Metagenome / Metatranscriptome Family F039216

Basic Information
Family ID	F039216
Family Type	Metagenome / Metatranscriptome
Number of Sequences	164
Average Sequence Length	40 residues
Representative Sequence	VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA
Number of Associated Samples	150
Number of Associated Scaffolds	164

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	2.44 %
% of genes near scaffold ends (potentially truncated)	26.22 %
% of genes from short scaffolds (< 2000 bps)	92.07 %
Associated GOLD sequencing projects	143
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.27

Most Common Taxonomy
Group	Bacteria (62.805 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.146 % of family members)
Environment Ontology (ENVO)	Unclassified (34.146 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (43.902 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 22.73% Coil/Unstructured: 77.27%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 164 Family Scaffolds
PF13463	HTH_27	26.83
PF00490	ALAD	9.15
PF12802	MarR_2	3.05
PF06271	RDD	1.22
PF03401	TctC	0.61
PF03600	CitMHS	0.61
PF07007	LprI	0.61
PF00528	BPD_transp_1	0.61

COG ID	Name	Functional Category	% Frequency in 164 Family Scaffolds
COG0113	Delta-aminolevulinic acid dehydratase, porphobilinogen synthase	Coenzyme transport and metabolism [H]	9.15
COG1714	Uncharacterized membrane protein YckC, RDD family	Function unknown [S]	1.22
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.61
COG3755	Uncharacterized conserved protein YecT, DUF1311 family	Function unknown [S]	0.61

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.80 %
Unclassified	root	N/A	37.20 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.80 %
Unclassified	root	N/A	37.20 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	62.80 %
Unclassified	root	N/A	37.20 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	62.20 %
Unclassified	root	N/A	37.20 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	46.34 %
Unclassified	root	N/A	37.20 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	46.34 %
Unclassified	root	N/A	37.20 %

Name	Rank	Taxonomy	Distribution
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	45.12 %
Unclassified	root	N/A	37.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.20 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	29.88 %
Rhodopseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas	14.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.20 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	14.63 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1.22 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1.83 %
Bradyrhizobium icense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	1.83 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	1.83 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.20 %
Rhodopseudomonas palustris BisA53	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	14.63 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1.22 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	1.83 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1.83 %
Bradyrhizobium icense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	1.83 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.61 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_100590944	All Organisms → cellular organisms → Bacteria → Proteobacteria	541	Open in IMG/M
3300000531\|CNBas_1003195	Not Available	913	Open in IMG/M
3300001205\|C688J13580_1036962	Not Available	634	Open in IMG/M
3300001305\|C688J14111_10034225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1519	Open in IMG/M
3300001661\|JGI12053J15887_10197747	Not Available	1024	Open in IMG/M
3300002092\|JGI24218J26658_1000007	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	534170	Open in IMG/M
3300005175\|Ga0066673_10230826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1066	Open in IMG/M
3300005331\|Ga0070670_100133377	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2146	Open in IMG/M
3300005468\|Ga0070707_102083228	All Organisms → cellular organisms → Bacteria → Proteobacteria	535	Open in IMG/M
3300005535\|Ga0070684_102358727	Not Available	501	Open in IMG/M
3300005540\|Ga0066697_10486914	Not Available	703	Open in IMG/M
3300005543\|Ga0070672_100900429	Not Available	781	Open in IMG/M
3300005548\|Ga0070665_100024314	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	6100	Open in IMG/M
3300005548\|Ga0070665_100892954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	901	Open in IMG/M
3300005552\|Ga0066701_10025144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3023	Open in IMG/M
3300005563\|Ga0068855_101824249	Not Available	617	Open in IMG/M
3300005564\|Ga0070664_101598132	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	617	Open in IMG/M
3300005577\|Ga0068857_100168397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1991	Open in IMG/M
3300005577\|Ga0068857_100343351	Not Available	1381	Open in IMG/M
3300005578\|Ga0068854_101056718	All Organisms → cellular organisms → Bacteria → Proteobacteria	721	Open in IMG/M
