Basic Information | |
---|---|
Family ID | F039195 |
Family Type | Metagenome |
Number of Sequences | 164 |
Average Sequence Length | 44 residues |
Representative Sequence | MIIATVLGLLALFSFVSILLSGDDELPEVDPRDRLPTWARFGLR |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 164 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 75.00 % |
% of genes near scaffold ends (potentially truncated) | 27.44 % |
% of genes from short scaffolds (< 2000 bps) | 74.39 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.415 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (30.488 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.317 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.902 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 164 Family Scaffolds |
---|---|---|
PF13404 | HTH_AsnC-type | 43.90 |
PF01116 | F_bP_aldolase | 12.20 |
PF01988 | VIT1 | 9.15 |
PF04542 | Sigma70_r2 | 5.49 |
PF01790 | LGT | 2.44 |
PF08281 | Sigma70_r4_2 | 1.83 |
PF10099 | RskA | 1.83 |
PF04545 | Sigma70_r4 | 1.22 |
PF13419 | HAD_2 | 1.22 |
PF01804 | Penicil_amidase | 0.61 |
PF02734 | Dak2 | 0.61 |
PF00795 | CN_hydrolase | 0.61 |
PF02423 | OCD_Mu_crystall | 0.61 |
PF07992 | Pyr_redox_2 | 0.61 |
PF00355 | Rieske | 0.61 |
PF00528 | BPD_transp_1 | 0.61 |
PF06897 | DUF1269 | 0.61 |
PF02915 | Rubrerythrin | 0.61 |
PF01553 | Acyltransferase | 0.61 |
COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
---|---|---|---|
COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 12.20 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 9.15 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 9.15 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 5.49 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 5.49 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 5.49 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 5.49 |
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 2.44 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.61 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.61 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.41 % |
Unclassified | root | N/A | 11.59 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090004|P1_DRAFT_NODE_343734_len_2774_cov_18_035328 | All Organisms → cellular organisms → Bacteria | 2824 | Open in IMG/M |
2088090005|LWSO_GLQAYWI02HJ3IU | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
2088090008|P3_DRAFT_NODE_522788_len_1744_cov_16_149082 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
2088090009|LWAnN_F624WLL02HFPDF | Not Available | 535 | Open in IMG/M |
2124908035|B3_GZOS_CLC_ConsensusfromContig62593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 747 | Open in IMG/M |
2124908040|B4_c_ConsensusfromContig156715 | Not Available | 725 | Open in IMG/M |
3300001402|JGI20195J14853_1007671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2838 | Open in IMG/M |
3300001410|JGI20179J14886_1002916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1514 | Open in IMG/M |
3300001428|JGI20201J14949_1002807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1788 | Open in IMG/M |
3300001870|JGI24129J20441_1002100 | All Organisms → cellular organisms → Bacteria | 6339 | Open in IMG/M |
3300002068|JGIcombinedJ21913_10091067 | All Organisms → cellular organisms → Bacteria → PVC group | 1189 | Open in IMG/M |
3300002071|JGIcombinedJ21915_10207577 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300002071|JGIcombinedJ21915_10273630 | Not Available | 578 | Open in IMG/M |
3300002072|JGIcombinedJ21914_10036945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1775 | Open in IMG/M |
3300002538|JGI24132J36420_10039760 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
3300002538|JGI24132J36420_10066325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1076 | Open in IMG/M |
3300002549|JGI24130J36418_10055619 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300002549|JGI24130J36418_10070833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 850 | Open in IMG/M |
3300002550|JGI24131J36419_10035723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1534 | Open in IMG/M |
3300002563|JGI24138J36424_10021715 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
3300002563|JGI24138J36424_10082936 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300002563|JGI24138J36424_10126854 | Not Available | 592 | Open in IMG/M |
3300002565|JGI24137J36423_1085481 | Not Available | 673 | Open in IMG/M |
3300002569|JGI24136J36422_10005457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4094 | Open in IMG/M |
3300002569|JGI24136J36422_10025546 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
3300003852|Ga0031655_10050863 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
3300003852|Ga0031655_10135473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 966 | Open in IMG/M |
