Basic Information | |
---|---|
Family ID | F039107 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 164 |
Average Sequence Length | 43 residues |
Representative Sequence | MAGSRTLKLSILADVDDLKKKLDVGSKEVEGFGGKLEKFGK |
Number of Associated Samples | 140 |
Number of Associated Scaffolds | 164 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 97.06 % |
% of genes near scaffold ends (potentially truncated) | 81.10 % |
% of genes from short scaffolds (< 2000 bps) | 76.83 % |
Associated GOLD sequencing projects | 132 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (78.049 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (13.415 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.585 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 164 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 1.22 |
PF04860 | Phage_portal | 1.22 |
COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.22 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.49 % |
Unclassified | root | N/A | 19.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001837|RCM39_1035816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
3300001842|RCM30_1086320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
3300001851|RCM31_10356532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
3300002402|B570J29627_1001940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1853 | Open in IMG/M |
3300002476|metazooDRAFT_10794526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300002835|B570J40625_100943915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
3300004054|Ga0063232_10191841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300005585|Ga0049084_10287703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300005805|Ga0079957_1259267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300005805|Ga0079957_1323817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300005943|Ga0073926_10019710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1226 | Open in IMG/M |
3300006030|Ga0075470_10024219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1880 | Open in IMG/M |
3300006030|Ga0075470_10039975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1446 | Open in IMG/M |
3300006030|Ga0075470_10182482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300006637|Ga0075461_10139131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
3300006802|Ga0070749_10208087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1119 | Open in IMG/M |
3300006805|Ga0075464_10123075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1508 | Open in IMG/M |
3300006805|Ga0075464_10131090 | Not Available | 1462 | Open in IMG/M |
3300006805|Ga0075464_10232156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
3300006917|Ga0075472_10279386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300007169|Ga0102976_1132625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2406 | Open in IMG/M |
3300007177|Ga0102978_1048280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1405 | Open in IMG/M |
3300007346|Ga0070753_1075653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
3300007516|Ga0105050_10532430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300007542|Ga0099846_1108516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
3300007640|Ga0070751_1338521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300007960|Ga0099850_1116742 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
3300008120|Ga0114355_1185977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300008122|Ga0114359_1091119 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
3300008263|Ga0114349_1022480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3178 | Open in IMG/M |
3300008263|Ga0114349_1127463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1057 | Open in IMG/M |