3300005617\|Ga0068859_101045579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	897	Open in IMG/M
3300005617\|Ga0068859_102020279	Not Available	636	Open in IMG/M
3300005844\|Ga0068862_100329979	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1410	Open in IMG/M
3300005937\|Ga0081455_10002109	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	23709	Open in IMG/M
3300005983\|Ga0081540_1018147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	4327	Open in IMG/M
3300006031\|Ga0066651_10406347	Not Available	726	Open in IMG/M
3300006041\|Ga0075023_100488648	All Organisms → cellular organisms → Bacteria → Proteobacteria	552	Open in IMG/M
3300006048\|Ga0075363_100404592	Not Available	802	Open in IMG/M
3300006048\|Ga0075363_100695927	All Organisms → cellular organisms → Bacteria → Proteobacteria	613	Open in IMG/M
3300006051\|Ga0075364_11053594	All Organisms → cellular organisms → Bacteria → Proteobacteria	552	Open in IMG/M
3300006178\|Ga0075367_10214705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	1203	Open in IMG/M
3300006358\|Ga0068871_100373295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1265	Open in IMG/M
3300006358\|Ga0068871_101575506	Not Available	622	Open in IMG/M
3300006604\|Ga0074060_11878419	Not Available	632	Open in IMG/M
3300006791\|Ga0066653_10318452	Not Available	784	Open in IMG/M
3300006800\|Ga0066660_10132504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1820	Open in IMG/M
3300006804\|Ga0079221_10466044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	808	Open in IMG/M
3300006844\|Ga0075428_100891853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	943	Open in IMG/M
3300006844\|Ga0075428_102414283	All Organisms → cellular organisms → Bacteria → Proteobacteria	540	Open in IMG/M
3300006853\|Ga0075420_100484282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1068	Open in IMG/M
3300007788\|Ga0099795_10345477	All Organisms → cellular organisms → Bacteria → Proteobacteria	664	Open in IMG/M
3300009012\|Ga0066710_104455283	All Organisms → cellular organisms → Bacteria → Proteobacteria	523	Open in IMG/M
3300009036\|Ga0105244_10235664	Not Available	856	Open in IMG/M
3300009092\|Ga0105250_10060559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1521	Open in IMG/M
3300009094\|Ga0111539_12284176	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	628	Open in IMG/M
3300009100\|Ga0075418_12177853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	604	Open in IMG/M
3300009146\|Ga0105091_10344872	Not Available	734	Open in IMG/M
3300009148\|Ga0105243_11712151	All Organisms → cellular organisms → Bacteria → Proteobacteria	658	Open in IMG/M
3300009157\|Ga0105092_10728659	Not Available	578	Open in IMG/M
3300009177\|Ga0105248_10383749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1582	Open in IMG/M
3300009610\|Ga0105340_1191974	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	857	Open in IMG/M
3300009795\|Ga0105059_1010432	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	898	Open in IMG/M
3300009802\|Ga0105073_1019218	Not Available	709	Open in IMG/M
3300009802\|Ga0105073_1049302	All Organisms → cellular organisms → Bacteria → Proteobacteria	554	Open in IMG/M
3300009803\|Ga0105065_1037794	Not Available	644	Open in IMG/M
3300009805\|Ga0105079_1020916	Not Available	625	Open in IMG/M
3300009840\|Ga0126313_10530442	Not Available	945	Open in IMG/M
3300010036\|Ga0126305_10121462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1596	Open in IMG/M
3300010037\|Ga0126304_10077380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2070	Open in IMG/M
3300010038\|Ga0126315_10634144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	693	Open in IMG/M
3300010040\|Ga0126308_10106672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1724	Open in IMG/M
3300010041\|Ga0126312_10171291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1512	Open in IMG/M
3300010041\|Ga0126312_11015984	All Organisms → cellular organisms → Bacteria → Proteobacteria	607	Open in IMG/M
3300010042\|Ga0126314_10103390	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1938	Open in IMG/M
3300010047\|Ga0126382_12257864	Not Available	525	Open in IMG/M
3300010362\|Ga0126377_12111177	All Organisms → cellular organisms → Bacteria → Proteobacteria	640	Open in IMG/M
3300010373\|Ga0134128_11072014	Not Available	890	Open in IMG/M
3300010401\|Ga0134121_11905001	All Organisms → cellular organisms → Bacteria → Proteobacteria	624	Open in IMG/M
3300010999\|Ga0138505_100052525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	590	Open in IMG/M
3300011119\|Ga0105246_10440971	All Organisms → cellular organisms → Bacteria → Proteobacteria	1092	Open in IMG/M
3300011398\|Ga0137348_1051925	Not Available	697	Open in IMG/M
3300011406\|Ga0137454_1085649	Not Available	543	Open in IMG/M
3300011430\|Ga0137423_1202900	All Organisms → cellular organisms → Bacteria → Proteobacteria	593	Open in IMG/M
3300012198\|Ga0137364_10749953	Not Available	737	Open in IMG/M
3300012201\|Ga0137365_10324251	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1140	Open in IMG/M