3300003858|Ga0031656_10022902 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
3300003861|Ga0031654_10206297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 563 | Open in IMG/M |
3300004011|Ga0055460_10038067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1187 | Open in IMG/M |
3300004282|Ga0066599_100602554 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300004481|Ga0069718_15456684 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300004481|Ga0069718_16260540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5992 | Open in IMG/M |
3300004481|Ga0069718_16271869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7161 | Open in IMG/M |
3300004779|Ga0062380_10135970 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300005833|Ga0074472_11113556 | All Organisms → cellular organisms → Bacteria | 1911 | Open in IMG/M |
3300005947|Ga0066794_10015672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2167 | Open in IMG/M |
3300005947|Ga0066794_10212932 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300006055|Ga0097691_1003531 | All Organisms → cellular organisms → Bacteria | 9622 | Open in IMG/M |
3300006224|Ga0079037_101074346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 798 | Open in IMG/M |
3300006619|Ga0075529_1019392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 596 | Open in IMG/M |
3300006640|Ga0075527_10051344 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300006642|Ga0075521_10015392 | All Organisms → cellular organisms → Bacteria | 3029 | Open in IMG/M |
3300006642|Ga0075521_10423809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 649 | Open in IMG/M |
3300006795|Ga0075520_1059195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1817 | Open in IMG/M |
3300006795|Ga0075520_1155193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 996 | Open in IMG/M |
3300006864|Ga0066797_1040977 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
3300006864|Ga0066797_1190530 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300006949|Ga0075528_10063500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 955 | Open in IMG/M |
3300009085|Ga0105103_10028584 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
3300009118|Ga0117940_114017 | Not Available | 588 | Open in IMG/M |
3300009118|Ga0117940_119937 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300009131|Ga0115027_11137222 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300009153|Ga0105094_10955938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 507 | Open in IMG/M |
3300009179|Ga0115028_11540397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 566 | Open in IMG/M |
3300009455|Ga0114939_10035187 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
3300009455|Ga0114939_10361676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 624 | Open in IMG/M |
3300009868|Ga0130016_10004457 | All Organisms → cellular organisms → Bacteria | 26544 | Open in IMG/M |
3300011436|Ga0137458_1199802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 607 | Open in IMG/M |
3300012668|Ga0157216_10193418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 966 | Open in IMG/M |
3300014266|Ga0075359_1131150 | Not Available | 544 | Open in IMG/M |
3300014490|Ga0182010_10028336 | All Organisms → cellular organisms → Bacteria | 2583 | Open in IMG/M |
3300014490|Ga0182010_10185192 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300014494|Ga0182017_10316187 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300014496|Ga0182011_10055862 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
3300014502|Ga0182021_10500959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1448 | Open in IMG/M |
3300014502|Ga0182021_11304500 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300014874|Ga0180084_1000257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4678 | Open in IMG/M |
3300014875|Ga0180083_1019440 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300014881|Ga0180094_1070423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 773 | Open in IMG/M |
3300018055|Ga0184616_10028213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1770 | Open in IMG/M |
3300018055|Ga0184616_10041734 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
3300018055|Ga0184616_10054649 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
3300018060|Ga0187765_10827263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 620 | Open in IMG/M |
3300022593|Ga0236338_1007638 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
3300022650|Ga0236339_1136582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2013 | Open in IMG/M |
3300024233|Ga0224521_1142971 | Not Available | 506 | Open in IMG/M |
3300025481|Ga0208079_1025447 | Not Available | 1680 | Open in IMG/M |
3300025484|Ga0208587_1010072 | All Organisms → cellular organisms → Bacteria | 3581 | Open in IMG/M |
