NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039240

Metagenome / Metatranscriptome Family F039240

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039240
Family Type Metagenome / Metatranscriptome
Number of Sequences 164
Average Sequence Length 44 residues
Representative Sequence VHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS
Number of Associated Samples 138
Number of Associated Scaffolds 164

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 16.67 %
% of genes near scaffold ends (potentially truncated) 79.88 %
% of genes from short scaffolds (< 2000 bps) 87.80 %
Associated GOLD sequencing projects 132
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (59.146 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.854 % of family members)
Environment Ontology (ENVO) Unclassified
(25.610 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(60.976 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 11.76%    Coil/Unstructured: 88.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 164 Family Scaffolds
PF04075F420H2_quin_red 25.61
PF00135COesterase 14.02
PF13599Pentapeptide_4 3.66
PF00196GerE 1.83
PF00067p450 1.83
PF13424TPR_12 1.83
PF00941FAD_binding_5 1.83
PF06724DUF1206 1.22
PF02687FtsX 1.22
PF07730HisKA_3 1.22
PF00132Hexapep 1.22
PF00083Sugar_tr 1.22
PF03450CO_deh_flav_C 1.22
PF02585PIG-L 0.61
PF00072Response_reg 0.61
PF13191AAA_16 0.61
PF02604PhdYeFM_antitox 0.61
PF10025DUF2267 0.61
PF09678Caa3_CtaG 0.61
PF04993TfoX_N 0.61
PF01734Patatin 0.61
PF08281Sigma70_r4_2 0.61
PF01596Methyltransf_3 0.61
PF00805Pentapeptide 0.61
PF03853YjeF_N 0.61
PF00266Aminotran_5 0.61
PF01740STAS 0.61
PF00872Transposase_mut 0.61
PF07876Dabb 0.61
PF13738Pyr_redox_3 0.61
PF13520AA_permease_2 0.61
PF13469Sulfotransfer_3 0.61
PF03704BTAD 0.61
PF13649Methyltransf_25 0.61
PF05345He_PIG 0.61
PF07883Cupin_2 0.61
PF01244Peptidase_M19 0.61
PF02148zf-UBP 0.61
PF08245Mur_ligase_M 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 164 Family Scaffolds
COG2272Carboxylesterase type BLipid transport and metabolism [I] 14.02
COG2124Cytochrome P450Defense mechanisms [V] 1.83
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 1.22
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 1.22
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 1.22
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 1.22
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.61
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.61
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.61
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.61
COG0062NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domainNucleotide transport and metabolism [F] 0.61
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.61
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.61
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.61
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.61
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 0.61
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.61
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 0.61
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.61
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.61
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.61
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.61
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.07 %
UnclassifiedrootN/A32.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_139834All Organisms → cellular organisms → Bacteria → Terrabacteria group1335Open in IMG/M
3300004080|Ga0062385_11099244Not Available539Open in IMG/M
3300004152|Ga0062386_100215724Not Available1513Open in IMG/M
3300005328|Ga0070676_11186979Not Available579Open in IMG/M
3300005435|Ga0070714_101535534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8650Open in IMG/M
3300005602|Ga0070762_11239810Not Available517Open in IMG/M
3300005610|Ga0070763_10100498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1458Open in IMG/M
3300005610|Ga0070763_10109700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1401Open in IMG/M
