_10185944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1059Open in IMG/M
3300032732|Ga0314711_10689920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300032742|Ga0314710_10207468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium798Open in IMG/M
3300032747|Ga0314712_10136820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1125Open in IMG/M
3300032748|Ga0314713_10220578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium801Open in IMG/M
3300032748|Ga0314713_10431981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300032755|Ga0314709_10125830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1440Open in IMG/M
3300034051|Ga0335024_0320854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium790Open in IMG/M
3300034116|Ga0335068_0300090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium800Open in IMG/M
3300034167|Ga0335017_0359190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium798Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.09%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.20%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.98%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.98%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.36%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.29%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater3.68%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.68%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.45%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.45%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.84%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.84%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.84%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.23%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer1.23%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.23%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.23%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.61%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.61%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.61%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.61%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.61%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.61%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.61%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.61%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.61%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.61%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.61%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.61%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.61%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.61%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001972Marine microbial communities from the Sargasso Sea - GS000dEnvironmentalOpen in IMG/M
3300002186Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M MetagenomeEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07EnvironmentalOpen in IMG/M
3300003806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012713Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES033 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012718Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES050 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012733Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012771Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012780Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013309Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES035 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019281Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300023701Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025387Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031036Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031269Marine microbial communities from Ellis Fjord, Antarctic Ocean - #991EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031613Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1056EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034051Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GOS2216_1003053143300001972MarineLHYLWSMKDNEIIDHAMVSFSVTSKEMGETPYALFGGYNSS*
JGI24539J26755_1012011013300002186MarineMKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFG
B570J40625_10055509613300002835FreshwaterMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS*
Ga0007840_100810913300003802FreshwaterMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVGGA*
Ga0007864_100679213300003806FreshwaterMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0065166_1007341223300004112Freshwater LakeMKKKKLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS*
Ga0007751_1001776223300004794Freshwater LakeDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVGGA*
