Basic Information | |
---|---|
Family ID | F039331 |
Family Type | Metagenome |
Number of Sequences | 164 |
Average Sequence Length | 45 residues |
Representative Sequence | MIEIEMPCCGTPTLVEELADVVGCETCGVVLELDEPAPEALPVAA |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 164 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 45.12 % |
% of genes near scaffold ends (potentially truncated) | 17.68 % |
% of genes from short scaffolds (< 2000 bps) | 87.20 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.244 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (15.854 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.537 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.220 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.18% Coil/Unstructured: 80.82% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 164 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 37.20 |
PF00596 | Aldolase_II | 28.66 |
PF00230 | MIP | 23.78 |
PF12679 | ABC2_membrane_2 | 2.44 |
PF03449 | GreA_GreB_N | 1.22 |
PF00027 | cNMP_binding | 0.61 |
PF01966 | HD | 0.61 |
PF01272 | GreA_GreB | 0.61 |
PF08271 | TF_Zn_Ribbon | 0.61 |
PF00892 | EamA | 0.61 |
PF00211 | Guanylate_cyc | 0.61 |
PF00528 | BPD_transp_1 | 0.61 |
PF01243 | Putative_PNPOx | 0.61 |
COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
---|---|---|---|
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 23.78 |
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 1.83 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.24 % |
Unclassified | root | N/A | 9.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908041|P3_CLC_ConsensusfromContig46798 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
3300000956|JGI10216J12902_103875602 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300000956|JGI10216J12902_109048186 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300003322|rootL2_10237867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1787 | Open in IMG/M |
3300003324|soilH2_10060494 | All Organisms → cellular organisms → Bacteria | 8851 | Open in IMG/M |
3300003999|Ga0055469_10252391 | Not Available | 563 | Open in IMG/M |
3300004114|Ga0062593_100146844 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300004114|Ga0062593_100513578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1115 | Open in IMG/M |
3300004114|Ga0062593_100779766 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300004114|Ga0062593_101314255 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300004114|Ga0062593_101419279 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300004114|Ga0062593_101719611 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300004114|Ga0062593_101752089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 681 | Open in IMG/M |
3300004114|Ga0062593_102215235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 616 | Open in IMG/M |
3300004157|Ga0062590_100294564 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
3300004463|Ga0063356_100562572 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300004463|Ga0063356_101011944 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300004463|Ga0063356_101149440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1123 | Open in IMG/M |
3300004463|Ga0063356_102076211 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300004463|Ga0063356_103595203 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300004463|Ga0063356_103903678 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300004479|Ga0062595_101245108 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300004479|Ga0062595_101566530 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300004480|Ga0062592_101022592 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300004480|Ga0062592_102457287 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005172|Ga0066683_10391247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 860 | Open in IMG/M |
3300005181|Ga0066678_11036568 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005332|Ga0066388_107059531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 565 | Open in IMG/M |
3300005336|Ga0070680_100000002 | All Organisms → cellular organisms → Bacteria | 211003 | Open in IMG/M |
3300005340|Ga0070689_100846338 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300005341|Ga0070691_10537763 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300005406|Ga0070703_10063002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1218 | Open in IMG/M |