3300005614|Ga0068856_100605591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1116Open in IMG/M
3300005834|Ga0068851_10175344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1185Open in IMG/M
3300005840|Ga0068870_10049160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2223Open in IMG/M
3300006046|Ga0066652_100740187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300006052|Ga0075029_100525486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae783Open in IMG/M
3300006059|Ga0075017_100680194All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300006175|Ga0070712_101549277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8579Open in IMG/M
3300006176|Ga0070765_100221168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1726Open in IMG/M
3300006176|Ga0070765_102187593Not Available516Open in IMG/M
3300006354|Ga0075021_10924967All Organisms → cellular organisms → Bacteria → Terrabacteria group567Open in IMG/M
3300006358|Ga0068871_101956200Not Available558Open in IMG/M
3300006575|Ga0074053_10013251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia735Open in IMG/M
3300006579|Ga0074054_12084340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria787Open in IMG/M
3300006605|Ga0074057_12295004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1873Open in IMG/M
3300006755|Ga0079222_11180933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia683Open in IMG/M
3300006804|Ga0079221_10252090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1004Open in IMG/M
3300006854|Ga0075425_101857635Not Available675Open in IMG/M
3300009101|Ga0105247_11149078All Organisms → cellular organisms → Bacteria → Terrabacteria group615Open in IMG/M
3300009143|Ga0099792_10213753Not Available1104Open in IMG/M
3300009520|Ga0116214_1126230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300009525|Ga0116220_10000887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11902Open in IMG/M
3300009525|Ga0116220_10155639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia982Open in IMG/M
3300009525|Ga0116220_10305452Not Available701Open in IMG/M
3300009683|Ga0116224_10256108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8835Open in IMG/M
3300009698|Ga0116216_10513542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300010333|Ga0134080_10561029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8551Open in IMG/M
3300010396|Ga0134126_11571835Not Available724Open in IMG/M
3300010396|Ga0134126_13042431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8506Open in IMG/M
3300010876|Ga0126361_10655038All Organisms → cellular organisms → Bacteria2426Open in IMG/M
3300010876|Ga0126361_10715589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1381Open in IMG/M
3300010876|Ga0126361_11018027All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300010880|Ga0126350_10053733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium858Open in IMG/M
3300010880|Ga0126350_10352724Not Available1232Open in IMG/M
3300010880|Ga0126350_11253251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia648Open in IMG/M
3300011120|Ga0150983_11798901Not Available541Open in IMG/M
3300012201|Ga0137365_10019788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5239Open in IMG/M
3300012209|Ga0137379_11405497Not Available601Open in IMG/M
3300012354|Ga0137366_10005649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9809Open in IMG/M
3300012357|Ga0137384_10668376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia845Open in IMG/M
3300012924|Ga0137413_10223023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1280Open in IMG/M
3300012987|Ga0164307_11141600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8642Open in IMG/M
3300013307|Ga0157372_12951523Not Available544Open in IMG/M
3300014166|Ga0134079_10197981Not Available841Open in IMG/M
3300016371|Ga0182034_10192983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1569Open in IMG/M
3300017937|Ga0187809_10290856Not Available600Open in IMG/M
3300017946|Ga0187879_10205877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1102Open in IMG/M