Ga0071100_107631423300005043Marine Subseafloor AquiferMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGG
Ga0071100_114553013300005043Marine Subseafloor AquiferMSKKKLHYLYSLKENGIIDNAVVSFSVTSQDMGETPYALFGGYNSS*
Ga0066831_1001628143300005516MarineMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS*
Ga0049083_1016347213300005580Freshwater LenticLGLSPHKDMKKKKLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS*
Ga0070743_1003444533300005941EstuarineMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSSQIVDG*
Ga0070742_1008845323300005942EstuarineMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0075509_139888913300006390AqueousMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQIVGGAEG
Ga0099654_1024642713300006415LakeLGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVGGA
Ga0075496_130624123300006419AqueousPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS*
Ga0075497_129906623300006424AqueousLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS*
Ga0105019_107466913300007513MarineMGKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS*
Ga0105050_1046706423300007516FreshwaterMSKKKLHYLWSLKDNGIIDHAIVSFSVTSKEMGETPYALFGGYNSSQIVGGA*
Ga0105052_1026160513300007523FreshwaterMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYA
Ga0102822_107291823300007558EstuarineMKKKKLHYLWSLKDNGIIDRAMVSFSIASKEMGETPYALFGGYNSS*
Ga0102822_117476313300007558EstuarinePHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0105051_1057456713300007722FreshwaterNKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0105749_116635113300007864Estuary WaterSPHKDVKKSKLHYLWSLKNNGIIDHAMVSFSVTSKDMDDAPYALFGGYNSS*
Ga0105748_1028241613300007992Estuary WaterMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNS
Ga0114351_139902713300008117Freshwater, PlanktonPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS*
Ga0104258_104883833300008993Ocean WaterLKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST*
Ga0102831_112347823300008996EstuarineGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSSQIVDG*
Ga0102810_113526913300009002EstuarineKLHYLWALKDNGIIDKAMVSFSIASLDMDDQPYALFGGINPS*
Ga0102813_104675933300009003EstuarineMSKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS*
Ga0115552_103867823300009077Pelagic MarineMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST*
Ga0102814_1018181223300009079EstuarineMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSSQ
Ga0114959_1015073423300009182Freshwater LakeMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMNETPYALFGGYNSS*
Ga0115005_1043785713300009432MarineMSKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSSQI
Ga0115005_1048597313300009432MarinePHKDMKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS*
Ga0115005_1101724213300009432MarineLNYVWSLKDKGIIDRALISFSITSKEMVETPYALFRMTQVH
Ga0115562_106119923300009434Pelagic MarineMKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS*
Ga0115007_1037072913300009441MarineHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST*
Ga0115563_116213013300009442Pelagic MarineMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQI
Ga0126448_101511743300009466Meromictic PondMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMGETPYALFGGYNSS*
Ga0115569_1015366123300009497Pelagic MarineMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFG
Ga0115103_100311333300009599MarineMGKKKLHYLWSLKDNGIIDHAVVSFSVTSKEMGETPYALFGGYNSS*
Ga0115104_1076915413300009677MarineMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYAL
Ga0115104_1077228713300009677MarineSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS*
Ga0115104_1126264933300009677MarineHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST*
Ga0115105_1019239413300009679MarineMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPY
Ga0115001_1019626313300009785MarineMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVNGAD
Ga0133913_1107153723300010885Freshwater LakeMKKKKLHYLWSLKDNGIIDHAMVSFSITSKEMGETPYALFGGYNSSQIVGGA*
Ga0133913_1172080323300010885Freshwater LakeMSKKKLHYLWSLKDNGIIDHAMVSFSVTFKDMNETPYALFVGYNSSQIVGGS*
Ga0137575_1008640813300010970Pond Fresh WaterMKKKKLHYLWSLKDNGIIDHAMVSITSKEMNEGPYALFGGYNSS*
Ga0138316_1028479913300010981MarineMSKKKLHYLWSLKDNGIIEHAMVSFSVTSKEMNETPYALFGGYNSS*
Ga0138326_1083546013300010985MarineMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQL*
Ga0138324_1029343323300010987MarineMSKKKLHYLWSMKDNGIIDHAIVSFSVTSKEMGEAPYALFGGYNSSQIVDGA*
Ga0151620_103029923300011268FreshwaterLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0138262_132941013300012417Polar MarineMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSSQIVGGS*
Ga0129352_1092023713300012528AqueousKDMKKKKLHYLWSLKDNQINDRAMVSFSITSREMGETPYALFGGYNST*
Ga0157544_108761823300012713FreshwaterLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS*
Ga0157605_108255913300012716FreshwaterKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0157557_106615613300012718FreshwaterKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS*