3300008266|Ga0114363_1170558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300008339|Ga0114878_1128173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300009026|Ga0102829_1191161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300009081|Ga0105098_10035372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1980 | Open in IMG/M |
3300009111|Ga0115026_11518781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300009164|Ga0114975_10712922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300009180|Ga0114979_10551502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300009183|Ga0114974_10419387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300010354|Ga0129333_10733492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300010370|Ga0129336_10253268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300010370|Ga0129336_10401282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300010370|Ga0129336_10403643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300010885|Ga0133913_11015711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2143 | Open in IMG/M |
3300011268|Ga0151620_1162024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300012013|Ga0153805_1026795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 980 | Open in IMG/M |
3300013004|Ga0164293_10209464 | Not Available | 1402 | Open in IMG/M |
3300013014|Ga0164295_10040393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3530 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10776837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10811677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300013295|Ga0170791_10927695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300013372|Ga0177922_11255914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300017722|Ga0181347_1079346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
3300017774|Ga0181358_1110970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
3300017774|Ga0181358_1204674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300017774|Ga0181358_1275952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300017777|Ga0181357_1178683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
3300017780|Ga0181346_1267467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300017785|Ga0181355_1395615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300019784|Ga0181359_1183904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300020048|Ga0207193_1093753 | All Organisms → Viruses → Predicted Viral | 2776 | Open in IMG/M |
3300020159|Ga0211734_10540476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1072 | Open in IMG/M |
3300020160|Ga0211733_10896959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300020161|Ga0211726_11044517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
3300020161|Ga0211726_11080984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300020527|Ga0208232_1006151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1963 | Open in IMG/M |
3300020527|Ga0208232_1031587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300020549|Ga0207942_1003875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2276 | Open in IMG/M |
3300020570|Ga0208465_1033533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300021962|Ga0222713_10405322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
3300022176|Ga0212031_1053251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300022190|Ga0181354_1154457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
3300022200|Ga0196901_1161698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300022407|Ga0181351_1169905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300022747|Ga0228703_1059602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
3300024298|Ga0255178_1080219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300024343|Ga0244777_10237990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1161 | Open in IMG/M |
3300024346|Ga0244775_11310546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300024550|Ga0255266_1017422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1755 | Open in IMG/M |