3300017961|Ga0187778_10324632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia999Open in IMG/M
3300017972|Ga0187781_10024413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4188Open in IMG/M
3300018007|Ga0187805_10583279All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300018025|Ga0187885_10192000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia950Open in IMG/M
3300018057|Ga0187858_10143725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1594Open in IMG/M
3300018058|Ga0187766_10340811Not Available979Open in IMG/M
3300018482|Ga0066669_10923620Not Available783Open in IMG/M
3300019082|Ga0187852_1242928Not Available730Open in IMG/M
3300019890|Ga0193728_1134434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1106Open in IMG/M
3300020581|Ga0210399_10020178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae5276Open in IMG/M
3300020582|Ga0210395_11219510Not Available552Open in IMG/M
3300021170|Ga0210400_10753497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia799Open in IMG/M
3300021171|Ga0210405_11026452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae620Open in IMG/M
3300021180|Ga0210396_10954519All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300021181|Ga0210388_10371187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1258Open in IMG/M
3300021181|Ga0210388_11645346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8532Open in IMG/M
3300021401|Ga0210393_10170169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1755Open in IMG/M
3300021401|Ga0210393_10230613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1500Open in IMG/M
3300021401|Ga0210393_11240413Not Available599Open in IMG/M
3300021402|Ga0210385_11123195Not Available603Open in IMG/M
3300021405|Ga0210387_10213658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1678Open in IMG/M
3300021406|Ga0210386_10499214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1051Open in IMG/M
3300021407|Ga0210383_10821699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300021474|Ga0210390_10418533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1132Open in IMG/M
3300021477|Ga0210398_10434957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1069Open in IMG/M
3300021477|Ga0210398_11019286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae660Open in IMG/M
3300021477|Ga0210398_11165303Not Available610Open in IMG/M
3300021559|Ga0210409_10852411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae784Open in IMG/M
3300024225|Ga0224572_1037749Not Available913Open in IMG/M
3300024271|Ga0224564_1090362Not Available618Open in IMG/M
3300024288|Ga0179589_10295938All Organisms → cellular organisms → Bacteria → Terrabacteria group727Open in IMG/M
3300025434|Ga0208690_1026916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria950Open in IMG/M
3300025633|Ga0208480_1079229Not Available802Open in IMG/M
3300025928|Ga0207700_11742589Not Available549Open in IMG/M
3300025931|Ga0207644_11039688Not Available688Open in IMG/M
3300026035|Ga0207703_12029382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8551Open in IMG/M
3300027096|Ga0208099_1021827All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300027109|Ga0208603_1021065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1044Open in IMG/M
3300027110|Ga0208488_1039316Not Available848Open in IMG/M
3300027497|Ga0208199_1102079Not Available592Open in IMG/M
3300027567|Ga0209115_1055189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia905Open in IMG/M
3300027575|Ga0209525_1073938Not Available819Open in IMG/M
3300027590|Ga0209116_1002317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4442Open in IMG/M
3300027783|Ga0209448_10059660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1283Open in IMG/M
3300027812|Ga0209656_10000824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria20019Open in IMG/M
3300027853|Ga0209274_10626259All Organisms → cellular organisms → Bacteria → Terrabacteria group556Open in IMG/M
3300027879|Ga0209169_10207814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae1024Open in IMG/M