3300012203\|Ga0137399_11268434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	620	Open in IMG/M
3300012204\|Ga0137374_10133146	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2259	Open in IMG/M
3300012207\|Ga0137381_10364344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1260	Open in IMG/M
3300012212\|Ga0150985_118019821	Not Available	650	Open in IMG/M
3300012358\|Ga0137368_10338371	Not Available	1005	Open in IMG/M
3300012918\|Ga0137396_10108924	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1986	Open in IMG/M
3300012922\|Ga0137394_10759631	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	814	Open in IMG/M
3300012941\|Ga0162652_100021425	Not Available	907	Open in IMG/M
3300012943\|Ga0164241_10730222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	719	Open in IMG/M
3300012951\|Ga0164300_10085654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1348	Open in IMG/M
3300012955\|Ga0164298_10203668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1159	Open in IMG/M
3300012961\|Ga0164302_10167425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1314	Open in IMG/M
3300014745\|Ga0157377_10489036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	858	Open in IMG/M
3300014968\|Ga0157379_10894966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	842	Open in IMG/M
3300015371\|Ga0132258_12870776	Not Available	1198	Open in IMG/M
3300017792\|Ga0163161_11347186	All Organisms → cellular organisms → Bacteria → Proteobacteria	622	Open in IMG/M
3300018000\|Ga0184604_10042370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1220	Open in IMG/M
3300018027\|Ga0184605_10417348	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	597	Open in IMG/M
3300018028\|Ga0184608_10331627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	668	Open in IMG/M
3300018052\|Ga0184638_1190018	Not Available	726	Open in IMG/M
3300018054\|Ga0184621_10151504	Not Available	835	Open in IMG/M
3300018061\|Ga0184619_10443645	Not Available	580	Open in IMG/M
3300018066\|Ga0184617_1058374	Not Available	999	Open in IMG/M
3300018066\|Ga0184617_1206322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	586	Open in IMG/M
3300018068\|Ga0184636_1298526	Not Available	567	Open in IMG/M
3300018072\|Ga0184635_10032586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1964	Open in IMG/M
3300018073\|Ga0184624_10156980	Not Available	1002	Open in IMG/M
3300018076\|Ga0184609_10103614	All Organisms → cellular organisms → Bacteria → Proteobacteria	1280	Open in IMG/M
3300018082\|Ga0184639_10122443	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1378	Open in IMG/M
3300018082\|Ga0184639_10172431	Not Available	1149	Open in IMG/M
3300018429\|Ga0190272_10867958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	842	Open in IMG/M
3300018433\|Ga0066667_11178386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	665	Open in IMG/M
3300018433\|Ga0066667_11439943	Not Available	606	Open in IMG/M
3300018465\|Ga0190269_10134117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1259	Open in IMG/M
3300018466\|Ga0190268_12303707	Not Available	508	Open in IMG/M
3300018468\|Ga0066662_11118779	Not Available	789	Open in IMG/M
3300018476\|Ga0190274_10075495	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2567	Open in IMG/M
3300018920\|Ga0190273_10231024	Not Available	1184	Open in IMG/M
3300019789\|Ga0137408_1378886	Not Available	1016	Open in IMG/M
3300019875\|Ga0193701_1095058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	560	Open in IMG/M
3300020016\|Ga0193696_1092216	Not Available	781	Open in IMG/M
3300021082\|Ga0210380_10049310	All Organisms → cellular organisms → Bacteria → Proteobacteria	1817	Open in IMG/M
3300022534\|Ga0224452_1177640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	655	Open in IMG/M
3300022694\|Ga0222623_10010499	All Organisms → cellular organisms → Bacteria	3362	Open in IMG/M
3300022756\|Ga0222622_10824302	All Organisms → cellular organisms → Bacteria → Proteobacteria	678	Open in IMG/M
3300022886\|Ga0247746_1068812	Not Available	835	Open in IMG/M
3300025711\|Ga0207696_1059129	Not Available	1081	Open in IMG/M
3300025728\|Ga0207655_1241703	Not Available	516	Open in IMG/M
3300025899\|Ga0207642_10421758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	803	Open in IMG/M
3300025900\|Ga0207710_10160207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	1096	Open in IMG/M
3300025901\|Ga0207688_10870106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	571	Open in IMG/M
3300025904\|Ga0207647_10607799	Not Available	603	Open in IMG/M
3300025918\|Ga0207662_10277238	Not Available	1108	Open in IMG/M
3300025920\|Ga0207649_10043693	All Organisms → cellular organisms → Bacteria → Proteobacteria	2741	Open in IMG/M
3300025922\|Ga0207646_10435136	All Organisms → cellular organisms → Bacteria → Proteobacteria	1184	Open in IMG/M
3300025925\|Ga0207650_11206716	Not Available	644	Open in IMG/M
3300025942\|Ga0207689_10184573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1720	Open in IMG/M
3300025949\|Ga0207667_11960561	Not Available	546	Open in IMG/M
3300025972\|Ga0207668_11915287	Not Available	534	Open in IMG/M