3300005406|Ga0070703_10388378 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300005440|Ga0070705_100812981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 745 | Open in IMG/M |
3300005440|Ga0070705_100829244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 738 | Open in IMG/M |
3300005440|Ga0070705_101669975 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300005441|Ga0070700_101157769 | Not Available | 644 | Open in IMG/M |
3300005444|Ga0070694_101387035 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300005450|Ga0066682_10340200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 967 | Open in IMG/M |
3300005467|Ga0070706_100073182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3171 | Open in IMG/M |
3300005467|Ga0070706_101225846 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300005468|Ga0070707_101070813 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300005471|Ga0070698_100400633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1305 | Open in IMG/M |
3300005518|Ga0070699_101184270 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300005530|Ga0070679_100896990 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300005536|Ga0070697_100439179 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300005545|Ga0070695_100188096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1468 | Open in IMG/M |
3300005545|Ga0070695_100504185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 936 | Open in IMG/M |
3300005545|Ga0070695_101277337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 606 | Open in IMG/M |
3300005546|Ga0070696_100352902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1139 | Open in IMG/M |
3300005546|Ga0070696_100431629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1036 | Open in IMG/M |
3300005549|Ga0070704_101330439 | Not Available | 658 | Open in IMG/M |
3300005578|Ga0068854_101759931 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005578|Ga0068854_101902742 | Not Available | 547 | Open in IMG/M |
3300005617|Ga0068859_100527892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1275 | Open in IMG/M |
3300006169|Ga0082029_1098180 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300006755|Ga0079222_12248750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
3300006844|Ga0075428_102226624 | Not Available | 565 | Open in IMG/M |
3300006852|Ga0075433_10075235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2971 | Open in IMG/M |
3300006854|Ga0075425_100955266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 979 | Open in IMG/M |
3300006854|Ga0075425_102517077 | Not Available | 570 | Open in IMG/M |
3300006854|Ga0075425_103042114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 512 | Open in IMG/M |
3300006876|Ga0079217_10042203 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
3300006881|Ga0068865_101771561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 558 | Open in IMG/M |
3300006904|Ga0075424_102774430 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300006918|Ga0079216_10240783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1025 | Open in IMG/M |
3300006954|Ga0079219_10075015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1564 | Open in IMG/M |
3300007004|Ga0079218_11287791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 768 | Open in IMG/M |
3300007076|Ga0075435_101939110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 517 | Open in IMG/M |
3300009012|Ga0066710_102378991 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300009093|Ga0105240_10963178 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300009148|Ga0105243_10592109 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300009162|Ga0075423_10075133 | All Organisms → cellular organisms → Bacteria | 3515 | Open in IMG/M |
3300009174|Ga0105241_10896985 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300009176|Ga0105242_10661759 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300009177|Ga0105248_10196369 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
3300009789|Ga0126307_10336744 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300009840|Ga0126313_10791612 | Not Available | 771 | Open in IMG/M |
3300010039|Ga0126309_10124108 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300010039|Ga0126309_10891050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 589 | Open in IMG/M |