3300027884|Ga0209275_10063017Not Available1817Open in IMG/M
3300027889|Ga0209380_10592590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300027911|Ga0209698_11249799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300028138|Ga0247684_1019629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1065Open in IMG/M
3300028745|Ga0302267_10414513Not Available554Open in IMG/M
3300028755|Ga0307316_10218781Not Available688Open in IMG/M
3300028768|Ga0307280_10006083Not Available3144Open in IMG/M
3300028768|Ga0307280_10006533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3050Open in IMG/M
3300028775|Ga0302231_10146789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8984Open in IMG/M
3300028801|Ga0302226_10041753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2233Open in IMG/M
3300028806|Ga0302221_10037262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium2280Open in IMG/M
3300028808|Ga0302228_10118656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1231Open in IMG/M
3300028808|Ga0302228_10279763Not Available749Open in IMG/M
3300028879|Ga0302229_10139098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1129Open in IMG/M
3300028884|Ga0307308_10348363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8709Open in IMG/M
3300028906|Ga0308309_10320060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1316Open in IMG/M
3300028906|Ga0308309_10460269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1096Open in IMG/M
3300028906|Ga0308309_10902405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae767Open in IMG/M
3300028906|Ga0308309_10967339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae738Open in IMG/M
3300029882|Ga0311368_10313079Not Available1185Open in IMG/M
3300029907|Ga0311329_10061186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium3244Open in IMG/M
3300029910|Ga0311369_10014521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9642Open in IMG/M
3300029910|Ga0311369_11461599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8514Open in IMG/M
3300029917|Ga0311326_10586977Not Available537Open in IMG/M
3300029939|Ga0311328_10018504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae6700Open in IMG/M
3300029943|Ga0311340_11198425All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300029944|Ga0311352_11183142Not Available581Open in IMG/M
3300029951|Ga0311371_12605669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8510Open in IMG/M
3300029999|Ga0311339_10455551Not Available1315Open in IMG/M
3300029999|Ga0311339_11106595Not Available733Open in IMG/M
3300030007|Ga0311338_10490323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1291Open in IMG/M
3300030007|Ga0311338_10554342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1192Open in IMG/M
3300030007|Ga0311338_11583953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii600Open in IMG/M
3300030053|Ga0302177_10395474Not Available724Open in IMG/M
3300030054|Ga0302182_10139325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas lacus1053Open in IMG/M
3300030399|Ga0311353_10697878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum876Open in IMG/M
3300030524|Ga0311357_11679504Not Available532Open in IMG/M
3300030598|Ga0210287_1174477All Organisms → cellular organisms → Bacteria → Terrabacteria group578Open in IMG/M
3300030706|Ga0310039_10165396Not Available887Open in IMG/M
3300030743|Ga0265461_11789108Not Available687Open in IMG/M
3300030760|Ga0265762_1148037Not Available557Open in IMG/M
3300030815|Ga0265746_1023692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae760Open in IMG/M
3300031028|Ga0302180_10477170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8614Open in IMG/M
3300031234|Ga0302325_11601153All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300031236|Ga0302324_100949800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1175Open in IMG/M
3300031238|Ga0265332_10176351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium891Open in IMG/M
3300031261|Ga0302140_10347072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium1227Open in IMG/M