3300025484|Ga0208587_1108437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 529 | Open in IMG/M |
3300025495|Ga0207932_1005057 | All Organisms → cellular organisms → Bacteria | 4274 | Open in IMG/M |
3300025495|Ga0207932_1008821 | All Organisms → cellular organisms → Bacteria | 3109 | Open in IMG/M |
3300025495|Ga0207932_1081351 | Not Available | 665 | Open in IMG/M |
3300025499|Ga0207931_1006323 | All Organisms → cellular organisms → Bacteria | 3033 | Open in IMG/M |
3300025533|Ga0208584_1010303 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
3300025533|Ga0208584_1050132 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300025533|Ga0208584_1148191 | Not Available | 534 | Open in IMG/M |
3300025548|Ga0208716_1002664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5966 | Open in IMG/M |
3300025553|Ga0208080_1022159 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
3300025575|Ga0209430_1138517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 523 | Open in IMG/M |
3300025604|Ga0207930_1024571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella | 1665 | Open in IMG/M |
3300025692|Ga0209744_1139618 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300025716|Ga0209746_1189337 | Not Available | 553 | Open in IMG/M |
3300025725|Ga0209638_1014476 | All Organisms → cellular organisms → Bacteria | 3972 | Open in IMG/M |
3300025764|Ga0209539_1024587 | All Organisms → cellular organisms → Bacteria | 2703 | Open in IMG/M |
3300025764|Ga0209539_1260469 | Not Available | 611 | Open in IMG/M |
3300025836|Ga0209748_1139791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 889 | Open in IMG/M |
3300025846|Ga0209538_1061471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes garbadinensis | 1583 | Open in IMG/M |
3300025857|Ga0209014_10121250 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300025865|Ga0209226_10031538 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
3300026223|Ga0209840_1023158 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
3300026357|Ga0256810_1012080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 995 | Open in IMG/M |
3300026477|Ga0256807_1080169 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300027432|Ga0209421_1028169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1094 | Open in IMG/M |
3300027811|Ga0256868_10004830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6799 | Open in IMG/M |
3300027831|Ga0209797_10032597 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
3300027841|Ga0209262_10068026 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
3300027885|Ga0209450_10321394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1121 | Open in IMG/M |
3300027896|Ga0209777_10025002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 5792 | Open in IMG/M |
3300027896|Ga0209777_10385639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1058 | Open in IMG/M |
3300027896|Ga0209777_10717581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 710 | Open in IMG/M |
3300027896|Ga0209777_10948091 | Not Available | 593 | Open in IMG/M |
3300027897|Ga0209254_10011704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8064 | Open in IMG/M |
3300027897|Ga0209254_10412778 | Not Available | 998 | Open in IMG/M |
3300027897|Ga0209254_10847880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 613 | Open in IMG/M |
3300027900|Ga0209253_10255330 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300027902|Ga0209048_10005409 | All Organisms → cellular organisms → Bacteria | 12056 | Open in IMG/M |
3300027902|Ga0209048_10389831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 958 | Open in IMG/M |
3300027902|Ga0209048_10568173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 759 | Open in IMG/M |
3300029987|Ga0311334_10823639 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300030294|Ga0311349_10540849 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300030613|Ga0299915_10454180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 849 | Open in IMG/M |
3300031249|Ga0265339_10570575 | Not Available | 520 | Open in IMG/M |
3300031521|Ga0311364_11636008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 635 | Open in IMG/M |
3300031707|Ga0315291_10027893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6616 | Open in IMG/M |
3300031746|Ga0315293_10173128 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
3300031834|Ga0315290_10056949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3189 | Open in IMG/M |
3300031834|Ga0315290_10238261 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
3300031834|Ga0315290_10244177 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
3300031952|Ga0315294_10058629 | All Organisms → cellular organisms → Bacteria | 4076 | Open in IMG/M |