3300010040|Ga0126308_10156013 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300010041|Ga0126312_11046348 | Not Available | 598 | Open in IMG/M |
3300010042|Ga0126314_11063708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 602 | Open in IMG/M |
3300010044|Ga0126310_10000919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10900 | Open in IMG/M |
3300010045|Ga0126311_11174406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 634 | Open in IMG/M |
3300010362|Ga0126377_10096932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2682 | Open in IMG/M |
3300010396|Ga0134126_10225037 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
3300010397|Ga0134124_10890604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 896 | Open in IMG/M |
3300010397|Ga0134124_12139535 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300010399|Ga0134127_10067846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3018 | Open in IMG/M |
3300010399|Ga0134127_11725604 | Not Available | 702 | Open in IMG/M |
3300010400|Ga0134122_10340659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1302 | Open in IMG/M |
3300012093|Ga0136632_10067845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1648 | Open in IMG/M |
3300012361|Ga0137360_10719416 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300012930|Ga0137407_11821150 | Not Available | 580 | Open in IMG/M |
3300013100|Ga0157373_11414862 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300013297|Ga0157378_10044856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3927 | Open in IMG/M |
3300013297|Ga0157378_11506812 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300013297|Ga0157378_11990690 | Not Available | 631 | Open in IMG/M |
3300014262|Ga0075301_1114069 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300014299|Ga0075303_1018242 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300014326|Ga0157380_11436685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 741 | Open in IMG/M |
3300015084|Ga0167654_1003422 | All Organisms → cellular organisms → Bacteria | 3091 | Open in IMG/M |
3300015371|Ga0132258_11104127 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
3300015371|Ga0132258_13357793 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300015372|Ga0132256_101651239 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300017787|Ga0183260_10002282 | All Organisms → cellular organisms → Bacteria | 15871 | Open in IMG/M |
3300018076|Ga0184609_10273740 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300018422|Ga0190265_13025613 | Not Available | 561 | Open in IMG/M |
3300018429|Ga0190272_10199423 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
3300018466|Ga0190268_10600085 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300018469|Ga0190270_11202774 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300019377|Ga0190264_10626110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 775 | Open in IMG/M |
3300019377|Ga0190264_10892080 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300020022|Ga0193733_1113289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 753 | Open in IMG/M |
3300020059|Ga0193745_1052916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 889 | Open in IMG/M |
3300021078|Ga0210381_10335954 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300022756|Ga0222622_10483720 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300024430|Ga0196962_10334225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
3300025901|Ga0207688_10358096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 900 | Open in IMG/M |
3300025910|Ga0207684_10018782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5916 | Open in IMG/M |
3300025910|Ga0207684_10107614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2385 | Open in IMG/M |
3300025912|Ga0207707_11443413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
3300025917|Ga0207660_10000002 | All Organisms → cellular organisms → Bacteria | 883566 | Open in IMG/M |
3300025917|Ga0207660_10619971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 881 | Open in IMG/M |
3300025918|Ga0207662_10032160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3052 | Open in IMG/M |
3300025922|Ga0207646_10045374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3945 | Open in IMG/M |