3300031573|Ga0310915_10522050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300031708|Ga0310686_103543064Not Available573Open in IMG/M
3300031708|Ga0310686_119423436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia708Open in IMG/M
3300031771|Ga0318546_11124311Not Available552Open in IMG/M
3300031781|Ga0318547_11036837Not Available513Open in IMG/M
3300031823|Ga0307478_11152426Not Available646Open in IMG/M
3300031938|Ga0308175_100115887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2502Open in IMG/M
3300032180|Ga0307471_102426704Not Available663Open in IMG/M
3300032783|Ga0335079_10120533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2961Open in IMG/M
3300032805|Ga0335078_11932038Not Available635Open in IMG/M
3300032828|Ga0335080_10498957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1292Open in IMG/M
3300033475|Ga0310811_10565726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1159Open in IMG/M
3300034199|Ga0370514_098964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300034817|Ga0373948_0008936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1718Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.85%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa15.24%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.27%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.27%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.88%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil3.66%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.05%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.44%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.22%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.22%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.22%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.22%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.22%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.22%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.61%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.61%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.61%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025633Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027109Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_022761102199352025SoilVATPRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVGELAGS
Ga0062385_1109924413300004080Bog Forest SoilPAVVHHETDTYITTYAALDPLRSAGGTVALDGFFGWPLTTMAS*
Ga0062386_10021572413300004152Bog Forest SoilHHETDTFTTTYAAIDPLRSENATVALDGFFGWPLAATAS*
Ga0070676_1118697913300005328Miscanthus RhizosphereHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS*
Ga0070714_10153553413300005435Agricultural SoilPRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS*
Ga0070762_1123981023300005602SoilTPRPAVVHHETDTFATTYTAIDPLRPDHAAVTLDGFFGWPLTAVAS*
Ga0070763_1010049813300005610SoilETDTFITTYTAIDPLRSAGGPVTLDGFFGWPLAALAS*
Ga0070763_1010970013300005610SoilWPDGNQVATPRPAVVHHESDTFITTYTAIDPPRTADAAVALDGFFGWPLSAVAS*
Ga0068856_10060559113300005614Corn RhizospherePRPAVVHAETDTFLTTYTAIDPPRQAGGPVINGGRVTLDGFFGWPLTAVAS*
Ga0068851_1017534433300005834Corn RhizosphereTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS*
Ga0068870_1004916033300005840Miscanthus RhizosphereTPRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS*
Ga0066652_10074018713300006046SoilPRPAVVHHETDTFITTYTAIDPPHPAGKPAGAALTLDGFFGWPLSAVAS*
Ga0075029_10052548623300006052WatershedsVHQETGTFITTYTAIDPLRPAGNSARNPVTLDGFFGWLLAAVAS*
Ga0075017_10068019423300006059WatershedsMHQETGTFITTQTAIDPLRSAGNSARNSVTLDGFFG*
Ga0070712_10154927713300006175Corn, Switchgrass And Miscanthus RhizospherePAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS*
Ga0070765_10022116813300006176SoilPARPAVVHQGTDTYITTYTAIDPLRKAGGRATLDGFFGWPLTSVAS*
Ga0070765_10218759323300006176SoilPRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLASVAS*
Ga0075021_1092496733300006354WatershedsVHRETDTFITTYTAIDPPRSAGATLTLDGFFGWPLTAVAS*
Ga0068871_10195620013300006358Miscanthus RhizosphereTPRPAVVHRETDTFITTYTAIASLRSASKPAGSTLTLDGFFGWPLAAVAS*
Ga0074053_1001325123300006575SoilVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS*