3300032053|Ga0315284_10369264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1781 | Open in IMG/M |
3300032143|Ga0315292_10254364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1452 | Open in IMG/M |
3300032143|Ga0315292_10261242 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
3300032143|Ga0315292_10384042 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
3300032143|Ga0315292_10554529 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300032143|Ga0315292_10907522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 734 | Open in IMG/M |
3300032163|Ga0315281_10115523 | All Organisms → cellular organisms → Bacteria | 3088 | Open in IMG/M |
3300032164|Ga0315283_10148131 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
3300032164|Ga0315283_10754004 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300032164|Ga0315283_12105807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 558 | Open in IMG/M |
3300032173|Ga0315268_10006360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12580 | Open in IMG/M |
3300032173|Ga0315268_10377760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1383 | Open in IMG/M |
3300032173|Ga0315268_10588473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1103 | Open in IMG/M |
3300032256|Ga0315271_10134311 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
3300032275|Ga0315270_10872639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 594 | Open in IMG/M |
3300032342|Ga0315286_10023687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6317 | Open in IMG/M |
3300032342|Ga0315286_10716360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1021 | Open in IMG/M |
3300032342|Ga0315286_11108223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 780 | Open in IMG/M |
3300032397|Ga0315287_10850491 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300033413|Ga0316603_12190324 | Not Available | 522 | Open in IMG/M |
3300033416|Ga0316622_101350232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 833 | Open in IMG/M |
3300033418|Ga0316625_101001887 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300033419|Ga0316601_102638939 | Not Available | 505 | Open in IMG/M |
3300033433|Ga0326726_10141854 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
3300033482|Ga0316627_100483899 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300033482|Ga0316627_102204284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 576 | Open in IMG/M |
3300033483|Ga0316629_10109950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia | 1581 | Open in IMG/M |
3300033483|Ga0316629_10399964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 967 | Open in IMG/M |
3300033485|Ga0316626_12053064 | Not Available | 518 | Open in IMG/M |
3300033521|Ga0316616_101033580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
3300033521|Ga0316616_101114074 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300033797|Ga0334815_003985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1450 | Open in IMG/M |
3300034195|Ga0370501_0023250 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
3300034281|Ga0370481_0030749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1629 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 30.49% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 15.24% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 9.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.71% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 3.66% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 3.05% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 2.44% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.83% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.22% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.22% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 1.22% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.22% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.22% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.22% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.22% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.22% |
Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 1.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.22% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.22% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.22% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.61% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.61% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.61% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.61% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.61% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.61% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.61% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.61% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.61% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