3300025922|Ga0207646_10319713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1402 | Open in IMG/M |
3300025922|Ga0207646_10506656 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300025923|Ga0207681_10908054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 738 | Open in IMG/M |
3300025931|Ga0207644_11682103 | Not Available | 532 | Open in IMG/M |
3300025932|Ga0207690_11377310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 590 | Open in IMG/M |
3300025933|Ga0207706_10313815 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300025934|Ga0207686_10245842 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300025935|Ga0207709_10704043 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300025935|Ga0207709_11340941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
3300025936|Ga0207670_11240463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 632 | Open in IMG/M |
3300025938|Ga0207704_10761326 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300025941|Ga0207711_10857991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 845 | Open in IMG/M |
3300025986|Ga0207658_11545744 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300026075|Ga0207708_10601016 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300026320|Ga0209131_1184171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
3300026329|Ga0209375_1142125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1026 | Open in IMG/M |
3300027886|Ga0209486_10744564 | Not Available | 636 | Open in IMG/M |
3300028578|Ga0272482_10250247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 559 | Open in IMG/M |
3300028589|Ga0247818_11163062 | Not Available | 550 | Open in IMG/M |
3300028597|Ga0247820_11447115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
3300028720|Ga0307317_10347609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
3300028793|Ga0307299_10159226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 850 | Open in IMG/M |
3300028799|Ga0307284_10252663 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300028880|Ga0307300_10133038 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300028880|Ga0307300_10315333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
3300028885|Ga0307304_10084298 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300031720|Ga0307469_10060878 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
3300031720|Ga0307469_11782293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 595 | Open in IMG/M |
3300031731|Ga0307405_10891432 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300031740|Ga0307468_100346239 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300031824|Ga0307413_10758649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 812 | Open in IMG/M |
3300031852|Ga0307410_11895703 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300032005|Ga0307411_10939087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 771 | Open in IMG/M |
3300032005|Ga0307411_11960231 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300032174|Ga0307470_11005075 | Not Available | 664 | Open in IMG/M |
3300032180|Ga0307471_101931753 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300033412|Ga0310810_10013349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9693 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 15.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 7.93% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.49% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.88% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.66% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.66% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.66% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.05% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.05% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.05% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.05% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.22% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.22% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.22% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.22% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.22% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.22% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.22% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.22% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.22% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.61% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.61% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.61% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.61% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.61% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.61% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.61% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P3_CLC_02237990 | 2124908041 | Soil | MIEIELPCCGTATHIDELADVVGCETCGVVLELDPPTLEALPVAA |