3300026023\|Ga0207677_12216087	Not Available	511	Open in IMG/M
3300026035\|Ga0207703_12110080	Not Available	540	Open in IMG/M
3300026067\|Ga0207678_11389644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	621	Open in IMG/M
3300026315\|Ga0209686_1211352	All Organisms → cellular organisms → Bacteria → Proteobacteria	526	Open in IMG/M
3300026317\|Ga0209154_1123534	Not Available	1093	Open in IMG/M
3300026322\|Ga0209687_1231505	Not Available	570	Open in IMG/M
3300026529\|Ga0209806_1101995	Not Available	1221	Open in IMG/M
3300026537\|Ga0209157_1127655	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1169	Open in IMG/M
3300027775\|Ga0209177_10469439	Not Available	519	Open in IMG/M
3300028379\|Ga0268266_10059288	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3297	Open in IMG/M
3300028379\|Ga0268266_10613379	Not Available	1045	Open in IMG/M
3300028380\|Ga0268265_10498867	All Organisms → cellular organisms → Bacteria → Proteobacteria	1146	Open in IMG/M
3300028704\|Ga0307321_1139401	Not Available	511	Open in IMG/M
3300028778\|Ga0307288_10058144	All Organisms → cellular organisms → Bacteria → Proteobacteria	1345	Open in IMG/M
3300028880\|Ga0307300_10206284	Not Available	638	Open in IMG/M
3300030114\|Ga0311333_10255811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	1380	Open in IMG/M
3300030521\|Ga0307511_10363153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	615	Open in IMG/M
3300031226\|Ga0307497_10427439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	639	Open in IMG/M
3300031232\|Ga0302323_101076852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	895	Open in IMG/M
3300031507\|Ga0307509_10302920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1345	Open in IMG/M
3300031521\|Ga0311364_11020970	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	825	Open in IMG/M
3300031938\|Ga0308175_100027952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4617	Open in IMG/M
3300031938\|Ga0308175_101866310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	673	Open in IMG/M
3300031938\|Ga0308175_102062241	All Organisms → cellular organisms → Bacteria → Proteobacteria	639	Open in IMG/M
3300032012\|Ga0310902_11134488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53	548	Open in IMG/M
3300032074\|Ga0308173_10535539	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1053	Open in IMG/M
3300033179\|Ga0307507_10563622	Not Available	597	Open in IMG/M
3300033551\|Ga0247830_11568605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	527	Open in IMG/M
3300034156\|Ga0370502_0082561	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1018	Open in IMG/M
3300034176\|Ga0364931_0067377	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1104	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	65.85%
Host-Associated	Host-Associated	34.15%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	50.00%
Plants	Host-Associated → Plants	34.15%
Aquatic	Environmental → Aquatic	15.85%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	46.34%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.85%
Sediment	Environmental → Aquatic → Sediment	13.41%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.80%
Roots	Host-Associated → Plants → Roots	5.49%
Freshwater	Environmental → Aquatic → Freshwater	2.44%
Peat	Environmental → Terrestrial → Peat	1.83%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	1.22%
Floodplain	Environmental → Terrestrial → Floodplain	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.20%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	13.41%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.15%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.71%
Loam	Environmental → Terrestrial → Soil → Loam	5.49%
Sand	Environmental → Terrestrial → Soil → Sand	3.05%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	2.44%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.83%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.83%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.83%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	1.22%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.22%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.61%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.61%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	13.41%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.15%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.71%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.66%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	3.05%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	2.44%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.44%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	2.44%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.83%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.83%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.83%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.83%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	1.22%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.22%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.61%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.61%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.61%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.15%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	8.54%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.10%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.10%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.27%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	4.