2088090005 | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1 | Environmental | Open in IMG/M |
2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
2124908035 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
2124908040 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
3300001410 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 | Environmental | Open in IMG/M |
3300001428 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 | Environmental | Open in IMG/M |
3300001870 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 | Environmental | Open in IMG/M |
3300002068 | Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
3300002071 | Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
3300002072 | Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005) | Environmental | Open in IMG/M |
3300002538 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 | Environmental | Open in IMG/M |
3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
3300002550 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 | Environmental | Open in IMG/M |
3300002563 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 | Environmental | Open in IMG/M |
3300002565 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 | Environmental | Open in IMG/M |
3300002569 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006619 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-4B | Environmental | Open in IMG/M |
3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009118 | Lake sediment microbial communities from Pelican Lake, MN | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300014266 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1 | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300022593 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2 | Environmental | Open in IMG/M |
3300022650 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3 | Environmental | Open in IMG/M |
3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025499 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025548 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025575 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-33A (SPAdes) | Environmental | Open in IMG/M |
3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
3300025716 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes) | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
3300026357 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU5 | Environmental | Open in IMG/M |
3300026477 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR5 | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033797 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-S | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P1_DRAFT_00547130 | 2088090004 | Soil | MVFASVLGLLALFCFLSILLSGDDSEPQVDPRDKLPIWARFGMR |
LWSO_05571320 | 2088090005 | Freshwater Sediment | CQAWEVWAMVVASVLGFLALFSLVSLLLSGDDHLPEADPRDRVPTWARFGMR |
P3_DRAFT_00936850 | 2088090008 | Soil | MVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR |
LWAnN_08306730 | 2088090009 | Freshwater Sediment | MIIATVLGLLALFSFVSILLSGDEDLPEADPRDQLPAWARFGLR |
B3_GZOS_CLC_01331310 | 2124908035 | Soil | MFVITVLGLLALFSFISILLSGDDSEPQVDPRDNFPAWPRFGLR |
B4_c_03500990 | 2124908040 | Soil | MFVXTVLGLXALFSXIXILVSXXASEPQVDPRDXXPAWPRFGXR |
JGI20195J14853_10076714 | 3300001402 | Arctic Peat Soil | MEVRTVVFASVLGLLALFCFLSILLSGDDSEPQVDPRDKLPIWARFGMR* |
JGI20179J14886_10029162 | 3300001410 | Arctic Peat Soil | MVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGVR* |
JGI20201J14949_10028072 | 3300001428 | Arctic Peat Soil | MEVRTVVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGTR* |
JGI24129J20441_10021005 | 3300001870 | Arctic Peat Soil | MVFASVLGLXALFCFLSILLSGDDSEPQVDPRDKLPIWARFGMR* |
JGIcombinedJ21913_100910671 | 3300002068 | Arctic Peat Soil | LALFCFLSILLSGDDSEPQVDPRDNLPIWARFGTR* |
JGIcombinedJ21915_102075772 | 3300002071 | Arctic Peat Soil | VFASVLGLLALFCFLSILLSGDDSEPQVDPRXXDGHIWARFGMR* |
JGIcombinedJ21915_102736302 | 3300002071 | Arctic Peat Soil | VFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGXR* |
JGIcombinedJ21914_100369453 | 3300002072 | Arctic Peat Soil | VVFASVLGLLALFCFLSILLSGDDSEPQVDPRDSLPIWARFGMR* |
JGI24132J36420_100397601 | 3300002538 | Arctic Peat Soil | MVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR* |
JGI24132J36420_100663252 | 3300002538 | Arctic Peat Soil | MEVRTVVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGVR* |
JGI24130J36418_100556193 | 3300002549 | Arctic Peat Soil | MILATVLGLLALFSFISILLSDDDSEPQADPRERLPIWARYGMR* |
JGI24130J36418_100708331 | 3300002549 | Arctic Peat Soil | MIFATVLGLLALFSFVSILLSGDDSEPQVDPRDSIPTWARFGMR* |
JGI24131J36419_100357233 | 3300002550 | Arctic Peat Soil | MVFASVLGLLALFCFLSILLSGDDSEPQVDPRDKLPIWARFGMR* |