JGI10216J12902_1038756022 | 3300000956 | Soil | MQPSGMIEIELPCCGATAHLDDLLDAVDCEMCGVVLELGAPTAEALPVAA* |
JGI10216J12902_1090481862 | 3300000956 | Soil | MFEIEMPCCGTATLLDPSADSVDCETCGVVLELDSPTTSAELLLAA* |
rootL2_102378673 | 3300003322 | Sugarcane Root And Bulk Soil | MIEIELPCCGTMAHLDDLGDEIDCEACGVVLELGAATPDALPVAA* |
soilH2_100604944 | 3300003324 | Sugarcane Root And Bulk Soil | MIEIEMPCCGTTTVIDELRDSVSCETCGVVLELDEPAAEALPVAA* |
Ga0055469_102523912 | 3300003999 | Natural And Restored Wetlands | MIQIGLPCCEATVHLEELAASVSCEACGVVLELDGPSREALPVAA* |
Ga0062593_1001468443 | 3300004114 | Soil | MVEIEMPCCGTATRVEELTGEVGCETCNVVLELADTATEALPVAA* |
Ga0062593_1005135782 | 3300004114 | Soil | MIQIEMPCCGTTTTVEALDDSVDCETCGVVLELADPAIEALPVAA* |
Ga0062593_1007797662 | 3300004114 | Soil | MIEIEMPCCGTATLVEELAEVVGCETCGVVLELDEPAPEALLVAA* |
Ga0062593_1013142552 | 3300004114 | Soil | MIEIELPCCGATAHLEDLPDAVDCEACGVVLELGAPTTEALPVAA* |
Ga0062593_1014192792 | 3300004114 | Soil | MIEIQMPCCGTPTLIEELTDAVGCETCGVVLELDEPAIEALPVAA* |
Ga0062593_1017196111 | 3300004114 | Soil | MIEIELPCCGTTAHLADFGDEVDCETCGVVLELAPPAPQALPVAA* |
Ga0062593_1017520892 | 3300004114 | Soil | MIEIEMPCCGNTTTVDELHERVHCETCRVDLELGEPAIEALPVAA* |
Ga0062593_1022152351 | 3300004114 | Soil | MIEIEMPCCGTTTMVEELRDSVACETCRVVLELNEPAIEALPVAA* |
Ga0062590_1002945642 | 3300004157 | Soil | MIEIQMPCCGTPTLIEELTDAVGCETCGVVVELDEPAIEALPVAA* |
Ga0063356_1005625721 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIEIEMPCCGTATQIEQLADEVGCETCGVVLELADTVLEALPVAA* |
Ga0063356_1010119442 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIKIEMPCCGTTTHVVELTDWVDCETCGVVLELADPTVEALPVAA* |
Ga0063356_1011494402 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIEIEMPCCGTATRIEELTDDVGCETCGVVLELGDPAPEALPVAA* |
Ga0063356_1020762112 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVEIEMPCCGTTTLIAELTDEVGCETCNVVLELADSHSEALPVAA* |
Ga0063356_1035952032 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVEIEMPCCGTATRVEELTDEVGCETCNVVLELADTTTEALPVAA* |
Ga0063356_1039036782 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIEIELPCCGTRTHLVELADTVDCETCGVVLELGDPGPERLPVAA* |
Ga0062595_1012451081 | 3300004479 | Soil | MIEIELPCCGSTTHIDELTDVVGCETCGVVLELDPHTPEALPVAA* |
Ga0062595_1015665301 | 3300004479 | Soil | RCQCNFRAMIEIELPCCGSTTHLVELTDSVRCETCFVVLELDAPEPEALPVAA* |
Ga0062592_1010225922 | 3300004480 | Soil | MFEIEMPCCGTTAYLDQSADSVDCETCGVVLELDVPTTEALPVAA* |
Ga0062592_1024572871 | 3300004480 | Soil | MIEIELPCCGTATYLDELADTIGCETCGVVLELADPAPASIELPLAA* |
Ga0066683_103912472 | 3300005172 | Soil | MIEIEMPCCGTATLVEELTDSVGCETCGVVLELDSPATEALPVAA* |
Ga0066678_110365682 | 3300005181 | Soil | MIEIEMPCCGSTTRVEELRDSVDCETCGIVLELDEHPTEALPVAA* |
Ga0066388_1070595312 | 3300005332 | Tropical Forest Soil | MIEIEMPCCGTTTTVDELCDEVDCETCGVVMELGDPAIEALPVAA* |
Ga0070680_10000000216 | 3300005336 | Corn Rhizosphere | MIEIEMPCCGTPALIAELTDDVGCEICGVVLELADPAPEALAAAA* |
Ga0070689_1008463382 | 3300005340 | Switchgrass Rhizosphere | MIEIEMPCCGTPTLVEVLADVVGCETCGVVLELDEPAPEALPVAA* |
Ga0070691_105377632 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTPALIAELTDDVGCETCGVVLELADPAPGALAAAA* |
Ga0070703_100630023 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | IEIQMPCCGTPTLIEELTDAVGCETCGVVLELDEPAHEALPVAA* |
Ga0070703_103883781 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGNVTVVEELHESVRCETCGIELELGESAPEALPAAA* |
Ga0070705_1008129812 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGNVTVVEELHESVRCETCGIELELGESAPEALPVAA* |
Ga0070705_1008292442 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTSTRVDELADVVGCETCGVVLELADSAPEALPVAA* |
Ga0070705_1016699752 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQIEMPCCGTTTTVEALDDSVDCETCGVVLELDPPAAEALPVAA* |
Ga0070700_1011577692 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTQTLVEMLADAVGCETCGVVLELDEPAHEALPVAA* |
Ga0070694_1013870351 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTTTMVEELADAVGCETCGVVLELDEPATEALPVAA* |