Ga0074054_1208434033300006579SoilPRPAVVHHETDTFITTYTAIDPPHPAGKPAGATLTLDGFFGWPLSAVAS*
Ga0074057_1229500443300006605SoilVHHETDTFITTYTAIDPPRPASKPAGATLTLDGFFGWPLSAVAS*
Ga0079222_1118093323300006755Agricultural SoilVATPRPAVVHAETDTFLTTYTAIDPPRQAGGPVINGGRVTLDGFFGWPLTAVAS*
Ga0079221_1025209013300006804Agricultural SoilTDTFLTTYTAIDPPRHAGGAVTLDGFFGWPLTAVAS*
Ga0075425_10185763513300006854Populus RhizosphereHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS*
Ga0105247_1114907813300009101Switchgrass RhizosphereVHAETDTFLTTYTAIDPPRPAGGPVINGGRVTLDGFFGWPLTAVAS*
Ga0099792_1021375333300009143Vadose Zone SoilVVVHHETDTFITTYTAIDPPRSADATLTLDGFFGWPLATVAS*
Ga0116214_112623023300009520Peatlands SoilMDRPYATPRPTVVHQETGTFITTYTAIDPLRPASNSAGNSVTLDGFFGWLLAAVAS*
Ga0116220_10000887123300009525Peatlands SoilVHHETDTFTTTYAAIDPLRSENATAALDGFFGWPLAATAS*
Ga0116220_1015563913300009525Peatlands SoilHHESDTFITTYTAIDPLRSANATVALDGFFGWPLSAVAS*
Ga0116220_1030545213300009525Peatlands SoilRPAVVHHETDNFITTYTAIDPLRTDDGSVALDGFFGWPLASVAS*
Ga0116224_1025610813300009683Peatlands SoilTPRPTVVHQETGTFITTYTAIDPLRPASNSAGNSVTLDGFFGWLLAAVAS*
Ga0116216_1051354223300009698Peatlands SoilMDRPYRATPRPTVVHQETDTLITTYTAIDPLRPAGNSARNPVTLDCFFGWLLAAVAS*
Ga0134080_1056102913300010333Grasslands SoilGNQVATPRPAVVHHETDTFITTYTAIDPPHPAGKPAGAALTLDGFFGWPLAAVAS*
Ga0134126_1157183513300010396Terrestrial SoilRPAVVHAETDTFLTTYTAIDPPRQAGGAVTLDGFFGWPLTAVAS*
Ga0134126_1304243113300010396Terrestrial SoilETDTFLTTYTAIDPPRPAGGPVINGGRVTLDGFFGWPLTAVAR*
Ga0126361_1065503833300010876Boreal Forest SoilVYHESDTFTTAYTATDPLRPDHAAVTLDGFFGWPLTATAS*
Ga0126361_1071558933300010876Boreal Forest SoilVHHESDTLITTYAAIDPLRPAGNPARHAASAAVALDGFFGWPLAAQAS*
Ga0126361_1101802713300010876Boreal Forest SoilTDTYITTYTAIDPARSRGATVVLDGFFGWPLTANAS*
Ga0126350_1005373313300010880Boreal Forest SoilGATIGPERPAVVHQGTDTYITTYTAIDPLRSAGGRVTLDGFFGWPLRSVAS*
Ga0126350_1035272413300010880Boreal Forest SoilHHATDTYITTYTAIDPPRSRGATVALDGFFGWPLTANAS*
Ga0126350_1125325113300010880Boreal Forest SoilATPRPGVVHHESDTFITTYTAIDPLRTANAPVALDGFFGWPLSAAAS*
Ga0150983_1179890123300011120Forest SoilPDGNQVATPRPAVVHHETDTFTTTYTAIDPLRPDHAAVTLDGFFGWPLTATAS*
Ga0137365_1001978873300012201Vadose Zone SoilVHHETDTFITTYTAIDPPHSAGATLTLNGFFGWPLSAVAS*
Ga0137379_1140549713300012209Vadose Zone SoilPAVVHHETDTFITSYAAIDPPRSANARVTLDGFFGWLLDAVAS*
Ga0137366_1000564943300012354Vadose Zone SoilVHHETDTFITTYTAIDPPRSAGATLTLNGFFGWPLSAVAS*
Ga0137384_1066837613300012357Vadose Zone SoilRPAVVHRETDTCITTYTAIGAPHSAGATRTRNGFFGWPLSGVAS*
Ga0137413_1022302313300012924Vadose Zone SoilTFITTYTAIDPPRSADATLTLDGFFGWPLATVAS*
Ga0164307_1114160023300012987SoilHETDTFITTYTAIDPPRSAGAALTLDGFFGWPLSAVAS*
Ga0157372_1295152323300013307Corn RhizosphereAAPRPAVVHAETDTFLTTYTAIDPPRQAGGPVINGGRVTLDGFFGWPLTAVAS*
Ga0134079_1019798123300014166Grasslands SoilVHAETDTFLTTYTAIDPPRQTGGTVTLDGFFGWPLTAVAS*
Ga0182034_1019298313300016371SoilVHHESDTFTTTDTAIDPLRSANATAALDGFFGWPLTATAR
Ga0187809_1029085633300017937Freshwater SedimentETDTFTATYAAIDPLRSDNATVALDGFFGWPLAATAS
Ga0187879_1020587723300017946PeatlandVHQETGTFITTYTAIDPLRPAGNSARNSVTLDGFFGWLLAAVAS
Ga0187778_1032463213300017961Tropical PeatlandMVHHETDTFITTYTAIDPLRSDNATVALDGFFGWPLAATAS
Ga0187781_1002441313300017972Tropical PeatlandMVHHETDTFITTCTAIDPLRSDNATVALDGFFGWPLAATAS
Ga0187805_1058327913300018007Freshwater SedimentTDNFITTYTAIDPLRTDDGSVALDGFFGWPLASVAS
Ga0187885_1019200023300018025PeatlandWPDGSQVATPRPAVVHHETDTFRITYTAIDSLRQANATVALDGFYGWPLAATAS
Ga0187858_1014372523300018057PeatlandTPRPAVVHHETDTFRITYTAIDSLRQANATVALDGFYGWPLAATAS
Ga0187766_1034081113300018058Tropical PeatlandRPPVVHHETDTFTTTYAAIDPLRSDNATVTLDGFFGWPLAATAS
Ga0066669_1092362023300018482Grasslands SoilVHAETDTFLTTYTAIDPPRQTGGTATLDGFFGWPLTAAAS
Ga0187852_124292813300019082PeatlandHETDTFTTTYTATDPLRPDHTAVTLNGFFGWPLTATAS
Ga0193728_113443423300019890SoilVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS
Ga0210399_1002017853300020581SoilVHHESDTFITTYAAIDPPRAADATAALDGFFGWPLSAAAS
Ga0210395_1121951023300020582SoilDGNQVAIPRPAVVHHESDTFTTTYTAIDPLRSENTAVALDGFFGWPLTAVAS