JGI24138J36424_100217151 | 3300002563 | Arctic Peat Soil | VFASVLGLLALFCFLSILLSGDDSEPQVDPRDSLPIWARFGMR* |
JGI24138J36424_100829362 | 3300002563 | Arctic Peat Soil | ASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR* |
JGI24138J36424_101268542 | 3300002563 | Arctic Peat Soil | VFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR* |
JGI24137J36423_10854811 | 3300002565 | Arctic Peat Soil | VFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGTR* |
JGI24136J36422_100054573 | 3300002569 | Arctic Peat Soil | MVFASVLGLLALFCFLSILLSGDDSEPQVDPRDSLPIWARFGMR* |
JGI24136J36422_100255462 | 3300002569 | Arctic Peat Soil | MILATVLGLLVLFSFISILLSGDDSEPQVDPRDNLPVWARFGMR* |
Ga0031655_100508631 | 3300003852 | Freshwater Lake Sediment | MILASVLGLLALFAVLSILLSGHNSEPQVDPRDELPTWARFGMR* |
Ga0031655_101354732 | 3300003852 | Freshwater Lake Sediment | MILASVLGLLALFSVVSILLSGHDSEPQVDPRDKLPTWARFGMR* |
Ga0031656_100229023 | 3300003858 | Freshwater Lake Sediment | MIIATVLGLLALFSFVSILLSGDDELAEADPRDRLPVWARFGLR* |
Ga0031654_102062971 | 3300003861 | Freshwater Lake Sediment | MVLASVLGLLALFCFLSILLSGDESEPQVDPRDSLPVWARFR |
Ga0055460_100380673 | 3300004011 | Natural And Restored Wetlands | MVIATVLGLLALFSIVSLLLSGEDELTEVDPRDKLPAWARFSLR* |
Ga0066599_1006025542 | 3300004282 | Freshwater | MIIASVLGLLALFSFVSILLSGDDELPEADPRDRLPTWARFGLR* |
Ga0069718_154566843 | 3300004481 | Sediment | ATVLGLLALFSFVSLLLSGDDELPEADPRDRLPTWARFGLR* |
Ga0069718_162605405 | 3300004481 | Sediment | MIIATVLGLLALFSFVSILLSGDDELPEADPRDRLPLWARYGLR* |
Ga0069718_162718696 | 3300004481 | Sediment | MIIATVLGLLALFSFVSILLSGDDEHAEADPRDQIPAWARFGLR* |
Ga0062380_101359701 | 3300004779 | Wetland Sediment | MIIATVLGLLALFSFISILLSGDDELSEADPRDQLPIWARFGLR* |
Ga0074472_111135563 | 3300005833 | Sediment (Intertidal) | MIIATVLGLLALFSFVSILLSGDDELPEADPRDQLPTWARFGLR* |
Ga0066794_100156723 | 3300005947 | Soil | VVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR* |
Ga0066794_102129322 | 3300005947 | Soil | SVLGLLALFCFLSILLSGDDSEPQVDPRDKLPIWARFGMR* |
Ga0097691_10035318 | 3300006055 | Arctic Peat Soil | VVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGVR* |
Ga0079037_1010743461 | 3300006224 | Freshwater Wetlands | MIIATVLGLLVLFSFVSILLSGDDELPEADPRDQLPAWARFGLR* |
Ga0075529_10193922 | 3300006619 | Arctic Peat Soil | MEVRTVVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGTR |
Ga0075527_100513441 | 3300006640 | Arctic Peat Soil | VVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWA |
Ga0075521_100153923 | 3300006642 | Arctic Peat Soil | VFLATVLGLLALFCFVSILLSGDDLGPQADPRHALPVWVRLALR* |
Ga0075521_104238092 | 3300006642 | Arctic Peat Soil | MIFATVLGLLALFSFISILLSGDDSEPQVDPRDSIPTWARFGMR* |
Ga0075520_10591952 | 3300006795 | Arctic Peat Soil | MFVITVLGLLALFSFISILVSGDASEPQVDPRDNLPAWPRFGLR* |
Ga0075520_11551931 | 3300006795 | Arctic Peat Soil | MEVRTVVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR* |
Ga0066797_10409771 | 3300006864 | Soil | MVFASVLGLLALFCFLSILLSGDDSGPQVDPRDNLPIWARFGMR* |
Ga0066797_11905301 | 3300006864 | Soil | RTMVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR* |
Ga0075528_100635002 | 3300006949 | Arctic Peat Soil | VFLATVLGLLALFCFVSILLSGDDLGPQADPRHALPVWARVALR* |
Ga0105103_100285841 | 3300009085 | Freshwater Sediment | VLGLLALFSFVSILLSDEDELPEVDPRDRLPTWARFGLR* |
Ga0117940_1140172 | 3300009118 | Lake Sediment | VNTMVLATVLGLLALFSFVSILLSGDDELPEADPRDKLPVWARFGLR* |
Ga0117940_1199371 | 3300009118 | Lake Sediment | SNRRTAGVTPVTTTEVRTMIIATVLGLLALFSFVSILLSGDDELAEADPRDRLPVWARFGLR* |
Ga0115027_111372222 | 3300009131 | Wetland | MIIATVLGLLALFSFISILLSGDDELPEADPRDQLPTWARFGLR* |
Ga0105094_109559382 | 3300009153 | Freshwater Sediment | MTIATVLGLLALFSFVSILLSGDDELPEADPRDLLPPWARYGMR* |
Ga0115028_115403971 | 3300009179 | Wetland | MIIATVLGLLALFSFVSILLSGDDELPEVDPRDRLPTWARFGLR* |
Ga0114939_100351873 | 3300009455 | Groundwater | MVIATVLGLLALFSFVSILLSGDDELPEADPRDKLPLWARFGLR* |
Ga0114939_103616762 | 3300009455 | Groundwater | MVIATVLGLLALFSFVSILLSSDDELPEADPRDRLPLWARYGLR* |
Ga0130016_1000445718 | 3300009868 | Wastewater | MEVCTMIIATVLGLLALFSFVSILLSGDDERPEADPRDQLPVWARFGLR* |
Ga0137458_11998022 | 3300011436 | Soil | MLIATVLGLLALFSFVSILLSGDDELSEADPRDQLPTWARFGLR* |
Ga0157216_101934182 | 3300012668 | Glacier Forefield Soil | MIIATVLGLLALFSFVSILLGGDDEHAEADPRDQLPTWARFGLR* |
Ga0075359_11311501 | 3300014266 | Natural And Restored Wetlands | MVLASVLGLLALFAFVSILLSGDDELPEADPRDKLPVWARFGLR* |
Ga0182010_100283364 | 3300014490 | Fen | MFLVTVLGLLALFSFISILVSGDASEPQVDPRDNLPAWPRFGLR* |
Ga0182010_101851922 | 3300014490 | Fen | MFVVTVLGLLALFSFISILVSGDASEPQVDPRDNLPAWPRFGLR* |
Ga0182017_103161872 | 3300014494 | Fen | MFVITVLGLLALFSFISILVSSDASEPQVDPRDNFPAWPRFGLR* |
Ga0182011_100558625 | 3300014496 | Fen | MFVVTVLGLLALFSFISILVSGDASEPQVDPRDNLPAWPRFVLR* |
Ga0182021_105009592 | 3300014502 | Fen | MILATVLGLLALFCFVSILLSGDDSEPQADPRDALPTWARFALR* |