Ga0066682_103402002 | 3300005450 | Soil | TRRHGNLSGMIEIEMPCCGTATLVEELTDSVGCETCGVVLELDSPATEALPVAA* |
Ga0070706_1000731823 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MWVQAPGMIEIEMPCCGTTALVEELRDSVGCETCGVVLELDEPVIEALPVAA* |
Ga0070706_1012258462 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTTTTVEELADAVGCETCGVVLELDEPATEALPVAA* |
Ga0070707_1010708132 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIELPCCGSTTHIDELTDVVGCETCGVVLELDPPTPEALPVAA* |
Ga0070698_1004006332 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTSTRVDELADLVGCETCGVVLELADSAPEALPVAA* |
Ga0070699_1011842702 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTTTMVEELRDSVDCETCGVVLELDEPAFEALRVAA* |
Ga0070679_1008969902 | 3300005530 | Corn Rhizosphere | MIEIEMPCCGNVTVVEELHESVRCETCGIELELGESAPEA |
Ga0070697_1004391791 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTPTLVEELTDSVGCETCGVVLELDEPAIEAMPVAA* |
Ga0070695_1001880963 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGNITVVEELHESVRCETCGIELELGESAPEALPVAA* |
Ga0070695_1005041852 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTPTLVELLADVVGCETCGVVLELDEPAPEALPVAA* |
Ga0070695_1012773372 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTTALIAEVTDDVGCETCGVVLELADPAPEALAAAA* |
Ga0070696_1003529021 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTTALMAEVTDDVACETCGVVLELADPAPEALAAAA* |
Ga0070696_1004316292 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MPCCGTPTLVEKLADVVGCETCGVVLELDEPAPEALPVAA* |
Ga0070704_1013304392 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AMIEIEMPCCGTPTLVELLADVVGCETCGVVLELDEPAPEALPVAA* |
Ga0068854_1017599312 | 3300005578 | Corn Rhizosphere | MVEIEMPCCGTTTLVEELTDEVGCEMCNVVLELGEPTAHALLAAA* |
Ga0068854_1019027421 | 3300005578 | Corn Rhizosphere | PTLVEMLADAVGCETCGVVLELDEPAHEALPVAA* |
Ga0068859_1005278922 | 3300005617 | Switchgrass Rhizosphere | VHFLPMFEIEMPCCGTPALFEEAADSVDCETCGVVLELEPSAPASVELPLAA* |
Ga0082029_10981801 | 3300006169 | Termite Nest | MIEIELPCCGTTAHLADLSDEVDCEACGVVLELGESRPEALPVAA* |
Ga0079222_122487501 | 3300006755 | Agricultural Soil | KVARRSPRLRAMIEIEMPCCGTSTLVELLADVVGCETCGVVLELDEPAPEALPVAA* |
Ga0075428_1022266241 | 3300006844 | Populus Rhizosphere | PCCGTTAHLDDLLDAVDCEACGVVLELGAPTTEALPVAA* |
Ga0075433_100752355 | 3300006852 | Populus Rhizosphere | MIEIQMPCCGTPTLIEELTDAVGCETCGVVLELDEPAIEA |
Ga0075425_1009552663 | 3300006854 | Populus Rhizosphere | QAPGMIEIEMPCCGTTALVEELRDSVGCETCGVVLELDDPAIEALPVAA* |
Ga0075425_1025170771 | 3300006854 | Populus Rhizosphere | MIEIEMPCCGTTKRVEELRDSVACETCGIVLELDEQPSEALPVAA* |
Ga0075425_1030421142 | 3300006854 | Populus Rhizosphere | MIEIELPCCGTTAHLFELTDSVDCEMCGVVLELGDPTFEALPVAA* |
Ga0079217_100422032 | 3300006876 | Agricultural Soil | MIQIELPCCETTVHIEELAETVGCETCGVVLELAGPNREALPVAA* |
Ga0068865_1017715611 | 3300006881 | Miscanthus Rhizosphere | QASGMIEIEMPCCGNITVVEELHESVRCETCGIELELGESAPEALPVAA* |
Ga0075424_1027744301 | 3300006904 | Populus Rhizosphere | MIEIEMPCCGTPTLVEMLADAVGCETCGVVLELDAPATEALPVAA* |
Ga0079216_102407831 | 3300006918 | Agricultural Soil | MIQIELPCCETTVHIEELAETVGCETCGVVLELAGPSREALPIAA* |
Ga0079219_100750153 | 3300006954 | Agricultural Soil | MIEIEMPCCGTATLVEELADVVGCETCGVVLELDAPAPEALPVAA* |
Ga0079218_112877912 | 3300007004 | Agricultural Soil | MIQIELPCCEATVHMEELAESVSCEACGVVLELDGPSREALPVAA* |
Ga0075435_1019391101 | 3300007076 | Populus Rhizosphere | SPMIEIEMPCCGTSTRVDELADVVGCETCGVVLELAESAPEALPVAA* |
Ga0066710_1023789912 | 3300009012 | Grasslands Soil | MIEIEMPCCGTPTLVEELADAVGCETCGVVLELDEPATEALPVAA |
Ga0105240_109631782 | 3300009093 | Corn Rhizosphere | MIEIEMPCCGTPTLVEMLADAVGCETCGVVLELDEPAHEALPVAA* |
Ga0105243_105921092 | 3300009148 | Miscanthus Rhizosphere | MIEIEMPCCGTPTLVEKLADVVGCETCGVVLELDEPAPEALPVAA* |
Ga0075423_100751332 | 3300009162 | Populus Rhizosphere | MIEIEMPCCGTTALVEELRDSVGCETCGVVLELDDPAIEALPVAA* |
Ga0105241_108969852 | 3300009174 | Corn Rhizosphere | MIEIEMPCCGNITVVEELHESVRCETCGIELELGESAPEALPAAA* |
Ga0105242_106617592 | 3300009176 | Miscanthus Rhizosphere | MIEIEMPCCGTTTTVEALDDSVDCETCGVVLELADPAIEALPVAA* |
Ga0105248_101963693 | 3300009177 | Switchgrass Rhizosphere | MIEIEMPCCGNVTVVEELHESVRCETCGIELELGEPALEALPVAA* |
Ga0126307_103367442 | 3300009789 | Serpentine Soil | MFEIEMPCCGTTAYLDESADSVDCETCGVVLELDSPTPEALPVAA* |
Ga0126313_107916121 | 3300009840 | Serpentine Soil | NFRAMVEIEMPCCGITTRVEELTDEVACETCNVVLELGDSFAETLPVAA* |