3300024560|Ga0256306_1025006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1486 | Open in IMG/M |
3300024568|Ga0255238_1153807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300024570|Ga0255276_1028870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1503 | Open in IMG/M |
3300025585|Ga0208546_1133682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300025646|Ga0208161_1143025 | Not Available | 606 | Open in IMG/M |
3300025732|Ga0208784_1073979 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
3300025818|Ga0208542_1053383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1250 | Open in IMG/M |
3300025896|Ga0208916_10155256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
3300026562|Ga0255285_1014777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1563 | Open in IMG/M |
3300026568|Ga0255240_1123290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300027129|Ga0255067_1036178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300027151|Ga0255063_1028157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
3300027153|Ga0255083_1018742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1495 | Open in IMG/M |
3300027153|Ga0255083_1061490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300027601|Ga0255079_1076805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300027601|Ga0255079_1104715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300027697|Ga0209033_1123823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
3300027707|Ga0209443_1232364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300027733|Ga0209297_1104207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1211 | Open in IMG/M |
3300027785|Ga0209246_10377901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300027798|Ga0209353_10304729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300027808|Ga0209354_10361669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300027832|Ga0209491_10352732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
3300027899|Ga0209668_10152837 | Not Available | 1401 | Open in IMG/M |
3300027899|Ga0209668_10992739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300027963|Ga0209400_1044329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2354 | Open in IMG/M |
3300027971|Ga0209401_1246855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300029930|Ga0119944_1006368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1873 | Open in IMG/M |
3300029930|Ga0119944_1006832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1798 | Open in IMG/M |
3300031758|Ga0315907_11077741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300031772|Ga0315288_10049460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5011 | Open in IMG/M |
3300031787|Ga0315900_10573010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300031787|Ga0315900_10601457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300031857|Ga0315909_10321211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1146 | Open in IMG/M |
3300031885|Ga0315285_10429853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
3300031951|Ga0315904_10060707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4158 | Open in IMG/M |
3300031963|Ga0315901_10828119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300031999|Ga0315274_10932532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300032046|Ga0315289_10954846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300032046|Ga0315289_11387367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300032093|Ga0315902_11099520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300032116|Ga0315903_10814989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300032173|Ga0315268_11618940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300032177|Ga0315276_10977461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300033414|Ga0316619_11966898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300033557|Ga0316617_101710613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300033978|Ga0334977_0289136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300034018|Ga0334985_0077372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2399 | Open in IMG/M |