Ga0157630_115507423300012722FreshwaterGILGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS*
Ga0157606_111276813300012733FreshwaterMKKKKLHYLWSLKDNGIIDHAMVRFSITSKEMNEGPYALFGGYNSS*
Ga0138270_132480113300012771Freshwater LakeMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMNETPYALFGGYNSSQIVGGS*
Ga0138271_134510833300012780Freshwater LakeKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS*
Ga0163179_1062254533300012953SeawaterWSLKDNGIIDRAMVSFSITSKEVGETPYALFGGYNST*
Ga0163111_1257912323300012954Surface SeawaterMKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGY
Ga0129346_108079033300012965AqueousGLSPHKDMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST*
Ga0157546_16453213300013309FreshwaterLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS*
Ga0187219_111322633300017751SeawaterMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVNGA
Ga0181410_112941213300017763SeawaterMKKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSSQIVGGAAG
Ga0181561_1043012323300018410Salt MarshMSKKKLHYLWSLKDNGIIDRAMVSFSVTSKEMGETPYALFGGYNST
Ga0181566_1046620913300018426Salt MarshMKDKGIIDRAMVSFSISSIDQEDPPYALFGGVNST
Ga0193517_103671123300018725MarineYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0193028_111552313300018905MarineKDMKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS
Ga0192868_1009240923300018913MarineLKDNGIIDKAIVSFSITSREMGETPYALFGGYNST
Ga0192947_1001617423300018982MarineMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0192947_1001706333300018982MarineMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS
Ga0192869_1020524913300019032MarineLGLSPHKDMSKKKLHYLWSMKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS
Ga0192945_1002743323300019036MarineLGLSPHKEMGKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS
Ga0188830_100876213300019085Freshwater LakeLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0193054_101462323300019117MarineMKKRKLHYLWSLRENGIIDHAMVSFSITSKEMNETPYALFGGYNSTQIVGGA
Ga0182077_134018223300019281Salt MarshMSKKKLHYLWSLKDNGIIDRAMVSFSITSNEMGETPYALFGGYNSSQIVNGAQ
Ga0182044_116087223300020014Salt MarshMGKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMGETPYALFGGYNST
Ga0207193_120974123300020048Freshwater Lake SedimentMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVGGA
Ga0194113_1020473313300020074Freshwater LakeMKKKKLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS
Ga0211731_1095645733300020205FreshwaterLGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0206690_1014111013300021355SeawaterKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0206690_1036026613300021355SeawaterMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNS
Ga0206123_1042345033300021365SeawaterLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS
Ga0213868_1031848923300021389SeawaterDGILGLSPHKDLTKKKLHYLWSLKDNGIIDHALVSFSVTSKEMNETPYALFGGYNSS
Ga0063086_100961833300021902MarineMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0063104_106482613300021913MarineGLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0063085_102829323300021924MarineMKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS
Ga0063098_107644513300021942MarineLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS
Ga0214917_1019192833300022752FreshwaterMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMNETPYALFGGYNSS
Ga0214923_1025712013300023179FreshwaterMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0214923_1052060913300023179FreshwaterMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSSQIVG
Ga0214919_1061696213300023184FreshwaterLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0228685_107825423300023701SeawaterMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYN
Ga0244775_1016837023300024346EstuarineMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSSQIVDG
Ga0209634_124751613300025138MarineHPSPMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0208382_102574623300025369FreshwaterKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0207959_107024523300025387FreshwaterKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSS
Ga0209405_109228933300025620Pelagic MarineHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS
Ga0209198_109576723300025640Pelagic MarineMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSS
Ga0209602_119293413300025704Pelagic MarineMTKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSSQIVGGAAGL
Ga0208543_109663033300025810AqueousKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0209632_1049344223300025886Pelagic MarineMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST
Ga0247593_109362913300026449SeawaterKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNST
Ga0247602_111123413300026471SeawaterMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFG
Ga0247592_108571023300026500SeawaterKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS
Ga0247587_118665113300026504SeawaterMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVNGADG
Ga0247590_119667813300026513SeawaterMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALF
Ga0209188_119180913300027708Freshwater LakeILGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKDMNETPYALFGGYNSS
Ga0209092_1018389123300027833MarineMGKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGY
Ga0209712_1069162713300027849MarineMGKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSSQIVGGAAGLK
Ga0209404_1111202023300027906MarineLSPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0209702_1028577213300027976FreshwaterLSPHKDMSKKKLHYLWSLKDNGIIDHAIVSFSVTSKEMGETPYALFGGYNSSQIVGGA
Ga0247584_104118613300028110SeawaterMKKKQLHYLWSLNDNGIIDRAMVSFSITSKEMGETPYALFGGYNS
Ga0247584_117643113300028110SeawaterMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNSTQIVGGAEGLK
Ga0256412_108044313300028137SeawaterGLSPHKDVSKKKLHYLWSLKENGIIAHAQVSFSVTSQDMGETPYALFGGYNST
Ga0256413_108962113300028282SeawaterMKKKKLHYLWSLKDNGIIDRALVSFSITSKEMGEGPYALF
Ga0256413_117053713300028282SeawaterLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0256413_134088423300028282SeawaterWSLKDNGIIDNAIVSFSITSQEMGESPYALFGGYNSSQIVGGS
Ga0247572_110024613300028290SeawaterLGLSPHKDMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS
Ga0247597_102566513300028334SeawaterHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSS
Ga0304731_1114551613300028575MarineMSKKKLHYLWSLKDNGIIEHAMVSFSVTSKEMNETPYALFGGYNSS
Ga0307399_1009140813300030702MarineMKKKKLHYLWSLKDNGISDRAMVSFSITSKEMGETPYALFGGYNST
Ga0307399_1021400823300030702MarineKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0307400_1013413123300030709MarineMGKKKLHYLWSLKDNGIIDHAMVSFSVTSQDMGETPYALFGGYNST
Ga0307400_1025797613300030709MarineMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNSSQIVGG
Ga0307400_1026819133300030709MarineMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIV
Ga0307400_1088341923300030709MarineMGKKKLHYLWSLKDNGIIDNAMVSFSVTSKEMGETPYALFGGYNSS
Ga0308139_101292843300030720MarineWSLKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST
Ga0073968_1142490223300030756MarineLKDYGIIDKAMVSFNIASKDMEDEPYALFGGVNSTQIVGG
Ga0073990_1205241113300030856MarineMKKRKLHYLWSLRENGIIDRAMVSFSITSKEMNETPYALFGGYNS
Ga0073977_144014613300030948MarineLGLSPHKDMSKKKLHYLWSLKDNGIIDRAMVSFSITSNEMGETPYALFGGYNSS
Ga0073978_101877623300031036MarineMSKKKLHYLWSMKDNGIIDHAIVSFSVTSKEMGEAPYALFGGYNSSQIVDGSSG
Ga0307983_104278423300031269Saline WaterSPHKDIKKKKLHYLWSLKDNGIIDRAMVSFSITSKDMGETPYALFGGYNSS
Ga0307489_1024076423300031569Sackhole BrineMSKKKLHYLWSLKDNGIIDHAIVSFSITSKDMSEKPYALFGGYNST
Ga0307978_110615113300031613Saline WaterKLHYLWSLKDNGIIDRAMVSFSITSKDMGETPYALFGGYNSS
Ga0307386_1003823123300031710MarineMNKKKLHYLWSLKDNGIIDHAMVSFSVTSQEMGETPYALFGGYNSS
Ga0307386_1034951013300031710MarineWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0307384_1002700623300031738MarineMSKKKLHYLWSMKDNGLIDHAVVSFSVTSKEMGETPYALFGGYNSS
Ga0307383_1015838113300031739MarineMGKKKLHYLWSLKDNGIIDHAMVSFSVTSQEMGETPYALFGG
Ga0307383_1031336113300031739MarineGLSPHKDMSKKKLHYLWSMKDNGIIDHAMVSFSVTSKEMGETPYALFGGYNSS
Ga0315906_1071277423300032050FreshwaterKKLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS
Ga0335396_1043053323300032462FreshwaterNKLHYLWSLKDNGIIDRAMVSFSITSKEMGETPYALFGGYNST
Ga0335396_1051717113300032462FreshwaterLSPHKDMSKKKLHYLWSLKDNGIIDHAIVSFSVTSKEMGETPYALFGGYNSSQIV
Ga0314668_1068149513300032481SeawaterLWSLKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST
Ga0314687_1077691313300032707SeawaterYLWSLKDNGIIDHAMVSFSVTSQDMGETPYALFGGYNST
Ga0314669_1021301723300032708SeawaterQKLHYLWSLKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST
Ga0314690_1026795133300032713SeawaterGILGLSPHKDMRKKKLHYLWSLKHNKIIDHAIVSFSINAKNMNDKPYALFGGYNSSQIIGGA
Ga0314686_1026359413300032714SeawaterPHKDMKKKKLHYLWSLKDNGIIDRAMVSFSITSKEMGEGPYALFGGYNST
Ga0314693_1018594413300032727SeawaterSPHKDQSKQKLHYRWSLKDNGIIDHALVSCSVTSQDMGENPYALFGGYNST
Ga0314711_1068992013300032732SeawaterLGLSPHKDQSKQKLHYLWSLKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST
Ga0314710_1020746833300032742SeawaterKKKLHYLWSLKYNKIIDHAIVSFSINAKNMNDKPYALFGGYNSSQIIGGA
Ga0314712_1013682023300032747SeawaterMKKKKLHYLWSLKDNQIIDRAMVSFSITSREMGETPYALFGGYNSTQIVGGAEGL
Ga0314713_1022057813300032748SeawaterLKDNGIIDHAMVSFSVTSQDMGENPYALFGGYNST
Ga0314713_1043198123300032748SeawaterMSKKKLHYLWSLKDNGIIDHAMVSFSVTSKEMNETPYALFGGYNSSQIVNG
Ga0314709_1012583023300032755SeawaterMKKKKLHYVWSLKDNGIIDRALVSFSITSKEMGEGPYALFGGYNSS
Ga0335024_0320854_1_1203300034051FreshwaterYLWSLKDNGIIDHAMVSLSITSKEMNEGPYALFGGYNSS
Ga0335068_0300090_671_7993300034116FreshwaterKLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS
Ga0335017_0359190_671_7963300034167FreshwaterLHYLWSLKDNGIIDHAMVSFSITSKEMNEGPYALFGGYNSS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.