Ga0126309_101241082 | 3300010039 | Serpentine Soil | MVEIEMPCCGTTTRIPELTDTVDCETCNVVLDLADSYTEALPVAA* |
Ga0126309_108910502 | 3300010039 | Serpentine Soil | MVEIEMPCCGTTTRVAELTDEVGCETCNVVLELADSYTEALPVAA* |
Ga0126308_101560132 | 3300010040 | Serpentine Soil | MVEIEMPCCGTTTHIAELADEVRCETCNVALELADSYPEALPVAA* |
Ga0126312_110463482 | 3300010041 | Serpentine Soil | MVEIEMPCCGITTRVEELTDEVACETCNVVLELGDSFAETLPVAA* |
Ga0126314_110637082 | 3300010042 | Serpentine Soil | MVEIEMPCCGTPTHIAELTDEVRCETCNVVLELADSYAEALPVAA* |
Ga0126310_100009195 | 3300010044 | Serpentine Soil | MIEIELPCCGTTARLEDLGDEVDCETCGVVLELGTTAPEALAVAA* |
Ga0126311_111744061 | 3300010045 | Serpentine Soil | MPCCGTTAYFDESADSVDCETCGVVLELDSPTPEALPVAA* |
Ga0126377_100969322 | 3300010362 | Tropical Forest Soil | MIEIEMPCCGTPSLVEELTDSVGCETCGVVLELADPAPEALPVAA* |
Ga0134126_102250373 | 3300010396 | Terrestrial Soil | MIEIEMPCCGTTTMVEELRDSVACETCRVVLELDEPAIEALPVAA* |
Ga0134124_108906041 | 3300010397 | Terrestrial Soil | RLRAMIEIQMPCCGTPTLIEELTDAVGCETCGVVLELDEPAIEALPVAA* |
Ga0134124_121395352 | 3300010397 | Terrestrial Soil | MIEIELPCCGSTTHLVELTDSVRCETCFVVLELDAPEPEALPVAA* |
Ga0134127_100678462 | 3300010399 | Terrestrial Soil | MIEIEMPCCGTTTVVEELRDSVACETCRVVLELDEPAIEALPVAA* |
Ga0134127_117256042 | 3300010399 | Terrestrial Soil | MIEIEMPCCGTPTLVERLADVAGCETCGVVLELDEPAPEALPVAA* |
Ga0134122_103406592 | 3300010400 | Terrestrial Soil | MIEIEMPCCGTPTLVERLADVVGCETCGVVLELDEPAPEALPVAA* |
Ga0136632_100678452 | 3300012093 | Polar Desert Sand | MIEIELPCCEATTYIEELTDSVGCEACGVVLELDLPRREAFPVAA* |
Ga0137360_107194162 | 3300012361 | Vadose Zone Soil | MIEIEMPCCGTMALVEELRDSVGCETCGVVLELDEPASEALPVAA* |
Ga0137407_118211502 | 3300012930 | Vadose Zone Soil | MIEIEMPCCGTMALVEELRDSVGCETCGVVLELDEPTTEALPVAA* |
Ga0157373_114148621 | 3300013100 | Corn Rhizosphere | MIEIEMPCCGTPALIAELTDDVGCKTCGVVLELADPAPGALAAAA* |
Ga0157378_100448566 | 3300013297 | Miscanthus Rhizosphere | MIEIEMPCCGTSTLVELLADVVGCETCGVVLELHEPAHEDMHSAA* |
Ga0157378_115068122 | 3300013297 | Miscanthus Rhizosphere | MIEIEMPCCGNITVVEELHESVRCETCGIDLELGESKLEALPVAA* |
Ga0157378_119906902 | 3300013297 | Miscanthus Rhizosphere | ERPCCGTPTLVEVLADVVGCETCGVVLELDEPAPEALPVAA* |
Ga0075301_11140692 | 3300014262 | Natural And Restored Wetlands | MIQIELPCCGTTTHIDELTDSVRCEACAVVLELAEPALEALPLAA* |
Ga0075303_10182422 | 3300014299 | Natural And Restored Wetlands | MIQIELPCCGNATHLVELTESVECETCGVVLELADSAPEALPRAA* |
Ga0157380_114366852 | 3300014326 | Switchgrass Rhizosphere | LRAMIEIEMPCCGTPTLVEKLADVVGCETCGVVLELDEPAIEALPVAA* |
Ga0167654_10034224 | 3300015084 | Glacier Forefield Soil | MIEIEMPCCGTPAYVEELADLVGCETCGVVLELDVAATEAIPVAA* |
Ga0132258_111041272 | 3300015371 | Arabidopsis Rhizosphere | MIEIEMPCCGTASLVEELTDSVGCETCGVVLELADPAPEALPVAA* |
Ga0132258_133577932 | 3300015371 | Arabidopsis Rhizosphere | MIEIEMPCCGTTALVEELRDSVGCETCGVVLELDEPAIEALPVAA* |
Ga0132256_1016512392 | 3300015372 | Arabidopsis Rhizosphere | MIEIEMPCCGNITVVEELHESVRCETCGIDLELGEPTLEALPVAA* |
Ga0183260_100022827 | 3300017787 | Polar Desert Sand | MIEIELPCCEATTYIEELTDSVGCEACGVVLELDLPRREAFPVAA |
Ga0184609_102737402 | 3300018076 | Groundwater Sediment | MFDIEMPCCGTATQIEELADSVGCETCGVVLELDEPAPEALPVAA |
Ga0190265_130256131 | 3300018422 | Soil | LRAMIEIELPCCGTTAHLDDLLDAVDCEACGVVLELGPPISQALPVAA |
Ga0190272_101994232 | 3300018429 | Soil | MIQIELPCCETTVHIEELAETVGCEACGVVLELAGPSREALPVAA |
Ga0190268_106000852 | 3300018466 | Soil | MIEIELPCCGTTAHLDDLLDAVDCETCGVVLELGAPTPEPLPVAA |
Ga0190270_112027742 | 3300018469 | Soil | MIEIELPCCGTTTHLFELTESVDCETCGVVLELGDPTPEALPVAA |
Ga0190264_106261101 | 3300019377 | Soil | KANLRAMIEIELPCCGATAHLDDLLDAVDCEACGVVLELGAPTSEALPVAA |
Ga0190264_108920801 | 3300019377 | Soil | MPCCGTTTHIAQLTDEVACETCNVVLELGDRYIEALPVAA |
Ga0193733_11132891 | 3300020022 | Soil | RHRSLRDMIEIEMPCCGTATLVEELTDSVGCEACGVVLELDDPATEALPVAA |
Ga0193745_10529162 | 3300020059 | Soil | MIEIEMPCCGTATLLEELADVVGCETCGVVLELDTPAPEALPVAA |
Ga0210381_103359542 | 3300021078 | Groundwater Sediment | MPCCGTATLVEELTDSVGCETCGVVLELDSPATETLP |
Ga0222622_104837201 | 3300022756 | Groundwater Sediment | MPCCGTATLVEELTDSVGCETCGVVLELDSPATETLPVAA |
Ga0196962_103342252 | 3300024430 | Soil | MIEIELPCCGTTTHLDDLHDAVECEECGVVLELGAPTPQALPVAA |
Ga0207688_103580961 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIQMPCCGTPTLIEELTDAVGCETCGVVLELDEPAIEALPVAA |
Ga0207684_100187823 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPCCGTSTRVDELADVVGCETCGVVLELADSAPEALPVAA |