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.66%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.66%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	3.05%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.05%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.05%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.44%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.44%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	2.44%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	2.44%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.44%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.44%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.83%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.83%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	1.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.83%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.22%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.22%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.22%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.22%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.22%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	1.22%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.22%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.22%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.61%
Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic	0.61%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.61%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.61%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.61%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.61%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.61%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.61%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.61%
Quercus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere	0.61%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.61%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.61%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000531	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled	Host-Associated	Open in IMG/M
3300001205	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300002092	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006048	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Host-Associated	Open in IMG/M
3300006051	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Host-Associated	Open in IMG/M
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006604	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009795	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50	Environmental	Open in IMG/M
3300009802	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60	Environmental	Open in IMG/M
3300009803	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50	Environmental	Open in IMG/M
3300009805	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010999	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011398	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2	Environmental	Open in IMG/M
3300011406	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2	Environmental	Open in IMG/M
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012941	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015	Environmental	Open in IMG/M
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018068	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300019875	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2	Environmental	Open in IMG/M
3300020016	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300022694	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300022886	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5	Environmental	Open in IMG/M
3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026315	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)	Environmental	Open in IMG/M
3300026317	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)	Environmental	Open in IMG/M
3300026322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)	Environmental	Open in IMG/M
3300026529	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)	Environmental	Open in IMG/M
3300026537	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028704	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379	Environmental	Open in IMG/M
3300028778	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142	Environmental	Open in IMG/M
3300028880	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181	Environmental	Open in IMG/M