Ga0182021_113045001 | 3300014502 | Fen | HCTEGRTMFLVTVLGLLALFSFISILVSGDASEPQVDPRDNLPAWPRFGLR* |
Ga0180084_10002573 | 3300014874 | Soil | MTYVEVRPMIIATVLGLLALFSFVSILLSSDDELREADPRDQLPPWARFGLR* |
Ga0180083_10194403 | 3300014875 | Soil | TAVVSMTYVEVRPMIIAIVLGLLALLSFVSILLGSDDELPEADPRDQLPPWARFGLR* |
Ga0180094_10704232 | 3300014881 | Soil | MTYVEVRPMIIATVLGLLALLSFVSILLGSDDELPEADTRDQLP |
Ga0184616_100282134 | 3300018055 | Groundwater Sediment | MIIATVLGLLALFSFVSILLSGDDELPETDPRDQLPTWARFGLR |
Ga0184616_100417342 | 3300018055 | Groundwater Sediment | MIIATVLGLLALFSFVSILLSSDDELPEADPRDQLPTWARFGLR |
Ga0184616_100546492 | 3300018055 | Groundwater Sediment | MIIATVLGLLALFSFVSILLSGDDELPEANPRDQIPTWARFGLR |
Ga0187765_108272632 | 3300018060 | Tropical Peatland | MEVCTMIAIALGLLALFSFLTILASGDDERREADDPRDALPLWTRFGHH |
Ga0236338_10076384 | 3300022593 | Freshwater | MFLVTVLGLLALFSFISILVSGDASEPQVDPRDNLPAWPRFGLR |
Ga0236339_11365823 | 3300022650 | Freshwater | MMLATVLGLLALFSVLSILLSGHDSEPQVDPRDKLPTWARFGMR |
Ga0224521_11429712 | 3300024233 | Soil | EGRTMFLVTVLGLLALFSFISILVSGDASEPQVDPRDNLPAWPRFGLR |
Ga0208079_10254473 | 3300025481 | Arctic Peat Soil | SVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGVR |
Ga0208587_10100726 | 3300025484 | Arctic Peat Soil | VVFASVLGLLALFCFLSILLSGDDSEPQVDPRDKLPIWARFGMR |
Ga0208587_11084372 | 3300025484 | Arctic Peat Soil | MIFATVLGLLALFSFVSILLSGDDSEPQVDPRDSIP |
Ga0207932_10050574 | 3300025495 | Arctic Peat Soil | VVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGVR |
Ga0207932_10088213 | 3300025495 | Arctic Peat Soil | MIFASVLGLLALFSFVSILLSGDDSEPQVDPRDSIPTWARFGMR |
Ga0207932_10813511 | 3300025495 | Arctic Peat Soil | MILATVLGLLVLFSFISILLSGDDSEPQVDPRDNLPVWARFGMR |
Ga0207931_10063232 | 3300025499 | Arctic Peat Soil | VVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR |
Ga0208584_10103034 | 3300025533 | Arctic Peat Soil | VVFASVLGLLALFCFLSILLSGDDSEPQVDPRDSLPIWARFGMR |
Ga0208584_10501322 | 3300025533 | Arctic Peat Soil | VLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR |
Ga0208584_11481911 | 3300025533 | Arctic Peat Soil | DYPQHTEVCTMIFATVLGLLALFSFVSILLSGDDSEPQVDPRDSIPTWARFGMR |
Ga0208716_10026644 | 3300025548 | Arctic Peat Soil | MIFATVLGLLALFSFVSILLSGDDSEPQVDPRDSIPTWARFGMR |
Ga0208080_10221591 | 3300025553 | Arctic Peat Soil | VFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR |
Ga0209430_11385171 | 3300025575 | Arctic Peat Soil | MVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGTR |
Ga0207930_10245711 | 3300025604 | Arctic Peat Soil | MILATVLGLLALFCFLSILLSGDDSEPQVDPRDKLPIWARFGMR |
Ga0209744_11396182 | 3300025692 | Arctic Peat Soil | ASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR |
Ga0209746_11893373 | 3300025716 | Arctic Peat Soil | LLALFCFLSILLSGDDSEPQVDPRDSLPIWARFGMR |
Ga0209638_10144766 | 3300025725 | Arctic Peat Soil | VFLATVLGLLALFCFVSILLSGDDSEPQADPRDALPVWARVALR |
Ga0209539_10245873 | 3300025764 | Arctic Peat Soil | MVFASVLGLLALFCFLSILLSGDDSEPQVDPRDSLPIWARFGMR |
Ga0209539_12604692 | 3300025764 | Arctic Peat Soil | VLGLLALFSFVSILLSGDDSEPQVDPRDSIPTWARFGMR |
Ga0209748_11397911 | 3300025836 | Arctic Peat Soil | MEVRTVVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGMR |
Ga0209538_10614713 | 3300025846 | Arctic Peat Soil | MVLASVLGLLALFCFPSILLSGDDSEPQEDPRASLPTWARVEMR |
Ga0209014_101212502 | 3300025857 | Arctic Peat Soil | VFLATVLGLLALFCFVSILLSGDDLGPQADPRHALPVWARVALR |
Ga0209226_100315383 | 3300025865 | Arctic Peat Soil | VVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLPIWARFGTR |
Ga0209840_10231583 | 3300026223 | Soil | MVFASVLGLLALFCFLSILLSGDDSEPQVDPRDNLP |
Ga0256810_10120802 | 3300026357 | Sediment | MIIATVLGLLALFSFLSILLSGDDELPEANPRDRLPTWARLGLR |
Ga0256807_10801692 | 3300026477 | Sediment | MILATVLGLLALFSFISILLSGDDELPEADPRDRLPAWARFGLR |
Ga0209421_10281691 | 3300027432 | Forest Soil | MFLVTVLGLLALFSIISILLSGDASEPQVNPRDNLPAWPRFGLR |
Ga0256868_100048307 | 3300027811 | Soil | MIIATVLGLLALFSFVSILLSGDDELPEADPRDQLPTWARFGLR |
Ga0209797_100325971 | 3300027831 | Wetland Sediment | MIIATVLGLLALFSFISILLSGDDELSEADPRDQLPIWARFGLR |
Ga0209262_100680264 | 3300027841 | Freshwater | MTIATVLGLLALFSFVSILLSGDDELPEVDPRDRLPTWARFGLR |
Ga0209450_103213944 | 3300027885 | Freshwater Lake Sediment | MIIATVLGLLALFSFVSILLSGDDELPEVDPRDRLP |
Ga0209777_100250026 | 3300027896 | Freshwater Lake Sediment | MILASVLGLLALLAVVSILLSGHDSEPQVDPRDKLPTWARFGMR |
Ga0209777_103856391 | 3300027896 | Freshwater Lake Sediment | MILASVLGLLALFSVLSILLSGHDSEPQVDPRDKLPTWARFGMR |
Ga0209777_107175811 | 3300027896 | Freshwater Lake Sediment | MILASVLGLLALFAVLSILLSGHNSEPQVDPRDELPTWARFGMR |
Ga0209777_109480912 | 3300027896 | Freshwater Lake Sediment | MILASVLGLLALFAVLSTLLSGHDSEPQVDPRDKLPTWARFGLR |
Ga0209254_100117048 | 3300027897 | Freshwater Lake Sediment | MIIATVLGLLALFSFVSILLSGDDELAEADPRDRLPVWARFGLR |