Ga0207684_101076142 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MWVQAPGMIEIEMPCCGTTALVEELRDSVGCETCGVVLELDEPVIEALPVAA |
Ga0207707_114434132 | 3300025912 | Corn Rhizosphere | MIEIEMPCCGTPTLVEKLADVVGCETCGVVLELDEPAPQALPVAA |
Ga0207660_10000002636 | 3300025917 | Corn Rhizosphere | MIEIEMPCCGTPALIAELTDDVGCEICGVVLELADPAPEALAAAA |
Ga0207660_106199712 | 3300025917 | Corn Rhizosphere | VQPSGMIEIEMPCCGTTTMVEELRDSVDCETCGVVLELDEPAFEALRVAA |
Ga0207662_100321602 | 3300025918 | Switchgrass Rhizosphere | MIEIEMPCCGNVTVVEELHESVRCETCGIELELGESAPEALPVAA |
Ga0207646_100453744 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTSTRVDELADVVGCETCGVVLELADSAPEALPVAA |
Ga0207646_103197132 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGTTTMVEELADAVGCETCGVVLELDEPATEALPVAA |
Ga0207646_105066562 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIEMPCCGSTTRVEELRDSVDCETCGIVLELDEHPTEALPVAA |
Ga0207681_109080542 | 3300025923 | Switchgrass Rhizosphere | PSGMIQIEMPCCGTTTTVEALDDSVDCETCGVVLELADPAIEALPVAA |
Ga0207644_116821032 | 3300025931 | Switchgrass Rhizosphere | MIEIEMPCCGNITVVEELHESVRCETCGIELELGESAPEALPAAA |
Ga0207690_113773102 | 3300025932 | Corn Rhizosphere | MIQIEMPCCGTTTTVETLEDSVDCETCGVVLELADPAIETLPVAA |
Ga0207706_103138152 | 3300025933 | Corn Rhizosphere | MIEIEMPCCGTPTLVEMLADAVGCETCGVVLELDEPAHEALPVAA |
Ga0207686_102458422 | 3300025934 | Miscanthus Rhizosphere | MIEIEMPCCGTPTLVERLADVVGCETCGVVLELDEPAPEALPVAA |
Ga0207709_107040432 | 3300025935 | Miscanthus Rhizosphere | MIEIEMPCCGNVTVVEELHESVRCETCGIELELGESAPEALPAAA |
Ga0207709_113409412 | 3300025935 | Miscanthus Rhizosphere | MPCCGTPTLVELLADVVGCETCGVVLELDEPAPEALPVAA |
Ga0207670_112404632 | 3300025936 | Switchgrass Rhizosphere | MIEIEMPCCGTPTLVEVLADVVGCETCGVVLELDEPAPEALPVAA |
Ga0207704_107613262 | 3300025938 | Miscanthus Rhizosphere | MIEIEMPCCGNITVVEELHESVRCETCGIELELGESAPEALPVAA |
Ga0207711_108579912 | 3300025941 | Switchgrass Rhizosphere | MIEIEMPCCGNVTVVEELHESVRCETCGIELELGEPALEALPVAA |
Ga0207658_115457442 | 3300025986 | Switchgrass Rhizosphere | MIEIEMPCCGTPTLVELLADVVGCETCGVVLELDEPAPEALPVAA |
Ga0207708_106010162 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEIQMPCCGTPTLIEELTDAVGCETCGVVLELDEPAPEALPVAA |
Ga0209131_11841712 | 3300026320 | Grasslands Soil | MIEIEMPCCGTSTRVDELADVVGCETCGVVLEPADSAPEALAVAA |
Ga0209375_11421251 | 3300026329 | Soil | IEIEMPCCGTATLVEELTDSVGCETCGVVLELDSPATEALPVAA |
Ga0209486_107445642 | 3300027886 | Agricultural Soil | MIQIELPCCETTVHIEELAEAVGCETCGVVLELAGPNREALPVAA |
Ga0272482_102502472 | 3300028578 | Soil | MPCCGTTTRVAELTDEVGCETCNVVLELGDRYIEALPVAA |
Ga0247818_111630622 | 3300028589 | Soil | MIEIELPCCGATAHLEDLPDAVDCEACGVVLELGAPTTEALPVAA |
Ga0247820_114471151 | 3300028597 | Soil | MIEIELPCCGTATHVIELTDSVECETCNVVLGLGDPAPEALPLAA |
Ga0307317_103476092 | 3300028720 | Soil | PCCGTATLVEELTDSVGCETCGVVLELDSPATETLPVAA |
Ga0307299_101592261 | 3300028793 | Soil | SRMIEIEMPCCGTATLVEELTDSVGCETCGVVLELDSPATETLPVAA |
Ga0307284_102526632 | 3300028799 | Soil | MIEIEMPCCGTPTLVEELADVVGCENCGVVLELDEAAPEALPVAA |
Ga0307300_101330382 | 3300028880 | Soil | MVEIEMPCCGTTALVEELTDEVGCETCNVVLELADPTPQALPVAA |
Ga0307300_103153332 | 3300028880 | Soil | MVEIEMPCCGTTTLIEELTDEVGCDTCNVVLELAEPTELALPVAA |
Ga0307304_100842982 | 3300028885 | Soil | MIEIEMPCCGTATLVEELADVVGCETCGVVLELDAPAPEALPVAA |
Ga0307469_100608782 | 3300031720 | Hardwood Forest Soil | MIEIEMPCCGTTALVEELRDSVGCETCGVVLELDEPAIEALPVAA |
Ga0307469_117822932 | 3300031720 | Hardwood Forest Soil | MPCCGTPTLIEELADAVGCETCGVVLELDEPAIEALPVAA |
Ga0307405_108914322 | 3300031731 | Rhizosphere | MVEIEMPCCGTTTLVEELTDEVGCEACNVVLELADTTAEGLPVAA |
Ga0307468_1003462392 | 3300031740 | Hardwood Forest Soil | MIEIEMPCCGTPTMVEKLADVVGCETCGVVLELDEPAPEALPVAA |
Ga0307413_107586492 | 3300031824 | Rhizosphere | MPCCGTATQIEQLADEVGCERCGVVLELADTVLEALPVAA |
Ga0307410_118957032 | 3300031852 | Rhizosphere | MPCCGTATQIEQLADEVGCERCGVVLELADTVLEALP |
Ga0307411_109390871 | 3300032005 | Rhizosphere | RCQRNFRAMVEIEMPCCGNTTRVEELTDEVGCETCNVVLELADTYAEALPVAA |
Ga0307411_119602312 | 3300032005 | Rhizosphere | MPCCGTTTLVEELTDEVGCETCNVVLDLADNYAARLAVAA |
Ga0307470_110050751 | 3300032174 | Hardwood Forest Soil | RGPSLRAMIEIEMPCCGTPTLVERLADVVGCETCGVVLELDEPAPEALPVAA |
Ga0307471_1019317532 | 3300032180 | Hardwood Forest Soil | MIEIEMPCCGTPTLVEELADVVGCETCGVVLELDEPAPEALPVAA |
Ga0310810_100133499 | 3300033412 | Soil | MIEIEMPCCGTATLVEELAEVVGCETCGVVLELDEPAPEALLVAA |
⦗Top⦘ |