3300030114	I_Fen_E2 coassembly	Environmental	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031521	III_Fen_E2 coassembly	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300032012	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034156	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18	Environmental	Open in IMG/M
3300034176	Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.27
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.27
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F039216

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1005909442	3300000364	Soil	MDQGFSQHFIDAGSALFTLRLRTLSHSETGPPEFETLA*
CNBas_10031951	3300000531	Quercus Rhizosphere	VDQGFLQYFIDGERALFTLRLQALSHSETGASEIETLA*
C688J13580_10369621	3300001205	Soil	MDQGFLQYFIDGERALFTLRLQALSHSKTGASEIATLA*
C688J14111_100342253	3300001305	Soil	VDQGFLQYFIDGERPMFTLRLQALSHSETGPPEIETLA*
JGI12053J15887_101977471	3300001661	Forest Soil	MDQGFLQYFIDGESLMFTLRLHPLSHSETGASEIETLA*
JGI24218J26658_1000007507	3300002092	Lentic	VDQGFLQYFIDGERAMFTLRLQALSHSETGAAEIETLA*
Ga0066673_102308262	3300005175	Soil	VNCRLSPADQGFLQYFIDGESTLFTLRLQALSHSETGAAEIETLA*
Ga0070670_1001333773	3300005331	Switchgrass Rhizosphere	ESLIKPMDKGFLQHFIDREKPLFTLRLRILSHSETASPEIETVP*
Ga0070707_1020832281	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	RLSPMDQGLLQYFIDGESALFTLRLQALSHSETGAPEIETLA*
Ga0070684_1023587272	3300005535	Corn Rhizosphere	VDQGFLQYFIDGERAMFTLRLHPLSHSETGPPEIETLAKVCGGT
Ga0066697_104869141	3300005540	Soil	VDQGFLQYFIDGESAMFTLRLHALSHSETGASEIETLA*
Ga0070672_1009004291	3300005543	Miscanthus Rhizosphere	MNQGFLQYFIDGEGAMFTLRLRALSHSETGASEIETPA*
Ga0070665_1000243144	3300005548	Switchgrass Rhizosphere	MDQGFLQYSVDGERLMFTLRLVPLSHSKTGPPEIETLA*
Ga0070665_1008929542	3300005548	Switchgrass Rhizosphere	VDQGFLQYFIDGECAMFTLRLQALSHSETGASEIETLA*
Ga0066701_100251443	3300005552	Soil	VDQGFLQYFIDGESALFTLRLHVLSHSETGASEIETLA*
Ga0068855_1018242492	3300005563	Corn Rhizosphere	VDQGFLQYFIDGESALFTLRLQALSHSGTGASEIETLA*
Ga0070664_1015981322	3300005564	Corn Rhizosphere	VDQGFLQYFIDGERAMFTLRLHPLSHSETGPPEIETLA*
Ga0068857_1001683973	3300005577	Corn Rhizosphere	FLQYFIDGERAMFTLRLHPLSHSETGPPEIETLA*
Ga0068857_1003433513	3300005577	Corn Rhizosphere	VDQGFLQYFIDGERAMFTLRLRALSHSETGASEIETPA*
Ga0068854_1010567181	3300005578	Corn Rhizosphere	MDQGFLQYFIDGESALFTLRLQALSHSKTGASEIETLA*
Ga0068859_1010455791	3300005617	Switchgrass Rhizosphere	VNQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA*
Ga0068859_1020202792	3300005617	Switchgrass Rhizosphere	MDKGFSQRFIDGGSRVFTLRLPALSHSETGRPEIETLA*
Ga0068862_1003299791	3300005844	Switchgrass Rhizosphere	DHEFNRVNCRLSPMDQGFLQYFIDGESALFTLRLQALSHSGTGASEIETLA*
Ga0081455_100021098	3300005937	Tabebuia Heterophylla Rhizosphere	MDQGFLQHFIEAGSALFTLRLHPLSHSETGASEIETLA*
Ga0081540_10181475	3300005983	Tabebuia Heterophylla Rhizosphere	MDQGLSQHFIEVGRALFTLRLRLLSHSETGAAESETLA*
Ga0066651_104063471	3300006031	Soil	VDQGFLQYFIDGESALFTLRLQALSHSETGASEIETLA*
Ga0075023_1004886483	3300006041	Watersheds	KPVDQGLLQYFIDAGKAMFTLRLRPLSHSGTGPPEIETLA*
Ga0075363_1004045922	3300006048	Populus Endosphere	MDQGLLQYFIDGESALFTLRLQALSHSKTGAPEIETPA*
Ga0075363_1006959271	3300006048	Populus Endosphere	VDQGFLQLFIDGERTLFTLRLRTLSHSETGASEIETPA*
Ga0075364_110535941	3300006051	Populus Endosphere	VNQGLLQYFIDGERLMFTLRLGALSHSETGAPEIETLA*
Ga0075367_102147053	3300006178	Populus Endosphere	MDQGFLQCFIDGESALFTLRLQALSHSKTGAPEIETPA*
Ga0068871_1003732951	3300006358	Miscanthus Rhizosphere	MDKDFLQHFIDREKPLFTLRLRILSHSETASPEIETVP*
Ga0068871_1015755062	3300006358	Miscanthus Rhizosphere	MDKGVFATFIDGGGSLFTLRLGGLSHSETGASEIETLA*
Ga0074060_118784192	3300006604	Soil	MDKGVFATFIDGGEPLFTLRLGGLSHSETGASEIETLANGCGE
Ga0066653_103184521	3300006791	Soil	MDQGFLQYFIDGESALFTLRLQALSHSETGASEIETLA*
Ga0066660_101325042	3300006800	Soil	VDQGFLQYFIDAESAMFTLRLHALSHSETGASEIETLA*
Ga0079221_104660442	3300006804	Agricultural Soil	DSESSIKPMDKGLFARFIDGGSRVFTLRLPALSHSETGRPEIETLA*
Ga0075428_1008918532	3300006844	Populus Rhizosphere	MDQGLLQYFIDGESALFTLRLQALSHSKTGAPEIATLA*
Ga0075428_1024142832	3300006844	Populus Rhizosphere	MDQGFLQYFIDCESALFTLRLQALSHSGTGASEIETLA*
Ga0075420_1004842822	3300006853	Populus Rhizosphere	MDQGFLQYFIDGERALFTLRLRPLSHSETGASEIETLA*
Ga0099795_103454772	3300007788	Vadose Zone Soil	MDQGFLQYFIDGERALFTLRLQPLSHSETGASEIETLA*
Ga0066710_1044552831	3300009012	Grasslands Soil	GFLQYFIDGEGAMLTLRLHALSHSETGASEIETLA
Ga0105244_102356642	3300009036	Miscanthus Rhizosphere	MDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA*
Ga0105250_100605591	3300009092	Switchgrass Rhizosphere	FNRVNCRLSPVDQGFLQYFIDGESALFTLRLQALSHSKTGASEIETLA*
Ga0111539_122841761	3300009094	Populus Rhizosphere	MDQGLLQYFIDGESALFTLRLQALSHSKTGASEIETLA*
Ga0075418_121778531	3300009100	Populus Rhizosphere	MDQGFLQYFIDGESAMFTLRLHALSHSETGASEIETLA*
Ga0105091_103448722	3300009146	Freshwater Sediment	VDQGFLQYFIDGEGALFTLRLQALSHSETGASEIETLA*
Ga0105243_117121511	3300009148	Miscanthus Rhizosphere	MNQGFLQYFIDGEGVMFTLRLWALSHSETGASEIETPA*
Ga0105092_107286592	3300009157	Freshwater Sediment	MDQGFLQYFIDGEGALFTLRLQALSHSETGASEIETLA*
Ga0105248_103837493	3300009177	Switchgrass Rhizosphere	VNFRLSSVDQVFLQYFIDGERAMFTLRLRALSHSETGASEIETLA*