Ga0209254_104127783 | 3300027897 | Freshwater Lake Sediment | MEVCGMIIASVLGLLALFSFVSILLSGDDELPEVDPRDRLPTWARFGVR |
Ga0209254_108478801 | 3300027897 | Freshwater Lake Sediment | MIIATVLGLLALFSFVSILLSGDEDLPEADPRDQLPTWARFGLR |
Ga0209253_102553301 | 3300027900 | Freshwater Lake Sediment | KPVTTTGVRTMIIATVLGLLALFSFVSILLSGDDELAEADPRDRLPVWARFGLR |
Ga0209048_100054095 | 3300027902 | Freshwater Lake Sediment | MVLASVLGLLALFCFLSILLSGDESEPQVDPRDSLPVWARFRPH |
Ga0209048_103898311 | 3300027902 | Freshwater Lake Sediment | MFLATVLGLLALFSLASILLSGDDELPGADPRDQLPIWARFSHR |
Ga0209048_105681732 | 3300027902 | Freshwater Lake Sediment | MIIATVLGLLALLSFVSILLSADDGPPEADPRDHLPAWARFGGR |
Ga0311334_108236392 | 3300029987 | Fen | HIRSTIVDYPQHTEVRTMIFATVLGLLALFSFISILLSGDDSEPQVDPRDNLPIWARFGM |
Ga0311349_105408491 | 3300030294 | Fen | TIVDYPQHTEVRTMIFATVLGLLALFSFISILVSGDASEPQVDPRDNLPAWPRFGLR |
Ga0299915_104541802 | 3300030613 | Soil | MIIATVLGLLALFSFVSILLSGDDELREADPRDQLPTWARFGLR |
Ga0265339_105705752 | 3300031249 | Rhizosphere | RRSSTIIHCTEGRTMFVVTVLGLLALFSFISILVSGDASEPQVDPRDNLPAWPRFGLR |
Ga0311364_116360081 | 3300031521 | Fen | MILATVLGLLALFCFVSILLSGDDSEPQADPRDALPTWARF |
Ga0315291_100278932 | 3300031707 | Sediment | MIIATVLGLLALFSFVSILLSGDDELSEADPRDQLPTWARFGLR |
Ga0315293_101731283 | 3300031746 | Sediment | MVIATVLGLLALFSFLSILLSGDDELPEVSPRDQLPVWAIFGLR |
Ga0315290_100569496 | 3300031834 | Sediment | MIIATVLGLLALFSFVSILLSGDDELPEADPRDQLPSWARFGLR |
Ga0315290_102382613 | 3300031834 | Sediment | MIIAAVLGLLALFSFVSILLSGDDELPEADPRDQLPTWARFGLR |
Ga0315290_102441773 | 3300031834 | Sediment | MIIATVLALLALFSFVSILLSGDEDLPEADPRDQLPAWARFGLR |
Ga0315294_100586295 | 3300031952 | Sediment | ATVLGLLALFSFVSILLSGDDELSEADPRDQLPTWARFGLR |
Ga0315284_103692643 | 3300032053 | Sediment | MIIATVLGLLALFSFISILLSGDDELSEADPRDQLPTWARFGLR |
Ga0315292_102543643 | 3300032143 | Sediment | MIIAAVLGLLALFSFVSILLSGDDELPEVDPRDRLPTWARFGLR |
Ga0315292_102612421 | 3300032143 | Sediment | MIIATVLGLLALFSFVSIVLSGDDELPQGDPRDRLPAWVRFGLR |
Ga0315292_103840421 | 3300032143 | Sediment | MVVASVLGFLALFSLVSILLSGDDDLREADPRDRVPTWARFGMR |
Ga0315292_105545293 | 3300032143 | Sediment | MIIATVLGLLALFSFVSILLSGDDEVPEVDPRDRLPTWARFGLR |
Ga0315292_109075221 | 3300032143 | Sediment | MIIATVLGLLALFSFVSILLSGDDELPEADPRDQLP |
Ga0315281_101155233 | 3300032163 | Sediment | MVLATVLGLLALFSFISILLSGEDEHLPADPRNSLPTWARFGIR |
Ga0315283_101481314 | 3300032164 | Sediment | MIIASVLGFLALFSFVSIVLSGDDELPQGDPRDRLPAWVRFGLR |
Ga0315283_107540043 | 3300032164 | Sediment | MIIAAVLGLLALFSFVSILLSGDDDLPEADPRDQLPTWVRFGLR |
Ga0315283_121058072 | 3300032164 | Sediment | MIIATVIGLLALFSFVSILLAGDDELPEADPREQLPVWARLR |
Ga0315268_100063606 | 3300032173 | Sediment | MILATVLGLLALFSFISILLSDHDSEPQADPRERLPIWARYGMR |
Ga0315268_103777602 | 3300032173 | Sediment | MTRQMVGFKYDPMEECTMVIASVLGLLALFSFVSILLSGGDELPEVDPRDRLPAWVRFGL |
Ga0315268_105884731 | 3300032173 | Sediment | MIIATVLGLLALFSFVSILLSGDDELPEVDPRDQLPTWVRFGLR |
Ga0315271_101343113 | 3300032256 | Sediment | MVIATVLGLLALLSFVSILLSGDDELPEADPRDQVPTWARFGMR |
Ga0315270_108726392 | 3300032275 | Sediment | MVIATVLGLLALLSFVSILLSGDDELPEADPRDQVPTWAR |
Ga0315286_100236878 | 3300032342 | Sediment | MILATVLGLLALFSFLSILLSGDDSEPQVGPRDNLPGWARFGMR |
Ga0315286_107163603 | 3300032342 | Sediment | MIIATVLGLLALFSFVSILLSGDDELPEVDPRDRLPTWARFGLR |
Ga0315286_111082232 | 3300032342 | Sediment | MIIATVLGLLALFSFVSILLSGDDELSEADPRDQLPTWAR |
Ga0315287_108504913 | 3300032397 | Sediment | GLLALFSFVSILLAGDDELPEADPREQLPVWARLR |
Ga0316603_121903242 | 3300033413 | Soil | MILATVLGLLALFSFVSILLSGDDEMPEADPRDQLPDWARFSLR |
Ga0316622_1013502321 | 3300033416 | Soil | MIIATVLGLLVLFSFVSILLSGDDELPEADPRDQLPAWARFGLR |
Ga0316625_1010018871 | 3300033418 | Soil | MILATVLGLLALFSFVSILLSGDDELPEADPRDRLPDWARFGLR |
Ga0316601_1026389391 | 3300033419 | Soil | MILATVLGLLALFSFVSILLSGDDELPEADPRDQLPAWARFGLR |
Ga0326726_101418541 | 3300033433 | Peat Soil | MIIATVFGLLALFSFVSILLSGDDELPEADPRDQLPVWARFGLR |
Ga0316627_1004838991 | 3300033482 | Soil | MVLATVLGLLALFSFVSILLSGDDELPEADPRDKLPLWARFGLR |
Ga0316627_1022042842 | 3300033482 | Soil | MIIATVLGLLALFSFISILLSGDDELPEADPRDQLPTWARFGLR |
Ga0316629_101099501 | 3300033483 | Soil | RTMIIATVLGLLVLFSFVSILLSGDDELPEADPRDQLPAWARFGLR |
Ga0316629_103999642 | 3300033483 | Soil | MIIATVLGLLSFVSILLSGDDELPEADPRDQLPTWARFGLR |
Ga0316626_120530641 | 3300033485 | Soil | MVIATVLGLLALFSFVSILLSGDDELPEADPRDRLPAWARFGLR |
Ga0316616_1010335803 | 3300033521 | Soil | MIIATVLGLLVLFSFVSILLSGDDELPEADPRDQLPAWAR |
Ga0316616_1011140743 | 3300033521 | Soil | MILATVLGLLALFSFVSILLSGDDELPEADPRDRLPDWARFGLRSPTMA |
Ga0334815_003985_1_114 | 3300033797 | Soil | GLLALFSFISILVSGDASEPQVDPRDNLPAWPRFGLR |
Ga0370501_0023250_1372_1506 | 3300034195 | Untreated Peat Soil | MIFATVLGLLALFSFISILLSGDDSEPQVDPRDSLPIWARYGMR |
Ga0370481_0030749_696_830 | 3300034281 | Untreated Peat Soil | MIFATVLGLLALFSFISILLSGDDSEPQVDPRDSIPTWARFGMR |
⦗Top⦘ |