3300034062|Ga0334995_0526568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300034082|Ga0335020_0390656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300034096|Ga0335025_0523354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300034104|Ga0335031_0245994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1188 | Open in IMG/M |
3300034104|Ga0335031_0802371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300034106|Ga0335036_0799907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300034109|Ga0335051_0385052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300034112|Ga0335066_0418105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300034283|Ga0335007_0535998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.41% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.59% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.37% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.93% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.10% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.49% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.27% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.66% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.66% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.05% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.44% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.83% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.83% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.83% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.83% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.22% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.22% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.22% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.22% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.22% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.22% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.61% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.61% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.61% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.61% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.61% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.61% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.61% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.61% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.61% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001837 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002402 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion | Environmental | Open in IMG/M |
3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003488 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012266 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG | Environmental | Open in IMG/M |
3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024550 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027153 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h | Environmental | Open in IMG/M |
3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027719 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM39_10358161 | 3300001837 | Marine Plankton | VAGSRTLKLSILADVDDLKKKLATADNDVQGFSGQVEKFGK |
RCM30_10863204 | 3300001842 | Marine Plankton | VAGSRTLKLSILADVDDLKKKLATADNDVQGFSGQVEKFGKMAAAAFAAAA |
RCM31_103565321 | 3300001851 | Marine Plankton | MAGSRTLKLSILADVDNLRKNLTEGGNDVESFGSKL |
B570J29627_10019405 | 3300002402 | Freshwater | MAGSRTLKLSILADVDNLKKNLNAGEKEVEGFGGKLEKFGKVAAAAFAAAA |