Ga0105340_11919742	3300009610	Soil	MDQGFLQYFIDGESVMFTLRLQALSHSETGASEIETLA*
Ga0105059_10104322	3300009795	Groundwater Sand	MDQGFLQYFIDGDSVMFTLRLQALSHSETGASEIETPA*
Ga0105073_10192182	3300009802	Groundwater Sand	MNQGFLQYFIDGERLMFTLRLRVLSHSETGASEIETP
Ga0105073_10493022	3300009802	Groundwater Sand	VDQGFLQYFIDGDSVMFTLRLQALSHSETGASEIETLA*
Ga0105065_10377941	3300009803	Groundwater Sand	MDQGFLQYFIDGEGAMFTLRLHPLSHSETGASEIATLA*
Ga0105079_10209162	3300009805	Groundwater Sand	MDQGFLQHFIDGESALFTLRLQALSHSETGASEIETLA*
Ga0126313_105304422	3300009840	Serpentine Soil	VNQGFLQYFIDGERVMFTLRLPPLSHSETGASEIETLA*
Ga0126305_101214622	3300010036	Serpentine Soil	MNQGFLQYFVDGERLMFTLRLRALSHSETGASEIETPA*
Ga0126304_100773803	3300010037	Serpentine Soil	VNQGFLQYFIDGDRVMFTLRLWALSHSETGASEIETLA*
Ga0126315_106341442	3300010038	Serpentine Soil	NQGFLQYFIDGERVMFTLRLRSLSHSETGASEIETLA*
Ga0126308_101066722	3300010040	Serpentine Soil	MNQGFLQYFIDGERLMFTLRLWALSHSETGASEIETPA*
Ga0126312_101712912	3300010041	Serpentine Soil	MNQGFLQYFIDGERLMFTLRLRALSHSETGASEIETLA*
Ga0126312_110159841	3300010041	Serpentine Soil	RDHEFNRVNCRLSPVDQGFLQYFIDGDSAMFTLRLQALSHSETGTSEIETPA*
Ga0126314_101033902	3300010042	Serpentine Soil	VNQGFLQYFIDGERVMFTLRLPPLSHSETGASEIETPA*
Ga0126382_122578642	3300010047	Tropical Forest Soil	LDQGLLQYFIDGERAMFTLRLQPLSHSKTGSPEIETL
Ga0126377_121111772	3300010362	Tropical Forest Soil	VDQGFLQYFIDGERAMFTLRLHGLSHSETGGPEIETLA*
Ga0134128_110720141	3300010373	Terrestrial Soil	MDQGFLQYFIDGESALFTLRLQALSHSGTGASEIETLA*
Ga0134121_119050012	3300010401	Terrestrial Soil	MDQGFLQLFIDGERALFTLRLRPLSHSKTGAFEIATLA*
Ga0138505_1000525251	3300010999	Soil	DQGFLQYFIDGESALFTLRLQALSHSETGASEIETLA*
Ga0105246_104409711	3300011119	Miscanthus Rhizosphere	VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA*
Ga0137348_10519251	3300011398	Soil	VDQGFLQYFIDAESALFTLRLQALSHSETGAPEIETLA*
Ga0137454_10856491	3300011406	Soil	MDQGLLQYFIDGESALFTLRLQALSHSETGTTEIETLA*
Ga0137423_12029001	3300011430	Soil	HEFNRVNCRLSPVDQGFLQYFIDAESALFTLRLQALSHSETGASEIETLA*
Ga0137364_107499531	3300012198	Vadose Zone Soil	VNQGFLQYFIEGERAMFTLRLQALSHSETGASEIETLT*
Ga0137365_103242512	3300012201	Vadose Zone Soil	VDQGFLQYFIDGESVLFTLRLHALSHSETGASEIETLA*
Ga0137399_112684341	3300012203	Vadose Zone Soil	VDQGFLQYFIDGERAMFTLRLHPLSHSETGASEIETLA*
Ga0137374_101331462	3300012204	Vadose Zone Soil	VDQGFLQYFIDGESALFTLRLHALSHSETGASEIETLA*
Ga0137381_103643442	3300012207	Vadose Zone Soil	VDQGLLQYFIDGERVMFTLRLQALSHSETGASEIETLA*
Ga0150985_1180198211	3300012212	Avena Fatua Rhizosphere	VDQGFLQYFIDGERALFTLRLQALSHSKTGASEIATLA*
Ga0137368_103383712	3300012358	Vadose Zone Soil	MNQGFLQYFIDGERAMFTLRLQALSHSETGASGIETLA*
Ga0137396_101089242	3300012918	Vadose Zone Soil	VDQGFLQYFIDGERAMFTLRLPPLSHSETGASEIETLA*
Ga0137394_107596312	3300012922	Vadose Zone Soil	VDQGFLQYFIDGVGAMFTLRLHPLSHSETGPSEIETLA*
Ga0162652_1000214252	3300012941	Soil	MDQGLLQYFIDGESALFTLRLQALSHSETGASEIETLA*
Ga0164241_107302221	3300012943	Soil	MDQGFLQYFIDGESVMFTLRLHALSHSETGGPEIETLA*
Ga0164300_100856542	3300012951	Soil	VDQGFLQYFIDAERAMFTLRLQALSHSETGAAEIETLA*
Ga0164298_102036682	3300012955	Soil	VDQGFLQYFIDGERAMFTLRLQTLSHSETGASEIETLA*
Ga0164302_101674252	3300012961	Soil	VDQGFLQYFIDGERAMFTLRLQALSHSETGAAKIETLA*
Ga0157377_104890361	3300014745	Miscanthus Rhizosphere	MDQGFLQYFIDGERALFTLRLQALSHSKTGASEIETLA*
Ga0157379_108949662	3300014968	Switchgrass Rhizosphere	KGFSQRFIDGGSRVFTLRLPALSHSETGRPEIETLA*
Ga0132258_128707761	3300015371	Arabidopsis Rhizosphere	VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLGQGVWWNPL
Ga0163161_113471861	3300017792	Switchgrass Rhizosphere	MDQGFLQYFIDGESALFTLRLQALSHSKTGASEIETLA
Ga0184604_100423702	3300018000	Groundwater Sediment	MDQGLLQYFIDGESALFTLRLQALSHSETGAPEIETLA
Ga0184605_104173481	3300018027	Groundwater Sediment	VDQGFLQYFIDGDSAMFTLRLHPLSHSETGASEIETLA
Ga0184608_103316271	3300018028	Groundwater Sediment	NCRLSPVDQGFLQLFIDGESVMFTLRLQGLSHSETGASEIETLA
Ga0184638_11900181	3300018052	Groundwater Sediment	MDQGFLQYFIDGESVMFTLRLQALSHSETGASEIETLA
Ga0184621_101515042	3300018054	Groundwater Sediment	MDQGLLQYFIDGESVMFTLRLQALSHSETGAPEIETLA
Ga0184619_104436452	3300018061	Groundwater Sediment	MDQGFLQYFIDGERALFTLRLQPLSHSETGASEIETLA
Ga0184617_10583742	3300018066	Groundwater Sediment	MHQGFLQLFIDGEGTLFTLRLQALSHSKTGASEIETLA
Ga0184617_12063222	3300018066	Groundwater Sediment	FNRVNCRLSPVNQGFLQYFIDGERSMFTLRLRALSHSETGASEIETPA
Ga0184636_12985262	3300018068	Groundwater Sediment	VDQGLLQYFIDGESALFTLRLQALSHSETGASEIETLA
Ga0184635_100325862	3300018072	Groundwater Sediment	VDQGFLQYFIDGDSALFTLRLHALSHSETGASEIETLA
Ga0184624_101569802	3300018073	Groundwater Sediment	VDQGFLQYFIDGESALFTLRLQALSHSETGAPEIETLA
Ga0184609_101036141	3300018076	Groundwater Sediment	MDQGFLQYFIDGESVLFTLRLQALSHSETGAPEIETLA
Ga0184639_101224431	3300018082	Groundwater Sediment	VDQGLLQYFIDGERAMFTLRLQALSHSETGGPEIETLA
Ga0184639_101724313	3300018082	Groundwater Sediment	VDQGFLQYFIDGESPLFTLRLQALSHSETGAPEIETLA
Ga0190272_108679582	3300018429	Soil	VNCRLSPANQGFLQYFIDGERVMFTLRLQALSHSETGASEIETLA
Ga0066667_111783862	3300018433	Grasslands Soil	MDQGFLQYFIDGESALFTLRLQALSHSETGASEIETLA
Ga0066667_114399432	3300018433	Grasslands Soil	VDQGFLQYFIDGESAMFTLRLHALSHSETGASEIETLA