Ga0210400_1075349713300021170SoilESDTFITTYTAIDPPRTANATVALDGFFGWPLSARAS
Ga0210405_1102645223300021171SoilAIPRPAVVHHESDTFTTTYTAIDPLRSGNTAVALDGFFGWPLTAVAS
Ga0210396_1095451923300021180SoilDTYITTYTATDPSRAAGATVALDGFFGWPLTATAS
Ga0210388_1037118713300021181SoilATIGAERPALVHRGTDTYITTYTATDPLRSAGGRVALDGFFGWPLTAVAS
Ga0210388_1164534623300021181SoilHEADTFITTYTAIDPLRSPHANVTLDGFFGWPLTTVAS
Ga0210393_1017016923300021401SoilSPVATPRPAVVHHQTDTYITTYTALDPLRSAGGTVALDGFFGWPLTTIAS
Ga0210393_1023061323300021401SoilATPRPAVVHHESDTFITTYTAIDPPHTPNATVALDGFFGWPLSAVAS
Ga0210393_1124041313300021401SoilAAPRPAVVHHETDTYITTYTALDPLLSSDGTVALDGFFGWPLTTVAS
Ga0210385_1112319523300021402SoilQATDTYITTYTATDPPRAAGATVALDGFFGWPLTATAS
Ga0210387_1021365813300021405SoilQTDTFITTYAAVDPLRSAGGRVTLDGFFGWPLTSVAS
Ga0210386_1049921413300021406SoilAAPRPEHPPTAVVHHESDTFITTYAAIDPPRAADATAALDGFFGWPLSAAAS
Ga0210386_1175186623300021406SoilHHETDTFVTTYAATDPPRSGGRRVMLDGFFGWPLMSVAR
Ga0210383_1082169923300021407SoilPALVHRGTDTYITTYTATDPLLSAGGRVALDGFFGWPLTAVAS
Ga0210390_1041853323300021474SoilVVHHESDTFITTYTAIDPPRTADATVALDGFFGWPLSAVAS
Ga0210398_1043495723300021477SoilWPDGNQVATPKPAVVHHESDTFITTYTAIDPPRTANATVALDGFFGWPLSARAS
Ga0210398_1101928623300021477SoilDIFTTTYTAIDPPRSDNTAVTLDGFFGWPLTAVAS
Ga0210398_1116530313300021477SoilALVHHATDTYITTYTATDPPRAAGATVALDGFFGWPLTATAS
Ga0210409_1085241113300021559SoilHESDTFTTTYTAIDPLRSENTAVALDGFFGWPLTAVAS
Ga0224572_103774913300024225RhizosphereHETDTYITTYTALDPLRSAGGTVALDGFFGWPLTTMAS
Ga0224564_109036223300024271SoilSNRPTLVHHATDTYITTYTATDPPRAAGATVALDGFFGWPLTATAS
Ga0179589_1029593833300024288Vadose Zone SoilVATPRPVVVHHETDTFITTYTAIDPPRSADATLTLDGFFGWPLATVAS
Ga0208690_102691633300025434PeatlandATPRPAVVHHEADTFITTYTAIDPLQSAHASVTLDGFFGWPLTAVAS
Ga0208480_107922923300025633Arctic Peat SoilPGPAVVHRETDTFITTYTAIDPLRSDNGTVALDGFFGWPLTAVAS
Ga0207700_1174258913300025928Corn, Switchgrass And Miscanthus RhizospherePRPAVVHAETDTFLTTYTAIDPPRRAGGAVTLDGFFGWPLTAVAS
Ga0207644_1103968813300025931Switchgrass RhizosphereDTFLTTYTAIDPPRQAGGAVTLDGFFGWPLTAVAS
Ga0207703_1202938213300026035Switchgrass RhizosphereDTFITTYTAIDPPRSADAALTLDGFFGWPLATVAS
Ga0208099_102182713300027096Forest SoilQVATPRPAVVHHEADTFITTYTAIDPLRSPHANVTLDGFFGWPLTAVAS
Ga0208603_102106523300027109Forest SoilVHHESDTFITTYAAIDPPRAADATAALDGFFGWPLSAVAS
Ga0208488_103931623300027110Forest SoilPDSSPVATPRPAVVHHETDTYITTYTALDPIRSTGGTVALDGFFGWPLITAAS
Ga0208199_110207923300027497Peatlands SoilVHQETGTFITTYTAIDPLRPASNSAGNSVTLDGFFGWLLAAVAS
Ga0209115_105518913300027567Forest SoilVHHETDTYITTYTALDPLRSAGGTVALDGFFGWPLTAVAS
Ga0209525_107393833300027575Forest SoilPAVVHREADTFITTYTAIDPLQSAHANVTLDGFFGWPLTAVAS
Ga0209116_100231753300027590Forest SoilHEADTFITTYTAIDPLRSDGGTVALDGFFGWPLTATAS
Ga0209448_1005966023300027783Bog Forest SoilMHQETGTFITTQTAIDPLRSAGNSARNSVTPDGFFG
Ga0209656_10000824143300027812Bog Forest SoilMHQETGTFITTQTAIDPLRSAGNSARNSVTLDGFFG
Ga0209274_1062625913300027853SoilPIATPRPAVVHHETDTYITTYTALDPLRSAGGMVALDGFFGWPLTAVAS
Ga0209169_1020781423300027879SoilIPRPAVVHHESDTFTTTYTAIDPLRSGNTAVALDGFFGWPLTAVAS
Ga0209275_1006301713300027884SoilDGNPVAKPRPPVVHHETETFITTYAAIDPLHSAGRTVTLDGFFGWPLTAHAS
Ga0209380_1059259023300027889SoilGNSVASPRPAVVHHETDTFVTTYAATDPPRSGGHRVMLDGFFGWPLMSVAR
Ga0209698_1124979913300027911WatershedsTPRPALIHHQTDTYITTYTAIDPLRSAGGTATLDGFFGWPLTAIAS
Ga0247684_101962913300028138SoilVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS
Ga0302267_1041451313300028745BogPRPAVVHHETDTFSITYTAIDSLRQANATVALDGFYGWPLAATAS
Ga0307316_1021878123300028755SoilRVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS
Ga0307280_1000608313300028768SoilPRVPPGPRRPRVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS
Ga0307280_1000653313300028768SoilVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLA
Ga0302231_1014678913300028775PalsaVHREADTFITTYTAIDPLQPAHANVTLDGFFGWPLTAVAS
Ga0302226_1004175333300028801PalsaQVATPRPAVVHHEADAFITTYTAIDPLRSAHANVTLDGFFGWPLTAVAS
Ga0302221_1003726213300028806PalsaTPRPTVVHHETDTFSITCAAIDSLRQANATVALDGFLGWPLAATAS
Ga0302228_1011865613300028808PalsaVVHHEADTFITTYTAIDPLRSAHANVTLDGFFGWPLTAVAS
Ga0302228_1027976313300028808PalsaWPDSSPVATPRPIVVHHETDTFITTYTAIDPLRSAGGTVALDGFFGWPLTTVVS
Ga0302229_1013909823300028879PalsaGSQVATPRPAVVHHETDTFSITYTAIDSLRQANATVALDGFFGWPLAATVS
Ga0307308_1034836313300028884SoilPARPVRNRVPAWPRRPRVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLAAVAS
Ga0308309_1032006013300028906SoilDTFITTYTAIDPPRTADATVALDGFFGWPLSAVAS
Ga0308309_1046026913300028906SoilGSMGPARPAVVHQGTDTYITTYTAIDPLRKAGGRATLDGFFGWPLTSVAS
Ga0308309_1090240523300028906SoilESDTFTTTYTAIDPLRSGNTAVALDGFFGWPLTAVAS
Ga0308309_1096733923300028906SoilRETDTFATTYTAIDPLRPDHAAVTLDGFFGWPLTAVAS
Ga0311368_1031307913300029882PalsaVHHETDTFITTYTAIDPLRSAGGTVALDGFFGWPLTTVVS
Ga0311329_1006118613300029907BogTDTFSITCAAIDSLRQANATVALDGFLGWPLAATAS
Ga0311369_1001452113300029910PalsaRPTVVHHETDTFSITCAAIDSLRQANATVALDGFLGWPLAATAS
Ga0311369_1146159913300029910PalsaVHHEADTFITTYTAIDPLQPAHANVTLDGFFGWPLTAVAS
Ga0311326_1058697713300029917BogATPRPAVVHHETDTFSITYTAIDSLRQANATVALDGFYGWPLAATAS
Ga0311328_1001850463300029939BogVVHHETDTFSITCAAIDSLRQANATVALDGFLGWPLAATAS
Ga0311340_1034958113300029943PalsaAVVHHETDTFVTTYTALDPLRSAGGTVALDGFFGWPLTSVAS
Ga0311340_1119842513300029943PalsaATPRLTVVHNETDTFITTYTAIDPLRAAGGTVVLDGFFGWPLTTVVS
Ga0311352_1118314223300029944PalsaDTFVTTYTALDPLRSAGGTVALDGFFGWPLTSVAS
Ga0311371_1260566923300029951PalsaSWPDGNQVATPRPAVVHHEADTFITTYTAIDPLQSAHASVTLDGFFGWPLTAVAS
Ga0311339_1045555113300029999PalsaDSSPVATPRPIVVHHETDTFITTYTAIDPLRSAGGTVALDGFFGWPLTTVVS
Ga0311339_1110659523300029999PalsaTDTFTTTYTAIDPLRPDHAAVTLDGFFGWPLTTTVS
Ga0311338_1049032333300030007PalsaSWPDGNQVATPRPAVVHHEADTFITTYTAIDPLRSPHANVTLDGFFGWPLTAVAS
Ga0311338_1055434223300030007PalsaDWPDGSQVATPRPAVVHHETDTFSITYTAIDSLRQANATVALDGFFGWPLAATVS
Ga0311338_1158395323300030007PalsaVHHETDTFTTTYTAIDPPRPDHAAVTLDGFFGWPLTATAS
Ga0302177_1039547413300030053PalsaTPRPAVVHHESDTFITTYTAIDPLRSANGTVALDGFFGWPLTSIAS
Ga0302182_1013932523300030054PalsaHHQADTFITTYTAIDPLRSDGGTVALDGFFGWPLTATAS
Ga0311353_1069787823300030399PalsaVATPRPIVVHHETDTFITTYTAIDPLRSAGGTVALDGFFGWPLTTVVS
Ga0311357_1167950413300030524PalsaVVHREADTFITTYTAIDPLQSAHARVTLDGFFGWPLTAVAS
Ga0210287_117447713300030598SoilDGASIAATRPAVVHHATDTYITTYTAIDPLRSHGATVALDGFFGWQLTGTAS
Ga0310039_1016539613300030706Peatlands SoilPPVVHHETDTFTTTYAAIDPLRSENATAALDGFFGWPLAATAS
Ga0265461_1178910823300030743SoilFFSIYYSETFITTYAAIDPLRSAGRTVTLDGFFGWPLTAHAS
Ga0265762_114803713300030760SoilVHHATDTYITTYTATDPPRAAGATVALDGFFGWPLTATAS
Ga0265746_102369213300030815SoilPRPAVVHHESDTFTTTYTAIDPLRSESTAVALDGFFGWPLTAVAS
Ga0302180_1047717023300031028PalsaDTFITTYTAIDPLQSAHASVTLDGFFGWPLTAVAS
Ga0302325_1160115313300031234PalsaDTYLTTYAATDPPLSAGGAVELDGFFGWPLAATAS
Ga0302324_10094980013300031236PalsaQVATPRPAVVHHETDTFSITYTAIDSLRQANATVALDGFFGWPLAATVS
Ga0265332_1017635123300031238RhizosphereDGNQVAIPRPAVVHHESDTFTTTYTAIDPLRSGNAAVALDGFFGWPLTAVAS
Ga0302140_1034707213300031261BogHHETDTFSITCAAIDSLRQANATVALDGFLGWPLAATAS
Ga0310915_1052205023300031573SoilVHHESDTFTTTDTAIDPLRSGNATAALDGFFGWPLTATAR
Ga0310686_10354306423300031708SoilVVHHETDTFITTYTAIDPLLSAGGPVTLDGFFGWPLTATAS
Ga0310686_11942343613300031708SoilAVVHHETDTFITTYTAIDPARSASAAVALDGFFGWPLSAVAS
Ga0318546_1112431113300031771SoilVVHHETDTFTTTYTAIDPLSSGNATVALDGFFGWPLTATAS
Ga0318547_1103683713300031781SoilNWPDGNQVATPRPAVVHHETDTFTTTYTAIDPLSSGNATVALDGFFGWPLTATAS
Ga0307478_1115242613300031823Hardwood Forest SoilSDTFITTYTAIDPPRTADAAVALDGFFGWPLSAVAS
Ga0308175_10011588753300031938SoilVATPRPVVVHAETDTFLTTYTAIDPPRQAGGAVTLDGFFGWPLTAVAR
Ga0307471_10242670413300032180Hardwood Forest SoilRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS
Ga0335079_1012053313300032783SoilVHHETDTFITTYTAIDPPRPAGKPAGATLTLDGFFGWPLSAVAS
Ga0335078_1193203813300032805SoilGNSVASPRPAVVHQQSDTFITTYAATDPLRTAGGQVALDGFFGWPLSSVAS
Ga0335080_1049895733300032828SoilVATPRPAVVHHETDTFITTYTAIDPPRPAGKPAGATLTLDGFFGWPLSAVAS
Ga0310811_1056572633300033475SoilRTSRPAVVHHETDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS
Ga0370514_098964_3_1493300034199Untreated Peat SoilVATPRPAVVHHETDTFLTTYTAIDPPHSASAAVALDGFFGWPLTTVAS
Ga0373948_0008936_1_1113300034817Rhizosphere SoilTDTFITTYTAIDPPRSAGATLTLDGFFGWPLSAVAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.