metazooDRAFT_107945261 | 3300002476 | Lake | MAGSRTLKLSILADIDNLKKNLNEGDKEIQGFGGKLEKFGKV |
B570J40625_1009439152 | 3300002835 | Freshwater | MAGQSRTLKLSILADVDQLKRSLNTGSGEVDGFAGKLGGFAKK |
JGI25919J51413_10075591 | 3300003488 | Freshwater Lake | MAAGTRTLKLSLLADVAGLSKGLDQGSKEVESFGSKVGDFGKKAGLAF |
Ga0063232_101918412 | 3300004054 | Freshwater Lake | MAVGGSRTLKLSILADIDNLKKNLDSGSNEVEGFGSKLGGFAQKAGAA |
Ga0049084_102877032 | 3300005585 | Freshwater Lentic | MAGSRTLKLSILADVDDLKKKLDTGSKEVEGFGGKLEKFGKVAAAAF |
Ga0079957_11787213 | 3300005805 | Lake | MAGSRTLKLSILADVDQLRRNLSSGSQDVASFGERVTDFGKKAGIAFAAATAA |
Ga0079957_12592671 | 3300005805 | Lake | MAGSRTLKLSILADVDDLRKKLTESSNEVEGFGSKVADFGK |
Ga0079957_13238171 | 3300005805 | Lake | MAEFRTLKLSILADVDNLKKQLGQGEKEVQSFGSKVADFG |
Ga0073926_100197101 | 3300005943 | Sand | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKFGKVAAAAFA |
Ga0075470_100242191 | 3300006030 | Aqueous | MAGSRTLKLSILADVDNLRKNLSTGSQEVISFGDRVSDFGKKAGLA |
Ga0075470_100399751 | 3300006030 | Aqueous | MAGSRTLKLSILADVDDLKKKLDVGSKEVEGFGGKLEKFGKVAAAAF |
Ga0075470_101824822 | 3300006030 | Aqueous | MAGSRTLKLSILADVDNLKKNLDVGSKEVEGFGGKLE |
Ga0075461_101391312 | 3300006637 | Aqueous | MAGSRTLKLSILADVDDLKKKLDVGSKEVEGFGGKLEKFGK |
Ga0070749_102080874 | 3300006802 | Aqueous | MAGSRTLKLSILADVDNLKKNLDSGAKEVEGFGGKLEKFGKVAA |
Ga0075464_101230755 | 3300006805 | Aqueous | MAGQSRTLKLSILADVDQLKKSLNTGSTEVQGFGDKIGDF |
Ga0075464_101310901 | 3300006805 | Aqueous | MADGSRTLKLSILADVDNLKKGLTQAGDDTESFGKKVGD |
Ga0075464_102321561 | 3300006805 | Aqueous | MAGNRTLKLSILADVDDLKKKLDTSSNEVEGFAGKLEKFGKIAGAAFLAAGAAAVA |
Ga0075464_104838873 | 3300006805 | Aqueous | MAGTGSRTLKLAILGDIDNLKKSLDQGTQEVSSFGDKV |
Ga0075472_102793863 | 3300006917 | Aqueous | MAGSRTLKLSILADVDGLRDGLKKGQNEMGGFEKTLADFG |
Ga0102976_11326256 | 3300007169 | Freshwater Lake | MAGSRTLKLSILADVDDLRKKLNTADNDVQGFGDKLGKWSKVAGAAFLAAG |
Ga0102978_10482804 | 3300007177 | Freshwater Lake | MAGSRTLKLSILADVDNLKKELDKGSKEVEGFSGKLEKFSAAAKA |
Ga0070753_10756531 | 3300007346 | Aqueous | MAGSRTLKLSILADVDDLKKKLDIGSKEVEGLAVS* |
Ga0105050_105324303 | 3300007516 | Freshwater | VAVGSRTLKLSILADVDQLKKSLTGGAGDVQSFGD |
Ga0099846_11085163 | 3300007542 | Aqueous | MAGSRTLKLSILADVDNLKKNLDTGSKEVEGFGGKLEKFGKVAAAAFA |
Ga0070751_13385211 | 3300007640 | Aqueous | MAGSRTLKLSILADVDDLKKKLDVGANEVEGFGGKMEKF |
Ga0099850_11167421 | 3300007960 | Aqueous | MAGNRTLKLSILADIDNLKKNLAGADKEIQGFGGKLAEFGKKAALALAAVGA |
Ga0114341_102866793 | 3300008108 | Freshwater, Plankton | MAGNRTLKLSILADVDDLNKKLKSANGDVESSSNKLGDFAKKAGVAFAA |
Ga0114343_11356721 | 3300008110 | Freshwater, Plankton | MAGNRTLKLSILADVDDLNKKLKAANGDVEQSAGKLEKFGKVA |
Ga0114355_11859772 | 3300008120 | Freshwater, Plankton | MAGSRTLKLSILADVDDLKKNLAKGTDEVQTFGSKIADFGKKAGIAFA |
Ga0114359_10911191 | 3300008122 | Freshwater, Plankton | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKFG |
Ga0114349_10224807 | 3300008263 | Freshwater, Plankton | MAGSRTLKLSILADVDDLKKNLAKGTDEVQTFGSKIADFGKKAGIAFAVAGALPLPM |
Ga0114349_11274633 | 3300008263 | Freshwater, Plankton | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKFGKVAAAAFAAAAAA |
Ga0114363_11705583 | 3300008266 | Freshwater, Plankton | MAEFRTLKLSILADVDNLKKQLGQGEKEVQTFGNKVAEFGKKAAL |
Ga0114878_11281731 | 3300008339 | Freshwater Lake | MASGSRTLKLSILADIDNLKKNLNQADNEVQGFGGKLEKFGKVAVAAFAAAAAAA |
Ga0102829_11911613 | 3300009026 | Estuarine | MAGQSRTLKLSILADVDQLKKSLNTGSNEVQSFGDK |
Ga0105098_100353721 | 3300009081 | Freshwater Sediment | MAERSRTLKLSILADVDKLKQSLNVGSKDVDGFAGK |
Ga0105103_109090171 | 3300009085 | Freshwater Sediment | MAGNRTLKLSILADVDDLNKKLKAANGDVEKSASGLEKFGKVAGAAFLAAAAAAGTYA |
Ga0115026_115187811 | 3300009111 | Wetland | MAGSRTLKLSILADVDDLKKKLDVGSKEVEGFGGK |
Ga0114918_105589061 | 3300009149 | Deep Subsurface | MAASRTLKLSLLADVAGLSKGLTQGSNEVQGFGGKVAD |
Ga0114968_103002373 | 3300009155 | Freshwater Lake | MAGNRTLKLSILADVDDLNKKLKAANGDVENSATGMEKFGKVASAAFAAA |
Ga0114975_107129222 | 3300009164 | Freshwater Lake | MVIMAGDSRTLKLSILADVDNLTKNLKKASTDTDNFGDKL |
Ga0105102_103692112 | 3300009165 | Freshwater Sediment | MAGNRTLKLSILADVDDLNKKLKAANGDVETSAGKLEKFGKVAGAAFL |
Ga0105097_104201001 | 3300009169 | Freshwater Sediment | MAGNRTLKLSILADVDDLNKKLKAANGDVETSAGKLEKFGKVAGA |
Ga0114979_105515023 | 3300009180 | Freshwater Lake | MAGSRTLKLSILADVDDLKKKLGQGSDEVEGFGGKL |
Ga0114974_104193873 | 3300009183 | Freshwater Lake | MAGQSRTLKLSILADVDELKKSLNVGSKDVDGFAGKIG |
Ga0129333_107334921 | 3300010354 | Freshwater To Marine Saline Gradient | MAGSRTLKLSILADVDDLKKNLKTGEKEVEGFGGKLEKFSKVAAAA |
Ga0129336_102532683 | 3300010370 | Freshwater To Marine Saline Gradient | MAGNRTLKLSILADVDNLKKNLDTGSKEVEGFGGKLEKFG |
Ga0129336_104012823 | 3300010370 | Freshwater To Marine Saline Gradient | MAGSRTLKLSILADVDQLKKNLDTGSKEVEGFGGKLEKFGKV |
Ga0129336_104036431 | 3300010370 | Freshwater To Marine Saline Gradient | MAGSRTLKLSILADVDNLKKNLDSGSKEVEGFGGKL |
Ga0136551_10223194 | 3300010388 | Pond Fresh Water | MAGNRTLKLSILADVDDLNKKLKAANGDVQDSATQLEKFGKVAGAAFLAAAAA |
Ga0133913_110157116 | 3300010885 | Freshwater Lake | MAGSRTLKLSILADVDDLKKKLNEGSNEVEGFGAKL |
Ga0151620_11620241 | 3300011268 | Freshwater | MAGSRTLKLSILADVDDLKKKLDVGSKEVEGFGGKLEKFGKVAAAAFAAAA |
Ga0153805_10267951 | 3300012013 | Surface Ice | MAGSRTLKLSILADIDNLKKNLNAGEKEVEGFGGKLEKFGKVAAAAF |
Ga0136712_10093213 | 3300012266 | Freshwater | MAGQGSRTLKLSILGDVDNLKKSLNSGATEVSSFGDKLGKFGKVAG |
Ga0157610_12439501 | 3300012725 | Freshwater | MATGNRTLKLSILADVDDLKKKLNEANGDVEVAATGMEK |
Ga0164293_102094644 | 3300013004 | Freshwater | MAGQSRTLKLSILADVDQLKKSLNTGSNEVQSFGDKIGNFGK |
Ga0164295_100403937 | 3300013014 | Freshwater | MAGSRTLKLSILADVDDLKKKLNQGSDEVEGFGSKLGKFGKVA |
(restricted) Ga0172364_105142183 | 3300013129 | Sediment | MAGNRTLKLSILADVDDLKKKLSQGEQEVKGFGDKLGAFGKKAAAAFA |
(restricted) Ga0172372_107768371 | 3300013132 | Freshwater | MAGSRTLKLSILADVDDLKKKLDTGSKEVEGFGGKLEKFGKI |
(restricted) Ga0172372_108116772 | 3300013132 | Freshwater | MATSRTLKLSILADVDDLRKKLSSGAQEVDGFATKLGDFGKKAAAAFAVAATAAA |
Ga0170791_109276951 | 3300013295 | Freshwater | MAAGSRTLKLSILADIDDLKKNLNAGQGEVQGFGDKVSDFGKKA |
Ga0177922_112559141 | 3300013372 | Freshwater | MAVGGSRTLKLSILADIDNLKKNLNSGSNEVEGFGSK |
Ga0181350_10175876 | 3300017716 | Freshwater Lake | MAAGTRTLKLSLLADVAGLSKGLDQGSKEVESFGSKVGDFGKKAGL |
Ga0181347_10793463 | 3300017722 | Freshwater Lake | MAVGGSRTLKLSILADIDNLKKNLNSGSNEVEGFGSKLGGFAKK |
Ga0181358_11109701 | 3300017774 | Freshwater Lake | MAGGSRTLKLSILADVDNLKKGLTEANTETEGFGGKLDG |
Ga0181358_12046742 | 3300017774 | Freshwater Lake | MAGSRTLKLSILADIDNLKKNLNAGEKEVEGFGGKLEKFGKVAAAAFAAAAAA |
Ga0181358_12759521 | 3300017774 | Freshwater Lake | MAGSRTLKLSILADVDNLKKGLTQGTDDVQTFGSKIADFGKKA |
Ga0181357_11786832 | 3300017777 | Freshwater Lake | MAGSRTLKLSILADIDNLKKNLNAGEKEVEGFGGKLE |
Ga0181346_12674671 | 3300017780 | Freshwater Lake | MAEGSRTLKLSILADVDSLKRGLTDAGDKTDSFGTKLL |
Ga0181355_13956152 | 3300017785 | Freshwater Lake | MAGSRTLKLSILADVDNLKKGLDNGSKDIATFGDKVSAFGKTAALAFAAAG |
Ga0181359_11839041 | 3300019784 | Freshwater Lake | MAGSRTLKLSILADVDNLKKNLDVGSKEVEGFGGKLEKF |
Ga0207193_10937532 | 3300020048 | Freshwater Lake Sediment | MASGSRTLKLSILADIDDLKKNLSNGSNDVQTFGDKLTKFGXXXXXXX |
Ga0211734_105404763 | 3300020159 | Freshwater | MAGSRTLKLSILADIDDLKKNLKAGDQEIQTFGGKLE |
Ga0211733_108969592 | 3300020160 | Freshwater | MAGQSRTLKLSILADIDDLKKKLTTGSAEVEGFGS |
Ga0211726_110445173 | 3300020161 | Freshwater | MAGSRTLKLSILADVDDLRKKLGTGSQEVEGFGSKVADFGKKAAAAFAVA |
Ga0211726_110809842 | 3300020161 | Freshwater | MALGGSRTLKLSILADIDNLKKNLTAGSGEVEGFGSKLGDF |
Ga0208232_10061516 | 3300020527 | Freshwater | MAGQSRTLKLSILADVDKLKQSLNVGSKDVDGFAGKIG |
Ga0208232_10315873 | 3300020527 | Freshwater | MAGQSRTLKLSILADVDKLKQSLNVGSKDVDGFAGKIGDF |
Ga0207942_10038751 | 3300020549 | Freshwater | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKFGK |
Ga0208465_10335332 | 3300020570 | Freshwater | MAGSRTLKLSILADVDDLKKKLGTAENEVQGFAGKVEKFGAAA |
Ga0213922_10922392 | 3300021956 | Freshwater | MAGNRTLKLSILADVDDLNKKLKAADGDVENSATNMEKFGKVAAA |
Ga0222713_104053223 | 3300021962 | Estuarine Water | MAGSRTLKLSILADVDDLKKNLNSGANEVEGFGGKLEKFGKVAAA |
Ga0212031_10532512 | 3300022176 | Aqueous | MAGSRTLKLSILADIDNLKKNLNSADKEIQGFGGKLADFV |
Ga0181354_11544571 | 3300022190 | Freshwater Lake | MAGSRTLKLSILADVDNLKKNLDVGSKEVEGFGGKLEKFGKIAA |
Ga0196901_11616983 | 3300022200 | Aqueous | MAGNRTLKLSILADIDSLKKNLTNADKEIKGFGNKLGDFAKKAGIAL |
Ga0181351_11699052 | 3300022407 | Freshwater Lake | MAAGSRTLKLSILADVDNLKKNLNAGSNDVQSFGDKVSDFGKKAG |
Ga0228703_10596023 | 3300022747 | Freshwater | MAGSRTLKLSILADVDDLKKKLNEGSNEVEGFGAKLEGFGKAAAA |
Ga0255178_10802192 | 3300024298 | Freshwater | MAGSRTLKLSILADVDDLRKKLGDGSNDVQTFGDKVSDFGAKAGLA |
Ga0244777_102379904 | 3300024343 | Estuarine | MALSGSRTLKLSILADIDNLKKNLDNGAKEVDGFGGKL |
Ga0244775_113105461 | 3300024346 | Estuarine | MAAGSRTLKLSILADVDNLKKGLTDAGDTTDSFGTKLS |
Ga0255266_10174221 | 3300024550 | Freshwater | MAGSRTLKLSILADVDDLKKKLDIGSNEVEGFGGKLEK |
Ga0256306_10250064 | 3300024560 | Freshwater | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKFGKVAAAAFAA |
Ga0255238_11538071 | 3300024568 | Freshwater | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKF |
Ga0255276_10288701 | 3300024570 | Freshwater | MAGSRTLKLSILADVDDLKKKLDIGSKEVEGFGGKLEK |
Ga0208546_11336821 | 3300025585 | Aqueous | MAGSRTLKLSILADVDDLRKKLTDSSNEVEGFGSK |
Ga0208004_10027251 | 3300025630 | Aqueous | MAGNRTLKLSILADVDDLKKKLGQGETEVSSFGDK |
Ga0208161_11430251 | 3300025646 | Aqueous | MAGNRTLKLSILADVDNLNKNLKLGGKDVDSFGAKLANFG |
Ga0208784_10739793 | 3300025732 | Aqueous | MAGSRTLKLSILADVDNLKKNLDTGSKEVEGFGGKLEKFGKVA |
Ga0208542_10533834 | 3300025818 | Aqueous | MAGSRTLKLSILADVDDLKKKLSTADNDVQGFAGQVEKF |
Ga0208916_101552561 | 3300025896 | Aqueous | MAGSRTLRLSILADVDDLKKKLDVGSKEVEGFGGKLEK |
Ga0255285_10147775 | 3300026562 | Freshwater | MAGSRTLKLSILADVDDLKKKLDIGSKEVEGFGGKLEKFGK |
Ga0255240_11232901 | 3300026568 | Freshwater | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEK |
Ga0255067_10361783 | 3300027129 | Freshwater | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLE |
Ga0255063_10281574 | 3300027151 | Freshwater | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKFGKV |
Ga0255083_10187421 | 3300027153 | Freshwater | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKFGKVAAAAFAAA |
Ga0255083_10614902 | 3300027153 | Freshwater | MAGSRTLKLSILADVDDLKKKLDVGSKEVEGFGGKLE |
Ga0255079_10768051 | 3300027601 | Freshwater | MAGSRTLKLSILADVDDLKKKLDVGSKEVEGFGGKLEKFGKVAAAAFA |
Ga0255079_11047151 | 3300027601 | Freshwater | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGK |
Ga0209033_11238233 | 3300027697 | Freshwater Lake | MAGSRTLKLSILADVDNLKKNLDVGSKEVEGFGGKLEKFGKVA |
Ga0209443_12323642 | 3300027707 | Freshwater Lake | MAAGSRTLKLSILAEVDNLKKNLNAGSNDVQSFGDKVSDFGKKAGLA |
Ga0209467_10634404 | 3300027719 | Freshwater | MAGNRTLKLSILADVDDLNKKLKAANGDVETSAGKLEKFG |
Ga0209492_12850101 | 3300027721 | Freshwater Sediment | MAGSRTLKLSILADVDDLNKKLKAANADVETSSEKISKFGKAAAAG |
Ga0209297_11042071 | 3300027733 | Freshwater Lake | MASGSRTLKLSILADVDQLKKSLNNGSDDVQGFGNKLDGFAGK |
Ga0209288_101096841 | 3300027762 | Freshwater Sediment | MAGSRTLKLSILADVDDLNKKLKAANADVETSSEKISKWGKAAAAGFALAGAAAI |
Ga0209246_102223271 | 3300027785 | Freshwater Lake | MAGNRTLKLSILADVDDLNKKLKAANGDVETSATGMEKFGK |
Ga0209246_103779011 | 3300027785 | Freshwater Lake | MAEGSRTLKLSILADVDNLKKGLTEANTETEGFGGKL |
Ga0209353_103047292 | 3300027798 | Freshwater Lake | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKFGKVAAAAFAAAA |
Ga0209354_103616691 | 3300027808 | Freshwater Lake | MAGNRTLKLSILADVDDLKKKLGQGEKEVQGFGDKLGE |
Ga0209491_103527324 | 3300027832 | Freshwater | VAAGSRTLKLSILADVDQLKKSLTGGAGDVQSFGDKIGKFGK |
Ga0209668_101528371 | 3300027899 | Freshwater Lake Sediment | MAAAGSRTLKLSILADIDDLKKNLNVGSTEVDSFGSKVTDFGKKAG |
Ga0209668_109927392 | 3300027899 | Freshwater Lake Sediment | MAGNRTLKLSILADVDDLKKKLNQGSDEVEGFGTKL |
Ga0209400_10443296 | 3300027963 | Freshwater Lake | MGDGSRTLKLSILADVDNLKKGLTQAGDDTDSFGTKLGGFGK |
Ga0209401_12468551 | 3300027971 | Freshwater Lake | MAIGGSRTLKLSILADIDNLKKNLDSGSNEVEGFGSKLGDF |
Ga0119944_10063685 | 3300029930 | Aquatic | MAGNRTLKLSILADVDDLKKKLDTGSKEVEGFGGKLEKFGKVAAAAFAAAAA |
Ga0119944_10068325 | 3300029930 | Aquatic | MAGSRTLKLSILADVDDLKKKLDVGANEVEGFGGKMEKFG |
Ga0307380_108068033 | 3300031539 | Soil | MAASRTLKLSLLADVAGLSKGLTQGSNEVQGFGGKVADFGKKAA |
Ga0307379_108109643 | 3300031565 | Soil | MAGSRTLKLSLLADVAGLSKGLNQGSNEVQSFGSKVGTFG |
Ga0307378_108516912 | 3300031566 | Soil | MAGSRTLKLSLLADVAGLSKGLNQGSNEVQSFGSKVGAFGKK |
Ga0315907_110777411 | 3300031758 | Freshwater | MAGSRTLKLSILADVDDLKKKLNAGATEVQGFGSKLG |
Ga0315288_100494601 | 3300031772 | Sediment | MAGTGSRTLKLSILGDIDNLKKNLDAGNKEVEGFGDKVGKFGKVA |
Ga0315899_108571011 | 3300031784 | Freshwater | MAGNRTLKLSILADVDDLNKKLKSGDDAVGASAEKMGKFGKVAAAAFVAVGAAA |
Ga0315900_105730101 | 3300031787 | Freshwater | MAGSRTLKLSILADVDNLKKNLDSGSKEVEGFGGKLEKFGKVAAAVFAAAA |
Ga0315900_106014571 | 3300031787 | Freshwater | MAGSRTLKLSILADIDNLTKNLNKGEVEVQTFGDKISKFDKIAGAAF |
Ga0315909_103212111 | 3300031857 | Freshwater | MAGSRTLKLSILADVDDLRKKLSAGSNEVEGFGSKVADFGKKAGL |
Ga0315285_104298533 | 3300031885 | Sediment | MAVGGSRTLKLSILADIDNLKKNLDSGSNEVEGFGGKLGGFAEKAGAAFAIAGA |
Ga0315904_100607071 | 3300031951 | Freshwater | MAGQSRTLKLSILADIDDLKKKLTTGSAEVEGFGSKLGDFSKKAG |
Ga0315901_106096743 | 3300031963 | Freshwater | MAGNRTLKLSILADVDDLNKKLKAANGDVEDSAGKLEKFGKVAG |
Ga0315901_108281191 | 3300031963 | Freshwater | MAEFRTLKLSILADVDNLKKQLGQGEKEVQTFGNKVAEFGKK |
Ga0315274_109325321 | 3300031999 | Sediment | MAEGSRTLKLSILADVDNLKKGLTEANTETEGFGGKLEGFGKK |
Ga0315289_109548462 | 3300032046 | Sediment | MAIGGSRTLKLSILADIDNLKKNLDAGSNEVEGFGGKLGG |
Ga0315289_113873672 | 3300032046 | Sediment | MAVGGSRTLKLSILADIDNLKKNLDSGSNEVEGFGGKLGGFA |
Ga0315902_110995201 | 3300032093 | Freshwater | MAGSRTLKLSILADVDDLRNKLGTASKETEGFGSKVGDF |
Ga0315903_108149893 | 3300032116 | Freshwater | MAEFRTLKLSILADVDNLKKQLGQGEKEVQGFGAKIAEF |
Ga0315268_116189402 | 3300032173 | Sediment | MATGSRTLKLSILADVDNLKKNLNAGSDDVQSFGDKVSEFGKKAGL |
Ga0315276_109774611 | 3300032177 | Sediment | MAVGGSRTLKLSILADIDNLKKNLNTGSNEVEGFGSKLGDFGKKAAA |
Ga0315286_111991002 | 3300032342 | Sediment | MAGTGSRTLKLSILADVDNLKKGLNTATAETDSFGDKLGGFAKK |
Ga0316619_119668981 | 3300033414 | Soil | MAGNRTLKLSILADVDDLKKKLDTGSKEVEGFGGKLEKFGKVAAAAFA |
Ga0316617_1017106131 | 3300033557 | Soil | MAGSRTLKLSILADVDDLKKKLGTAENEVQGFAGKVEKFGAAAKAAFVAAA |
Ga0334977_0289136_1_156 | 3300033978 | Freshwater | MAGSRTLKLSILADVDNLRKNLGEGSKDVESFGDKLGDFGKKAGAAFAVAAA |
Ga0334985_0077372_3_152 | 3300034018 | Freshwater | MALGGSRTLKLSILADIDNLKKNLTAGSGEVEGFGSKLGDFSKKAGLAFA |
Ga0334995_0526568_556_702 | 3300034062 | Freshwater | MAGTRTLKLSILADVDNLKKELKKGEQEVQGFGGKLEKFSAAAKAAFAA |
Ga0335020_0390656_506_646 | 3300034082 | Freshwater | MAGSRTLKLSILADVDDLKKKLNQGSDEVEGFGSKLGKFGKVAGLA |
Ga0335025_0523354_3_134 | 3300034096 | Freshwater | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKFGKVAA |
Ga0335031_0245994_1039_1188 | 3300034104 | Freshwater | MAGQSRTLKLSILADVDQLKKNLNTGSNEVEGFGSKLGGFAKKAGAAFAV |
Ga0335031_0802371_414_527 | 3300034104 | Freshwater | MAAGSRTLKLSILADVDNLKKSLNQGSDDVQGFGKKID |
Ga0335036_0799907_2_109 | 3300034106 | Freshwater | MAAGSRTLKLSILADVDNLKKNLNAGSNDVQSFGDK |
Ga0335051_0385052_3_131 | 3300034109 | Freshwater | MAGSRTLKLSILADVADLKKNLDTGSKEVEGFGGKLEKFGKVA |
Ga0335066_0418105_3_131 | 3300034112 | Freshwater | MAGQSRTLKLSILGDVDQLKKSLDTGTKEVDGFAGKLGGFAKK |
Ga0335007_0535998_580_693 | 3300034283 | Freshwater | MATGNRTLKLSILADVDELKKSLKTGETEVKGFSDKVG |
Ga0335048_0176343_1_132 | 3300034356 | Freshwater | MAGNRTLKLSILADVDDLNKKLKSANNDVETSAGKLEKFGKVAG |
⦗Top⦘ |