Ga0190269_101341172	3300018465	Soil	VDQGFLQYFIDGERALFTLRLQPLSHSETGASEIETLA
Ga0190268_123037071	3300018466	Soil	MDQGFLQYFIDGESPLFTLRLQALSHSETGASEIETLA
Ga0066662_111187792	3300018468	Grasslands Soil	VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLGQGVWWNPLRPLTVTETL
Ga0190274_100754952	3300018476	Soil	VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA
Ga0190273_102310242	3300018920	Soil	VNQGFLQYFIDGEGVMFTLRLWALSHSETGASEIETPA
Ga0137408_13788862	3300019789	Vadose Zone Soil	VDQGFLQYFIDGERALFTLRLQALSHSETGASEIETLA
Ga0193701_10950581	3300019875	Soil	VDQGFLQLFIDGEGALFTLRLQALSHSETGAPEIETLA
Ga0193696_10922162	3300020016	Soil	VDQGFLQLFIDGERALFTLRLHPLSHSETGAPEIETLA
Ga0210380_100493103	3300021082	Groundwater Sediment	VDQGLLQYFIDGERAMFTLRLQALSHSGTGASEIETLA
Ga0224452_11776402	3300022534	Groundwater Sediment	MNQGFLQCFIDGEGAMFTLRLQPLSHSETGASEIETLA
Ga0222623_100104992	3300022694	Groundwater Sediment	MNQGFLQCFIDGERAMFTLRLQPLSHSETGASEIETLA
Ga0222622_108243021	3300022756	Groundwater Sediment	RVNCRLRPVDQGFLQLFIDGERALFTLRLQALSHSKTGASEIATLA
Ga0247746_10688122	3300022886	Soil	VNQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA
Ga0207696_10591292	3300025711	Switchgrass Rhizosphere	VDQGFLQYFIDGESALFTLRLQALSHSKTGASEIETLA
Ga0207655_12417031	3300025728	Miscanthus Rhizosphere	MDQGFLQLFIDGERALFTLRLRPLSHSKTGASKIATLGQGVWWNPLRP
Ga0207642_104217582	3300025899	Miscanthus Rhizosphere	MNQGFLQYFIDGEGVMFTLRLWALSHSETGASEIETPA
Ga0207710_101602072	3300025900	Switchgrass Rhizosphere	VDQGFLQYFIDGECAMFTLRLQALSHSETGASEIETLA
Ga0207688_108701062	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	RVNCRLSPVDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA
Ga0207647_106077991	3300025904	Corn Rhizosphere	VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLGQG
Ga0207662_102772382	3300025918	Switchgrass Rhizosphere	VDQGFLQYFIDGESALFTLRLQALSHSKTGAPEIETLA
Ga0207649_100436935	3300025920	Corn Rhizosphere	VDQGFLQYFIDGERAMFTLRLHPLSHSETGPPEIETLA
Ga0207646_104351363	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MDQGFLQYFIDGERTLFTLRLQPLSHSETGASEIETLA
Ga0207650_112067161	3300025925	Switchgrass Rhizosphere	VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLGQGVW
Ga0207689_101845731	3300025942	Miscanthus Rhizosphere	EFNRVNCRLSPVDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA
Ga0207667_119605612	3300025949	Corn Rhizosphere	VDQGFLQYFIDGESALFTLRLQALSHSGTGASEIETLA
Ga0207668_119152871	3300025972	Switchgrass Rhizosphere	VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIET
Ga0207677_122160872	3300026023	Miscanthus Rhizosphere	VDQGFLQYFIDGERAMFTLRLRALSHSETGASEIETLGQ
Ga0207703_121100801	3300026035	Switchgrass Rhizosphere	HEFNRVNCRLSPMDQGFLQLFIDGERALFTLRLRPLSHSKTGAFEIATLA
Ga0207678_113896441	3300026067	Corn Rhizosphere	EFNRVNCRLSPVDQGFLQYFIDGERAMFTLRLHPLSHSETGPPEIETLA
Ga0209686_12113522	3300026315	Soil	VDQGFLQYFIDGESALFTLRLQALSHSETGASEIETLA
Ga0209154_11235341	3300026317	Soil	VDQGFLQYFIDAESAMFTLRLHALSHSETGASEIETLA
Ga0209687_12315051	3300026322	Soil	VDQGFLQYFIDGESALFTLRLHALSHSETGASEIETLA
Ga0209806_11019952	3300026529	Soil	VNQGFLQYFIDAESAMFTLRLHALSHSETGASEIETLA
Ga0209157_11276553	3300026537	Soil	VDQGFLQYFIDGESALFTLRLHVLSHSETGASEIETLA
Ga0209177_104694391	3300027775	Agricultural Soil	VDQGFLQYFIDGERAMFTLRLRALSHSETGASEIETLGQRVWW
Ga0268266_100592883	3300028379	Switchgrass Rhizosphere	MDQGFLQYSVDGERLMFTLRLVPLSHSKTGPPEIETLA
Ga0268266_106133793	3300028379	Switchgrass Rhizosphere	VDQGFLQYFIDGERAMFTLRLRALSHSETGASEIETLGQRVWWNPLRPLTVTETLP
Ga0268265_104988671	3300028380	Switchgrass Rhizosphere	NCRLSPMDQGFLQYFIDGESALFTLRLQALSSHSKTGASEIETLA
Ga0307321_11394012	3300028704	Soil	MDQGLLQYFIDGECVMFTLRLQALSHSETGAPEIETLA
Ga0307288_100581442	3300028778	Soil	VDQGFLQLFIDGERALFTLRLQALSHSKTGASEIATLA
Ga0307300_102062842	3300028880	Soil	VNQGFLQYFIDGERVMFTLRLPALSHSETGASEIETLA
Ga0311333_102558113	3300030114	Fen	VDQGFLQYFIDGERAMFTLRLRPLSHSETGAAEIETLA
Ga0307511_103631531	3300030521	Ectomycorrhiza	MDQGFLQYFIDGERALFTLRLQALSHSETGASEIETLA
Ga0307497_104274392	3300031226	Soil	VDQGFLQYFIDGESAMFTLRLHTLSHSETGAPEIETLA
Ga0302323_1010768522	3300031232	Fen	VDQGFLQYFIDGKRAMFTLRLRPLSHSETGAAEIETLA
Ga0307509_103029203	3300031507	Ectomycorrhiza	MDQGFLQYFIDGERALFTLRLHALSHSETGASEIETLA
Ga0311364_110209701	3300031521	Fen	PVDQGFLQYFIDGERAMFTLRLRPLSHSETGAAEIETLA
Ga0308175_1000279526	3300031938	Soil	VDQGFLQYFIDGERAMFTLRLQGLSHSETGPPEMETLA
Ga0308175_1018663101	3300031938	Soil	PVDQGFLQYFIDGERAMFSFRLRPLSHSETGPPEIETLA
Ga0308175_1020622412	3300031938	Soil	RDHEFNRVNCRLSPVDQGFLQYFIDGERAMFTLRLHPLSHSETGPPEIETLA
Ga0310902_111344881	3300032012	Soil	FNRVNCRLSPVDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA
Ga0308173_105355393	3300032074	Soil	GFLQYFIDGERAMFPFRLRPLSHSETGPPEIETLA
Ga0307507_105636222	3300033179	Ectomycorrhiza	VDQGFLQYFIDGERAMFSFRLRPLSHSETGPPEIETLA
Ga0247830_115686051	3300033551	Soil	VDQGFLQYFIDGESALFTLRPHALSHSETGASEIETLA
Ga0370502_0082561_458_574	3300034156	Untreated Peat Soil	MYQGLLQYFIDGERAMFPLRLPRLSHSGTGPFEIETLA
Ga0364931_0067377_299_415	3300034176	Sediment	MDQGLLQYFIDGESVMFTLRLQALSHSETGASEIETLA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign