Metagenome / Metatranscriptome Family F039029

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F039029
Family Type	Metagenome / Metatranscriptome
Number of Sequences	164
Average Sequence Length	42 residues
Representative Sequence	MKMQILVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEG
Number of Associated Samples	86
Number of Associated Scaffolds	164

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	16.25 %
% of genes near scaffold ends (potentially truncated)	50.61 %
% of genes from short scaffolds (< 2000 bps)	72.56 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (82.317 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (28.658 % of family members)
Environment Ontology (ENVO)	Unclassified (28.659 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Sediment (non-saline) (28.659 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 14.29% β-sheet: 0.00% Coil/Unstructured: 85.71%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.22
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 164 Family Scaffolds
PF09084	NMT1	4.88
PF01977	UbiD	3.66
PF00892	EamA	2.44
PF00501	AMP-binding	1.83
PF01738	DLH	1.83
PF16868	NMT1_3	1.83
PF12367	PFO_beta_C	1.83
PF04909	Amidohydro_2	1.83
PF01374	Glyco_hydro_46	1.83
PF07690	MFS_1	1.83
PF00689	Cation_ATPase_C	1.83
PF06240	COXG	1.83
PF00072	Response_reg	1.22
PF13030	DUF3891	1.22
PF03976	PPK2	1.22
PF02627	CMD	1.22
PF00206	Lyase_1	1.22
PF01321	Creatinase_N	1.22
PF13379	NMT1_2	1.22
PF13602	ADH_zinc_N_2	1.22
PF00903	Glyoxalase	1.22
PF03176	MMPL	1.22
PF08402	TOBE_2	1.22
PF00694	Aconitase_C	1.22
PF03972	MmgE_PrpD	1.22
PF01568	Molydop_binding	1.22
PF07355	GRDB	1.22
PF13343	SBP_bac_6	1.22
PF03401	TctC	0.61
PF00106	adh_short	0.61
PF00496	SBP_bac_5	0.61
PF00994	MoCF_biosynth	0.61
PF13458	Peripla_BP_6	0.61
PF08281	Sigma70_r4_2	0.61
PF02775	TPP_enzyme_C	0.61
PF01596	Methyltransf_3	0.61
PF01042	Ribonuc_L-PSP	0.61
PF13472	Lipase_GDSL_2	0.61
PF04452	Methyltrans_RNA	0.61
PF00255	GSHPx	0.61
PF02615	Ldh_2	0.61
PF13247	Fer4_11	0.61
PF13549	ATP-grasp_5	0.61
PF07007	LprI	0.61
PF07992	Pyr_redox_2	0.61
PF00596	Aldolase_II	0.61
PF01717	Meth_synt_2	0.61
PF13714	PEP_mutase	0.61
PF01300	Sua5_yciO_yrdC	0.61
PF00005	ABC_tran	0.61
PF00355	Rieske	0.61
PF01850	PIN	0.61
PF00528	BPD_transp_1	0.61
PF00248	Aldo_ket_red	0.61
PF13671	AAA_33	0.61
PF02776	TPP_enzyme_N	0.61
PF13416	SBP_bac_8	0.61
PF00296	Bac_luciferase	0.61
PF09619	YscW	0.61
PF10099	RskA	0.61
PF00701	DHDPS	0.61
PF13673	Acetyltransf_10	0.61
PF00529	CusB_dom_1	0.61
PF13649	Methyltransf_25	0.61
PF00768	Peptidase_S11	0.61
PF02738	MoCoBD_1	0.61
PF09865	DUF2092	0.61
PF07883	Cupin_2	0.61
PF00881	Nitroreductase	0.61
PF12697	Abhydrolase_6	0.61
PF00254	FKBP_C	0.61
PF01244	Peptidase_M19	0.61
PF00171	Aldedh	0.61
PF00510	COX3	0.61
PF01425	Amidase	0.61
PF12833	HTH_18	0.61

COG ID	Name	Functional Category	% Frequency in 164 Family Scaffolds
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	4.88
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	4.88
COG0043	3-polyprenyl-4-hydroxybenzoate decarboxylase	Coenzyme transport and metabolism [H]	3.66
COG0474	Magnesium-transporting ATPase (P-type)	Inorganic ion transport and metabolism [P]	1.83
COG3427	Carbon monoxide dehydrogenase subunit CoxG	Energy production and conversion [C]	1.83
COG0006	Xaa-Pro aminopeptidase	Amino acid transport and metabolism [E]	1.22
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	1.22
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	1.22
COG1033	Predicted exporter protein, RND superfamily	General function prediction only [R]	1.22
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	1.22
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	1.22
COG2326	Polyphosphate kinase 2, PPK2 family	Energy production and conversion [C]	1.22
COG2409	Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily	General function prediction only [R]	1.22
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.61
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.61
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.61
COG0386	Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides	Defense mechanisms [V]	0.61
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	0.61
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.61
COG1385	16S rRNA U1498 N3-methylase RsmE	Translation, ribosomal structure and biogenesis [J]	0.61
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.61
COG1845	Heme/copper-type cytochrome/quinol oxidase, subunit 3	Energy production and conversion [C]	0.61
COG2055	Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family	Energy production and conversion [C]	0.61
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.61
COG2355	Zn-dependent dipeptidase, microsomal dipeptidase homolog	Posttranslational modification, protein turnover, chaperones [O]	0.61
COG2518	Protein-L-isoaspartate O-methyltransferase	Posttranslational modification, protein turnover, chaperones [O]	0.61
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.61
COG3755	Uncharacterized conserved protein YecT, DUF1311 family	Function unknown [S]	0.61
COG4122	tRNA 5-hydroxyU34 O-methylase TrmR/YrrM	Translation, ribosomal structure and biogenesis [J]	0.61
COG4123	tRNA1(Val) A37 N6-methylase TrmN6	Translation, ribosomal structure and biogenesis [J]	0.61
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.61

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.93 %
Unclassified	root	N/A	17.07 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	82.93 %
Unclassified	root	N/A	17.07 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	82.32 %
Unclassified	root	N/A	17.07 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.61 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	38.41 %
Unclassified	root	N/A	17.07 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	3.66 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.22 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	1.22 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.61 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.61 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.61 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	25.61 %
Unclassified	root	N/A	17.07 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3.05 %
unclassified Nitrospirae	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae	1.22 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.22 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.22 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.22 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.83 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.61 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.61 %
Stramenopiles	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles	0.61 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.61 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	25.61 %
Unclassified	root	N/A	17.07 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	1.22 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	1.22 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.22 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.61 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.61 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.61 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.61 %
Oomycota	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota	0.61 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.61 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	0.61 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.61 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.61 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	20.12 %
Unclassified	root	N/A	17.07 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	1.22 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.22 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.61 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	0.61 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.61 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.61 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.61 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.61 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.61 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	0.61 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.61 %
Oomycota	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota	0.61 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.61 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	20.12 %
Unclassified	root	N/A	17.07 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.22 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.61 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.61 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.61 %
Variovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax	0.61 %
Methylobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter	0.61 %
Paenibacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae	0.61 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.61 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.61 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	0.61 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.61 %
Oomycota	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota	0.61 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.61 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	20.12 %
Unclassified	root	N/A	17.07 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.22 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.61 %
unclassified Variovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax	0.61 %
Methylobacter tundripaludum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter tundripaludum	0.61 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.61 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.61 %
Paenibacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae	0.61 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.61 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.61 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	0.61 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.61 %
Oomycota	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota	0.61 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.61 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	20.12 %
Unclassified	root	N/A	17.07 %
Nitrospirae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1.22 %
Variovorax sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp.	0.61 %
Candidatus Solibacter usitatus Ellin6076	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	0.61 %
Methylobacter tundripaludum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter tundripaludum	0.61 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.61 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.61 %
Paenibacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae	0.61 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.61 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.61 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	0.61 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.61 %
Oomycota	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota	0.61 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.61 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000579\|AP72_2010_repI_A01DRAFT_1075078	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1002897	All Organisms → cellular organisms → Bacteria	2770	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1005407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2069	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1062549	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10002924	All Organisms → cellular organisms → Bacteria	4581	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1015386	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1455	Open in IMG/M
3300000793\|AF_2010_repII_A001DRAFT_10070962	All Organisms → cellular organisms → Bacteria	752	Open in IMG/M
3300000793\|AF_2010_repII_A001DRAFT_10132743	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	519	Open in IMG/M
3300000837\|AP72_2010_repI_A100DRAFT_1009497	All Organisms → cellular organisms → Bacteria	1373	Open in IMG/M
3300000955\|JGI1027J12803_101248173	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300003987\|Ga0055471_10233949	Not Available	580	Open in IMG/M
3300004145\|Ga0055489_10205099	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300004268\|Ga0066398_10003061	All Organisms → cellular organisms → Bacteria	1854	Open in IMG/M
3300004268\|Ga0066398_10188933	Not Available	538	Open in IMG/M
3300004633\|Ga0066395_10002766	All Organisms → cellular organisms → Bacteria → Proteobacteria	6056	Open in IMG/M
3300004633\|Ga0066395_10290629	All Organisms → cellular organisms → Bacteria	890	Open in IMG/M
3300005093\|Ga0062594_100352682	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1157	Open in IMG/M
3300005289\|Ga0065704_10498596	Not Available	622	Open in IMG/M
3300005295\|Ga0065707_10802214	Not Available	599	Open in IMG/M
3300005332\|Ga0066388_104572567	All Organisms → cellular organisms → Bacteria → Proteobacteria	704	Open in IMG/M
3300005332\|Ga0066388_105199042	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300005332\|Ga0066388_107813146	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	535	Open in IMG/M
3300005332\|Ga0066388_108229072	Not Available	520	Open in IMG/M
3300005363\|Ga0008090_15422122	All Organisms → cellular organisms → Bacteria	1223	Open in IMG/M
3300005447\|Ga0066689_10752127	All Organisms → cellular organisms → Bacteria	608	Open in IMG/M
3300005536\|Ga0070697_101462375	All Organisms → cellular organisms → Bacteria	610	Open in IMG/M
3300005713\|Ga0066905_100710869	All Organisms → cellular organisms → Bacteria	863	Open in IMG/M
3300005713\|Ga0066905_101063706	All Organisms → cellular organisms → Bacteria	717	Open in IMG/M
3300005719\|Ga0068861_101639781	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	635	Open in IMG/M
3300005764\|Ga0066903_100762570	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1721	Open in IMG/M
3300005937\|Ga0081455_10004395	All Organisms → cellular organisms → Bacteria	15848	Open in IMG/M
3300005937\|Ga0081455_10275346	All Organisms → cellular organisms → Bacteria	1218	Open in IMG/M
3300005981\|Ga0081538_10037307	All Organisms → cellular organisms → Bacteria	3155	Open in IMG/M
3300005981\|Ga0081538_10051592	All Organisms → cellular organisms → Bacteria	2468	Open in IMG/M
3300005981\|Ga0081538_10078272	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1775	Open in IMG/M
3300006852\|Ga0075433_10298764	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1426	Open in IMG/M
3300006865\|Ga0073934_10032789	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4940	Open in IMG/M
3300006871\|Ga0075434_100907453	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	896	Open in IMG/M
3300006871\|Ga0075434_101242029	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300006871\|Ga0075434_101566516	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	668	Open in IMG/M
3300006904\|Ga0075424_100158281	All Organisms → cellular organisms → Bacteria	2400	Open in IMG/M
3300006904\|Ga0075424_100167384	All Organisms → cellular organisms → Bacteria	2331	Open in IMG/M
3300007076\|Ga0075435_101730608	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	549	Open in IMG/M
3300009081\|Ga0105098_10018828	All Organisms → cellular organisms → Bacteria	2622	Open in IMG/M
3300009081\|Ga0105098_10034413	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2005	Open in IMG/M
3300009081\|Ga0105098_10104810	All Organisms → cellular organisms → Bacteria	1225	Open in IMG/M
3300009081\|Ga0105098_10313083	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300009081\|Ga0105098_10484425	Not Available	628	Open in IMG/M
3300009157\|Ga0105092_10005422	All Organisms → cellular organisms → Bacteria → Proteobacteria	6755	Open in IMG/M
3300009157\|Ga0105092_10009226	All Organisms → cellular organisms → Bacteria	5171	Open in IMG/M
3300009157\|Ga0105092_10009247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5164	Open in IMG/M
3300009157\|Ga0105092_10013063	All Organisms → cellular organisms → Bacteria → Proteobacteria	4361	Open in IMG/M
3300009157\|Ga0105092_10016853	All Organisms → cellular organisms → Bacteria → Proteobacteria	3845	Open in IMG/M
3300009157\|Ga0105092_10055717	All Organisms → cellular organisms → Bacteria	2127	Open in IMG/M
3300009157\|Ga0105092_10058353	All Organisms → cellular organisms → Bacteria → Proteobacteria	2078	Open in IMG/M
3300009157\|Ga0105092_10064173	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1983	Open in IMG/M
3300009157\|Ga0105092_10066850	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1944	Open in IMG/M
3300009157\|Ga0105092_10131309	All Organisms → cellular organisms → Bacteria	1385	Open in IMG/M
3300009157\|Ga0105092_10151069	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1290	Open in IMG/M
3300009157\|Ga0105092_10156460	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1267	Open in IMG/M
3300009157\|Ga0105092_10202554	All Organisms → cellular organisms → Bacteria	1109	Open in IMG/M
3300009157\|Ga0105092_10237878	All Organisms → cellular organisms → Bacteria	1022	Open in IMG/M
3300009157\|Ga0105092_10238104	Not Available	1021	Open in IMG/M
3300009157\|Ga0105092_10293718	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp.	916	Open in IMG/M
3300009157\|Ga0105092_10388134	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	794	Open in IMG/M
3300009157\|Ga0105092_10400617	All Organisms → cellular organisms → Bacteria	781	Open in IMG/M
3300009157\|Ga0105092_10593689	Not Available	639	Open in IMG/M
3300009157\|Ga0105092_10613310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter tundripaludum	629	Open in IMG/M
3300009157\|Ga0105092_10626560	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300009157\|Ga0105092_10657969	Not Available	607	Open in IMG/M
3300009157\|Ga0105092_10734429	Not Available	576	Open in IMG/M
3300009157\|Ga0105092_10751545	Not Available	569	Open in IMG/M
3300009162\|Ga0075423_12539058	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota	559	Open in IMG/M
3300009162\|Ga0075423_12911531	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	524	Open in IMG/M
3300009168\|Ga0105104_10062803	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2011	Open in IMG/M
3300009168\|Ga0105104_10574683	Not Available	639	Open in IMG/M
3300009792\|Ga0126374_11296403	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300009817\|Ga0105062_1128086	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	519	Open in IMG/M
3300009818\|Ga0105072_1002756	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2807	Open in IMG/M
3300009818\|Ga0105072_1021979	All Organisms → cellular organisms → Bacteria	1166	Open in IMG/M
3300009818\|Ga0105072_1025768	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1083	Open in IMG/M
3300009822\|Ga0105066_1127319	Not Available	575	Open in IMG/M
3300009836\|Ga0105068_1008444	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1644	Open in IMG/M
3300009837\|Ga0105058_1002038	All Organisms → cellular organisms → Bacteria	3356	Open in IMG/M
3300009837\|Ga0105058_1004137	Not Available	2609	Open in IMG/M
3300010043\|Ga0126380_12019083	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	528	Open in IMG/M
3300010046\|Ga0126384_10003812	All Organisms → cellular organisms → Bacteria	9187	Open in IMG/M
3300010046\|Ga0126384_10179297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1658	Open in IMG/M
3300010046\|Ga0126384_10941055	All Organisms → cellular organisms → Bacteria → Acidobacteria	783	Open in IMG/M
3300010046\|Ga0126384_11009931	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300010048\|Ga0126373_10007950	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	8389	Open in IMG/M
3300010048\|Ga0126373_12105379	Not Available	626	Open in IMG/M
3300010359\|Ga0126376_10002085	All Organisms → cellular organisms → Bacteria	11191	Open in IMG/M
3300010362\|Ga0126377_10152175	All Organisms → cellular organisms → Bacteria → Proteobacteria	2174	Open in IMG/M
3300012948\|Ga0126375_10421352	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	971	Open in IMG/M
3300012961\|Ga0164302_11232565	Not Available	600	Open in IMG/M
3300012971\|Ga0126369_10189935	All Organisms → cellular organisms → Bacteria → Proteobacteria	1971	Open in IMG/M
3300013307\|Ga0157372_11871045	Not Available	690	Open in IMG/M
3300014255\|Ga0075320_1019900	All Organisms → cellular organisms → Bacteria	1086	Open in IMG/M
3300014255\|Ga0075320_1034749	All Organisms → cellular organisms → Bacteria	866	Open in IMG/M
3300014877\|Ga0180074_1025674	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1171	Open in IMG/M
3300015258\|Ga0180093_1027091	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1210	Open in IMG/M
3300017966\|Ga0187776_10412253	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	906	Open in IMG/M
3300018051\|Ga0184620_10141371	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	773	Open in IMG/M
3300018084\|Ga0184629_10320451	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	816	Open in IMG/M
3300018084\|Ga0184629_10557067	Not Available	590	Open in IMG/M
3300018084\|Ga0184629_10658740	Not Available	530	Open in IMG/M
3300018465\|Ga0190269_10580683	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	752	Open in IMG/M
3300021081\|Ga0210379_10088582	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1277	Open in IMG/M
3300021178\|Ga0210408_10988336	All Organisms → cellular organisms → Bacteria	652	Open in IMG/M
3300021560\|Ga0126371_10013336	All Organisms → cellular organisms → Bacteria	7459	Open in IMG/M
3300025324\|Ga0209640_10234788	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1550	Open in IMG/M
3300025324\|Ga0209640_10389285	All Organisms → cellular organisms → Bacteria	1152	Open in IMG/M
3300025324\|Ga0209640_11061017	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	620	Open in IMG/M
3300025908\|Ga0207643_11040520	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	529	Open in IMG/M
3300025910\|Ga0207684_10752720	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	826	Open in IMG/M
3300026037\|Ga0208655_1018167	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300027379\|Ga0209842_1000132	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	12783	Open in IMG/M
3300027490\|Ga0209899_1014973	All Organisms → cellular organisms → Bacteria	1761	Open in IMG/M
3300027646\|Ga0209466_1004378	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2954	Open in IMG/M
3300027650\|Ga0256866_1118134	All Organisms → cellular organisms → Bacteria	718	Open in IMG/M
3300027722\|Ga0209819_10000644	All Organisms → cellular organisms → Bacteria → Proteobacteria	10337	Open in IMG/M
3300027722\|Ga0209819_10003006	All Organisms → cellular organisms → Bacteria → Proteobacteria	5336	Open in IMG/M
3300027722\|Ga0209819_10003290	All Organisms → cellular organisms → Bacteria	5135	Open in IMG/M
3300027722\|Ga0209819_10003306	All Organisms → cellular organisms → Bacteria	5122	Open in IMG/M
3300027722\|Ga0209819_10005957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	3893	Open in IMG/M
3300027722\|Ga0209819_10014114	All Organisms → cellular organisms → Bacteria	2611	Open in IMG/M
3300027722\|Ga0209819_10014880	All Organisms → cellular organisms → Bacteria	2545	Open in IMG/M
3300027722\|Ga0209819_10022288	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2109	Open in IMG/M
3300027722\|Ga0209819_10041854	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1565	Open in IMG/M
3300027722\|Ga0209819_10045020	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1510	Open in IMG/M
3300027722\|Ga0209819_10061095	All Organisms → cellular organisms → Bacteria	1299	Open in IMG/M
3300027722\|Ga0209819_10075467	All Organisms → cellular organisms → Bacteria	1170	Open in IMG/M
3300027722\|Ga0209819_10085432	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1099	Open in IMG/M
3300027722\|Ga0209819_10168506	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	766	Open in IMG/M
3300027722\|Ga0209819_10180361	All Organisms → cellular organisms → Bacteria	738	Open in IMG/M
3300027874\|Ga0209465_10126038	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1264	Open in IMG/M
3300027909\|Ga0209382_11209601	Not Available	772	Open in IMG/M
3300027952\|Ga0209889_1057185	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	810	Open in IMG/M
3300027956\|Ga0209820_1083808	All Organisms → cellular organisms → Bacteria	860	Open in IMG/M
3300030620\|Ga0302046_10747022	All Organisms → cellular organisms → Bacteria	790	Open in IMG/M
3300031231\|Ga0170824_113970003	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	605	Open in IMG/M
3300031720\|Ga0307469_10007700	All Organisms → cellular organisms → Bacteria	5020	Open in IMG/M
3300031720\|Ga0307469_12215977	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	535	Open in IMG/M
3300031740\|Ga0307468_100424628	All Organisms → cellular organisms → Bacteria → Proteobacteria	1025	Open in IMG/M
3300031740\|Ga0307468_101616423	All Organisms → cellular organisms → Bacteria → Proteobacteria	606	Open in IMG/M
3300031740\|Ga0307468_102082941	Not Available	546	Open in IMG/M
3300031820\|Ga0307473_10358935	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	940	Open in IMG/M
3300031965\|Ga0326597_11926200	Not Available	550	Open in IMG/M
3300032180\|Ga0307471_100708469	All Organisms → cellular organisms → Bacteria	1171	Open in IMG/M
3300032180\|Ga0307471_100857512	All Organisms → cellular organisms → Bacteria	1075	Open in IMG/M
3300032205\|Ga0307472_100909608	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	815	Open in IMG/M
3300032782\|Ga0335082_10028880	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	5898	Open in IMG/M
3300032892\|Ga0335081_10310083	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae	2084	Open in IMG/M
3300032892\|Ga0335081_11242303	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	846	Open in IMG/M
3300033004\|Ga0335084_11554014	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	653	Open in IMG/M
3300033004\|Ga0335084_12107631	All Organisms → cellular organisms → Bacteria → Acidobacteria	548	Open in IMG/M
3300033417\|Ga0214471_10914774	Not Available	679	Open in IMG/M
3300034151\|Ga0364935_0304414	Not Available	526	Open in IMG/M
3300034257\|Ga0370495_0205505	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	88.41%
Host-Associated	Host-Associated	11.59%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	53.66%
Aquatic	Environmental → Aquatic	34.76%
Plants	Host-Associated → Plants	11.59%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	53.05%
Freshwater	Environmental → Aquatic → Freshwater	29.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.71%
Sediment	Environmental → Aquatic → Sediment	3.66%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.05%
Roots	Host-Associated → Plants → Roots	1.83%
Marine	Environmental → Aquatic → Marine	1.22%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.61%
Floodplain	Environmental → Terrestrial → Floodplain	0.61%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Sediment	29.27%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	28.05%
Loam	Environmental → Terrestrial → Soil → Loam	12.20%
Sand	Environmental → Terrestrial → Soil → Sand	6.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.71%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.10%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.66%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.44%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.83%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.22%
Sediment	Environmental → Aquatic → Thermal Springs → Sediment	0.61%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	29.27%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.80%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	12.20%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.93%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	6.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.71%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.10%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.44%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.44%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	1.83%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	1.83%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.22%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.22%
Unclassified	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified	0.61%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.61%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.61%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.61%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	28.66%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.54%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	7.93%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	6.71%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	6.10%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.10%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	5.49%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.05%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.05%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.44%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.44%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.83%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	1.83%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere	1.83%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.22%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.22%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.22%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.22%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.22%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.61%
Hot Spring Sediment	Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment	0.61%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.61%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.61%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.61%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.61%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.61%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.61%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000579	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01	Environmental	Open in IMG/M
3300000580	Forest soil microbial communities from Amazon forest - 2010 replicate II A01	Environmental	Open in IMG/M
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300000793	Forest soil microbial communities from Amazon forest - 2010 replicate II A001	Environmental	Open in IMG/M
3300000837	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300003987	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2	Environmental	Open in IMG/M
3300004145	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2	Environmental	Open in IMG/M
3300004268	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006865	Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009817	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20	Environmental	Open in IMG/M
3300009818	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40	Environmental	Open in IMG/M
3300009822	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40	Environmental	Open in IMG/M
3300009836	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20	Environmental	Open in IMG/M
3300009837	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014255	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2	Environmental	Open in IMG/M
3300014877	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D	Environmental	Open in IMG/M
3300015258	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026037	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300027379	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)	Environmental	Open in IMG/M
3300027490	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes)	Environmental	Open in IMG/M
3300027646	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027650	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq	Environmental	Open in IMG/M
3300027722	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027952	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)	Environmental	Open in IMG/M
3300027956	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300030620	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033417	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155	Environmental	Open in IMG/M
3300034151	Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17	Environmental	Open in IMG/M
3300034257	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
AP72_2010_repI_A01DRAFT_10750782	3300000579	Forest Soil	MPAWIAGIQIRKDASGNIHVNLDSSASCWNDAIDGPLLEVT
AF_2010_repII_A01DRAFT_10028971	3300000580	Forest Soil	RIAGIQARKEASGDIHVNPDSSTPCWNDAIDGFS*
AF_2010_repII_A01DRAFT_10054073	3300000580	Forest Soil	PAWIAGIQTRKDPSGNIHVNLDSSTPCWNDTIEWPLLQNE*
AF_2010_repII_A01DRAFT_10625492	3300000580	Forest Soil	MKKQFSVMPAWIAGIQVRTDASGDIHVSLDSSTPCWNDAIKGLYLT*
AF_2010_repII_A1DRAFT_100029244	3300000597	Forest Soil	MKNPIFVMPARIAGIQARKEASGDIHVNPDSSTPCWNDAIDGFS*
AF_2010_repII_A100DRAFT_10153861	3300000655	Forest Soil	AAWIAGIQVRKDASADIHVSLDSSTPCWNDTIEELY*
AF_2010_repII_A001DRAFT_100709622	3300000793	Forest Soil	MKKQFSVMPAWIAGIQVRTDASGDIHVSLDSSTPCWNDXIKGLYLT*
AF_2010_repII_A001DRAFT_101327431	3300000793	Forest Soil	MFVMPAWIAGIQIRRMLPRDIHVSLGSSTPCWNDAIKELY*
AP72_2010_repI_A100DRAFT_10094972	3300000837	Forest Soil	MPAWIAGIQIRKDASGDIHVNLDSSTPCWNDDME*
JGI1027J12803_1012481732	3300000955	Soil	MPAWIAGIPVRKDASGNNHVNLDSSTPCWNDANRG
Ga0055471_102339492	3300003987	Natural And Restored Wetlands	MKIESTVMPAWMAGIQARKDASGNVHVNLDSSTPCWNDAI
Ga0055489_102050992	3300004145	Natural And Restored Wetlands	FTNYENEDPVMPAWIAGIQSSQHASEDIHVGLDSSTPCWNDAIEGFYLN*
Ga0066398_100030611	3300004268	Tropical Forest Soil	MKNSNFVMPAWIAGIQIRKDASGNIHVNLDSSAPCWNDAI
Ga0066398_101889331	3300004268	Tropical Forest Soil	VIPAWIAGIQVRKDASEDVHVTLDSSNPCWNDTIKGLYLT*
Ga0066395_100027668	3300004633	Tropical Forest Soil	MEICVMPAWIAGIQVRKGASGNIHVTRDSSTPCWNDTVEELY*
Ga0066395_102906292	3300004633	Tropical Forest Soil	MKMQIFVMPAWMAGIQLREDASGDIHVNLDSSAPCWNDPLKGSA*
Ga0062594_1003526823	3300005093	Soil	MKMQIFVMPAWIAGIQARKDAPDTSIVNLDSSTPCWNDVIEGFCWN*
Ga0065704_104985961	3300005289	Switchgrass Rhizosphere	MQIIVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEGFCLN*
Ga0065707_108022141	3300005295	Switchgrass Rhizosphere	MKMQSFVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDVIEGFYLN*
Ga0066388_1045725672	3300005332	Tropical Forest Soil	MKMQIFVMPAWMAGIQLREDASGDIRVNLDSSAPCWNDPLKGSA*
Ga0066388_1051990421	3300005332	Tropical Forest Soil	MENVIFVMPALIASIQVHKDASGNIHVNLDSSTPCWNDVIEGS*
Ga0066388_1078131462	3300005332	Tropical Forest Soil	MKMQIFVMPAWMAGIQLREDASGDVHVNLDSSAPCWNDPLKGSA*
Ga0066388_1082290722	3300005332	Tropical Forest Soil	VMPAWMAGIQVRKDASGDIHVSLDSSTPCWNDAIEDVLQD*
Ga0008090_154221222	3300005363	Tropical Rainforest Soil	MKMRVFVMPAWMAGIQVRKDASGDIHVSLDSSTPCWNDAIEGVLRD*
Ga0070708_1006466592	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MPAWIAGIQGGKDASVDIHVSLDSTTPCWNDALEKVSACSDRTLNA*
Ga0066689_107521271	3300005447	Soil	MKMQSFVMPAWIAGIQVRKDAFGTSMQLDSSTPCWNDVIEGFCLN
Ga0070706_1007055722	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MPCPFTRLQNLKMQIFVMPAWIAGIQARKDAYGDIRVNLDSSTPCWNDAIFTFFYD*
Ga0070697_1014623752	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MEIFVMPAWIAGISSQDAFGDIPVSLDSSTPCWNDAIEE*
Ga0066905_1007108692	3300005713	Tropical Forest Soil	MINQRMKMEILVMPARVVGNQVRKDASGNIQVNLDSSTPSWNGAMKGSV*
Ga0066905_1010637061	3300005713	Tropical Forest Soil	IFVMPAWIAGIQVRKDASGDIHVSLDSSTPCWNDQLKGGLN*
Ga0068861_1016397812	3300005719	Switchgrass Rhizosphere	MKMQIFVMAAWIAGIQARKDAPDTSIVNLDSSTPCWNDVIEGFCWN*
Ga0066903_1007625701	3300005764	Tropical Forest Soil	MQIFVMPAWIGGIRIRKDDSQDIHVSLDSSTPCWNDAIKKLY*
Ga0081455_1000439512	3300005937	Tabebuia Heterophylla Rhizosphere	MENVIFVMPALIAGIEVHKDASGNVHVNLDSSTPCWNDVIEGS*
Ga0081455_102753462	3300005937	Tabebuia Heterophylla Rhizosphere	MKMQIILMPAWMAGIQSRKDASGNIHVKLDSSTPCWNDQLKGSA*
Ga0081538_100373072	3300005981	Tabebuia Heterophylla Rhizosphere	MKMESFVMPAWMAGIPVSQDASEDVHVGLDSSTPCWNDAMEELYQD*
Ga0081538_100515923	3300005981	Tabebuia Heterophylla Rhizosphere	MKTRMIVMPAWIAGIQIRKDAYRDIHVDLDSSPPCWNDAIEVLCWT*
Ga0081538_100782722	3300005981	Tabebuia Heterophylla Rhizosphere	MQITVMPAWMAGIQIREDASGNVHVNLDSSTPCWNDVIKRFFN*
Ga0075433_102987642	3300006852	Populus Rhizosphere	MKMQIFVMLAWIAGIQVCKDASGNIHVSLDSSTPCWNDAVEGF*
Ga0073934_100327892	3300006865	Hot Spring Sediment	MKMQIIVMPAWIAGMQVRKDASGDIHVNLDSSIPRWNDAIEGAA*
Ga0075434_1009074532	3300006871	Populus Rhizosphere	MPEWIAGIQVHEDASGDIHVSLDSSTPCWNDAIWGA
Ga0075434_1012420291	3300006871	Populus Rhizosphere	MKMVILVMPAWIAGIHQVRKDASGDVHVGLDSSAPCWNDG
Ga0075434_1015665162	3300006871	Populus Rhizosphere	FVMPAWIAGIQIRKDASGHVHANLDSSTPCWNDAIETSPL*
Ga0075424_1001582811	3300006904	Populus Rhizosphere	MPAWIAGIHQVRKDASEDIHVNLDSSTPCWNDAIE
Ga0075424_1001673841	3300006904	Populus Rhizosphere	MPAWIAGTHQVRKDASGNVHVGLDSSAPCWNDGIE
Ga0075435_1017306082	3300007076	Populus Rhizosphere	VMPAWIAGIQIRKDASGHVHANLDSSTPCWNDAIETSPL*
Ga0105098_100188282	3300009081	Freshwater Sediment	MQIIVMPAWIAGIQIRKDASGDVHVNLDSSAPCWNDGIEGSA*
Ga0105098_100344132	3300009081	Freshwater Sediment	MKMESFVMPAWMAGIQVRMDASGHIHVGLDSSTPCWNDGIEESYQD*
Ga0105098_101048101	3300009081	Freshwater Sediment	MEIEITVMPAWMAGNQARKDASGNVHVDLDSSAPC
Ga0105098_103130831	3300009081	Freshwater Sediment	MPAWIAGIQVCKDASGNIHVNLDSSTPYWNDAIEWGSALN*
Ga0105098_104844252	3300009081	Freshwater Sediment	MKMQIVVMPVWMAGTQVRKDASEDIHVNLDSSTPCWNDESRGSA*
Ga0105092_100054227	3300009157	Freshwater Sediment	MHMFVMPAWMAGIQARKDASGDIRVGLDSSTPCWNDAIGGFYLN*
Ga0105092_100092265	3300009157	Freshwater Sediment	MKMQIVVMPAWIAGTQVRKDASGDIRAGLDSSTPCWNDGIEGFCLK*
Ga0105092_100092473	3300009157	Freshwater Sediment	MEIFVMPAWIAGIQVRKDASGDIHVNLDSSTPCWNDVIEGFCLS*
Ga0105092_100130636	3300009157	Freshwater Sediment	MQTSVMPAWMAGIQVRKDASGNVHVSLDSSAPCWNDTIEGSA*
Ga0105092_100168535	3300009157	Freshwater Sediment	MKKQILVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDGIEVFCLN*
Ga0105092_100557172	3300009157	Freshwater Sediment	MKMQIVVMPAWMAGTQVRKDASEDIHVNLDSSTPCWNDESRGSA*
Ga0105092_100583532	3300009157	Freshwater Sediment	MKMQITVMPAGMAGIQIRKDASGNVHVNLDSSIPCWNGVIERFFN*
Ga0105092_100641732	3300009157	Freshwater Sediment	MKMQIVVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDESRGSA*
Ga0105092_100668501	3300009157	Freshwater Sediment	ARPQKKKIEITVMPAWMAGIQASKDVSGNVHVNLDSSAPCWNDAIGGLCLN*
Ga0105092_101313091	3300009157	Freshwater Sediment	IVVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDAMESSA*
Ga0105092_101510691	3300009157	Freshwater Sediment	MKMQIFVMPAWIAGIQIRKDASGDIHVSLDSSTPCWNDGIVGFCLK*
Ga0105092_101564601	3300009157	Freshwater Sediment	MKMESFVMPAWMAGIQVRMDASGHIHVGLDSSTPCWNDGIE
Ga0105092_102025542	3300009157	Freshwater Sediment	IAGIQIRKDASGDIHVSLDSSAPCWNDAIEGFCLN*
Ga0105092_102378781	3300009157	Freshwater Sediment	MKMQSFVIPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEGFC
Ga0105092_102381041	3300009157	Freshwater Sediment	MKLQITVMPAWMAGIQIRKDASGDIHVNLDSSAPCWNDGIEGFCLY*
Ga0105092_102937182	3300009157	Freshwater Sediment	MKMQIIVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEGFCLN*
Ga0105092_103881342	3300009157	Freshwater Sediment	MILPRPQNMKIQSFVMPAWIAGIQIRKDASGDIHVSLDSSTPCWNDGIVGFCLK*
Ga0105092_104006172	3300009157	Freshwater Sediment	MEMQIFVMPAWIAGIQICKDASGDVHVNLDSSAPCWNDGIEGSA*
Ga0105092_105936891	3300009157	Freshwater Sediment	QNMKMQIFVMPAWMAGTQVRKDASGDIHVNLDSSAPCWNDASRGSA*
Ga0105092_106133101	3300009157	Freshwater Sediment	MKMQIFVMPAWIAGIQIRKDASGDIHVSLDSSTPCWNDGIV
Ga0105092_106265602	3300009157	Freshwater Sediment	MQSFVMPAWIAGIQIRKDASGDIRVGLDSSTPCWKDGIEGFCLN*
Ga0105092_106579692	3300009157	Freshwater Sediment	PAWMAGIQACKDASGDIHVNLDSSTPCWNDAIEGFCLN*
Ga0105092_107344291	3300009157	Freshwater Sediment	MKMESFVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDESRGSA
Ga0105092_107515452	3300009157	Freshwater Sediment	MKMQIVMPAWIAGIQIRKDASGDIHVSLDSSIPCWNDAIEGFCLN*
Ga0075423_125390582	3300009162	Populus Rhizosphere	PAWIAGIQIRKDASGNIHVNLDSSTPCWNDVIERLYLK*
Ga0075423_129115311	3300009162	Populus Rhizosphere	MPAWIAGIQVRKEASGDIHVDLDSSPPCWNDTIKSLCSKLSKTLLPIF
Ga0105104_100628032	3300009168	Freshwater Sediment	MKMQIFVMPARIAGIQVRTDASGDIHVKLDSSTPCWNEPIEGSV*
Ga0105104_105746832	3300009168	Freshwater Sediment	MKMQIFVMPAWIAGIQIRKDASGDIHVSLDSSTPCWNDTIEELSKCSDPE*
Ga0126374_112964032	3300009792	Tropical Forest Soil	MKMQFFVMPAWIASIQVRKDASGNIHVSLDSSTPCWNDAIEGVLHKLT
Ga0105062_11280861	3300009817	Groundwater Sand	MKMQILVMPAWIAGIQVRKDASGNVHVNLDSSTPCWND
Ga0105072_10027561	3300009818	Groundwater Sand	MKMQILVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEG
Ga0105072_10219791	3300009818	Groundwater Sand	NMKMQIIVMPAWIAGIQVRKDASGNVHVNLIPALPCWNDAIEGFCLN*
Ga0105072_10257682	3300009818	Groundwater Sand	MKMEIIVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDA
Ga0105066_11273191	3300009822	Groundwater Sand	MKIQIIVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEGFCLN*
Ga0105068_10084442	3300009836	Groundwater Sand	MKMQIIVMPEWIAGIQVRKDASGNVHVNLDSSTPCWN
Ga0105058_10020382	3300009837	Groundwater Sand	MKMQIIVMPAWISGIQVRKDASGNVHVNLIPALPCWNDAIEGFCLN*
Ga0105058_10041373	3300009837	Groundwater Sand	MKMQIIVMPAWIAGNQVCKDASGNVHVNLDSSTPCWNDAIEGFCL
Ga0126380_120190831	3300010043	Tropical Forest Soil	MPAWIDGIQARKDASGDIHINLDSSSPCWNDAIEVL
Ga0126384_100038123	3300010046	Tropical Forest Soil	MLAWIAGIQVRKGASGNIHVTRDSSTPCWNDIVEELY*
Ga0126384_101792971	3300010046	Tropical Forest Soil	MENVIFVMPALIAGIQVHKDASGSVHVNLDSSTPCWNDVIDV
Ga0126384_109410551	3300010046	Tropical Forest Soil	MKMESFVMPAWTAGTQIRKDASREIHVNLDCSSPCRNFGG
Ga0126384_110099313	3300010046	Tropical Forest Soil	MKMQFFVMPAWIASIQVRKDASGNIHVSLDSSTPCWNDTKLRTLHVLRRK
Ga0126373_1000795012	3300010048	Tropical Forest Soil	ENATFVMAAWIAGIQIRKDASADIHVSLDSSTPCWNDTIEELY*
Ga0126373_121053792	3300010048	Tropical Forest Soil	MKMQIFVMPAWMAGIQLREDASGDIHVNLDSSAPCWNDGIEEFCLK*
Ga0126376_1000208511	3300010359	Tropical Forest Soil	METCVMLAWIAGIQVRKGASGNIHVTRDSSTPCWNDTVEELY*
Ga0126376_119854302	3300010359	Tropical Forest Soil	AYARLQNLKTQIVMPAWIAGIQIRKDACGDIHVNLDSSTP*
Ga0126377_101521754	3300010362	Tropical Forest Soil	MPAWIAGIQVRKDASGDIHVDLDSSAPCWNDGTDGLCFNWAKPI*
Ga0126375_104213521	3300012948	Tropical Forest Soil	RMKTHTVVIPAWIAGIQARKDAFGNIRVNLDSST*
Ga0164302_112325651	3300012961	Soil	MRNVDFVMPAWIAGIQVREDASGNIHVSLDSSAPCWNDSIKEGRT
Ga0126369_101899355	3300012971	Tropical Forest Soil	MPAWIAGIQIRKDASGDIHVDLDSSLPCWNDGIAGLCFN*
Ga0157372_118710451	3300013307	Corn Rhizosphere	QIFVMPAWIAGIQARKDAPDTSIVNLDSSTPCWNDVIEGFCWN*
Ga0075320_10199002	3300014255	Natural And Restored Wetlands	MKMQIIVMPALMAGIQVRKDASGDIHVNLGSSTPCWNDAKEGF*
Ga0075320_10347491	3300014255	Natural And Restored Wetlands	MKKPIFVMPAWIAGIQVRVQASADIHVNLDSSTPCW
Ga0180074_10256742	3300014877	Soil	MKMEIFVMPAWIAGIQVRKDASGDIHVNLDSSTPCWNDVIEGFCLS*
Ga0180093_10270911	3300015258	Soil	AWIAGIQVRKDASGNIHVNLDSSTPCWNDPIEEFCLN*
Ga0187776_104122532	3300017966	Tropical Peatland	MHAENPNFVMPAWIAGIQIRKDASGNVHVNLDSSIPCWNNVIERFFN
Ga0184620_101413712	3300018051	Groundwater Sediment	MKMQIFVMPAWIAGIQARKDASGNIHVNLDSSTPCWNDV
Ga0184629_103204512	3300018084	Groundwater Sediment	MNKQIIVMPAWIAGIQVRKDASGNIHVSLDSSTPCWND
Ga0184629_105570671	3300018084	Groundwater Sediment	MEIFVMPAWIAGIQVRKDASGDIHVNLDSSTPCWNDVIEGFCLS
Ga0184629_106587401	3300018084	Groundwater Sediment	MKMEIFVMPAWIAGIQVCKDASGIIHVNLDSSTPCWND
Ga0190269_105806831	3300018465	Soil	MKMQSSVMPAWIAGIQVRKDASGDIHVNLDSSTPCWNDVIEGFCLS
Ga0210379_100885823	3300021081	Groundwater Sediment	MKMQIIVMPAWIAGIQVRKDASGNIHVSLGSSTPCWNDAKEGFCLNS
Ga0210408_109883361	3300021178	Soil	MPAWIAGIQVRKDASGDIHVSLDSTTLCWNDALEK
Ga0210408_112637451	3300021178	Soil	MSLRLQNMKTQIFVMPAWIAGIQRFHINQVRTDASGNIHVNLDSSTPCWNDARE
Ga0126371_100133362	3300021560	Tropical Forest Soil	MLAWIAGIQVRKGASGNIHVTRDSSTPCWNDIVEELY
Ga0209640_102347882	3300025324	Soil	MKTQIFVMPAWIAGIQVRTDASGDIHVNLDSGTPCWNDANEDWCLN
Ga0209640_103892851	3300025324	Soil	AWIAGIQVRKDASGDIQVNLDSSTPCWNDVIEGFCLS
Ga0209640_110610171	3300025324	Soil	MKMEIFVMPAWIAGIQIRKDASGAIHVNLDSSTPCWNDVIEGF
Ga0207643_110405201	3300025908	Miscanthus Rhizosphere	MKMQIFVMPAWIAGIQARKDAPDTSIVNLDSSTPCWNDVIEGFCWN
Ga0207684_107527202	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MKIQIFVMPAWIAGIQVCTDASGNVHVSLDSSTPCWNDAIEGFCFKLTG
Ga0208655_10181671	3300026037	Natural And Restored Wetlands	MPAWTAGIQVRRDASGDIHVNLGSGHPCRNDDIEEYSP
Ga0209842_100013215	3300027379	Groundwater Sand	MKMQILVMPAWIAGIQVRKDASGNVHVNLDSSTPCWN
Ga0209899_10149731	3300027490	Groundwater Sand	MKVQSFVMPAWIAGIQACEDASENVHVDLDSSSPCWNDVIEGFL
Ga0209466_10043781	3300027646	Tropical Forest Soil	VIFVMPALIAGIQVHKDASGSVHVNLDSSTPWWNDVIDV
Ga0256866_11181343	3300027650	Soil	MKMQISVMPAWIAGIQAPQDVSGDIDVNLDSSTPCWNDAVEGFCLNRCGPL
Ga0209819_100006442	3300027722	Freshwater Sediment	MKMQIVVMPAWMAGTQVRRDASGDIHVDLDSSTPCWNDRIEGFCLK
Ga0209819_100030066	3300027722	Freshwater Sediment	MQTSVMPAWMAGIQVRKDASGNVHVSLDSSAPCWNDTIEGSA
Ga0209819_100032905	3300027722	Freshwater Sediment	MKMESFVMPAWMAGIQVRMDASGHIHVGLDSSTPCWNDGIEESYQD
Ga0209819_100033063	3300027722	Freshwater Sediment	MQIIVMPAWIAGIQIRKDASGDVHVNLDSSAPCWNDGIEGSA
Ga0209819_100059574	3300027722	Freshwater Sediment	MKMQIFVMPAWIAGIQIRKDASGDIHVSLDSSTPCWNDGIVGFCLK
Ga0209819_100141142	3300027722	Freshwater Sediment	MKMQIVVMPAWMAGTQVRKDASEDIHVNLDSSTPCWNDESRGSA
Ga0209819_100148801	3300027722	Freshwater Sediment	MKKQILVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDGIEVFCLN
Ga0209819_100222883	3300027722	Freshwater Sediment	MKMQIVVMPAWIAGTQVRKDASGDIRAGLDSSTPCWNDGIEGFCLK
Ga0209819_100418543	3300027722	Freshwater Sediment	MEMQIFVMPAWIAGIQICKDASGDVHVNLDSSAPCWNDGIEGSA
Ga0209819_100450201	3300027722	Freshwater Sediment	MKMQIVVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDESRGSA
Ga0209819_100610954	3300027722	Freshwater Sediment	MKLQITVMPAWMAGIQIRKDASGDIHVNLDSSAPCWNDGIEGFCLY
Ga0209819_100754671	3300027722	Freshwater Sediment	MKMQIIVMPAWIAGIQVRKDASGNVHVNLDSSTPCWND
Ga0209819_100854322	3300027722	Freshwater Sediment	MKMQITVMPAGMAGIQIRKDASGNVHVNLDSSIPCWNGVIERFFN
Ga0209819_101685061	3300027722	Freshwater Sediment	MKMQSFVMPAWMAGIQVRKDASGDVHFNLDSSTPCWNDVRG
Ga0209819_101803612	3300027722	Freshwater Sediment	MPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEG
Ga0209465_101260382	3300027874	Tropical Forest Soil	MKMQIFVMPAWMAGIQLREDASGDIHVNLDSSAPCWNDPLKGSA
Ga0209382_112096012	3300027909	Populus Rhizosphere	NFVLPAWIAGIQIRKDASGNIHVNLDSSTPCWNDVIERLYLK
Ga0209889_10571851	3300027952	Groundwater Sand	YLVMPAWMDGRHLGSQDASGDIHVGVDSSTPCWNDAIEGFYLN
Ga0209820_10838081	3300027956	Freshwater Sediment	VVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDESRGSA
Ga0302046_107470221	3300030620	Soil	MKMEIFVMPAWIAGIQVRKDASGDIHVNLDSSTPCWNDVIEGFCLS
Ga0170824_1139700032	3300031231	Forest Soil	MQIFVMRARIAGIRVRKDASGDVHVSLDSSTPCWNDTIR
Ga0307469_100077004	3300031720	Hardwood Forest Soil	MKMQIFVMLAWIAGIQVCKDASGNIHVSLDSSTPCWNDAVEGF
Ga0307469_122159771	3300031720	Hardwood Forest Soil	MKITIFVMPAWIAGIHQVCKDASGDIHVNLDSSTPCWNDAVEGFCFELIEVLCPVFS
Ga0307468_1004246281	3300031740	Hardwood Forest Soil	MKMEIFVMQVWIAGIQVRKDASGNIHVSLDSSIPCWNDAIEA
Ga0307468_1016164232	3300031740	Hardwood Forest Soil	METVMPVWIAGIQVRKDASGNIHVNLGSSTPCWND
Ga0307468_1020829411	3300031740	Hardwood Forest Soil	VMPARIAGIQARKDASANIHVNLDSGTPCWNDTIEELYSK
Ga0307473_103589352	3300031820	Hardwood Forest Soil	MQICVMLAWIAGIQARKDAYGDIRVNLDSSTPCWNDAIFTFFYD
Ga0326597_119262001	3300031965	Soil	MNKQIIVMPAWIAGIQVRKDASGNIHVNLDSSTPCWN
Ga0307471_1007084691	3300032180	Hardwood Forest Soil	MKMVILVMPAWIAGIHQVRKDASEDVHVGLDSSAPCWN
Ga0307471_1008575122	3300032180	Hardwood Forest Soil	MRNADFVMPAWIAGIQVREDASGNIHVSLDSSTPCWND
Ga0307472_1009096081	3300032205	Hardwood Forest Soil	MKTQTFVLPAWIAGIQVRTDASENIHVNLDSSTPC
Ga0335082_100288802	3300032782	Soil	MPAWIAGIQVPKDASGDIHVNLDSSAPCWNDAVESSG
Ga0335081_103100831	3300032892	Soil	MPAWIAGIQICMDASGDVHVGLHSSNPCWNDETKGF
Ga0335081_112423032	3300032892	Soil	KPGFVMPAWIAGIQARKDAPGDVHVNLDSSPPCWNDGIEGGCFK
Ga0335084_115540141	3300033004	Soil	MKIQVFVMPAWIAGIKVCRDASGNIHVSLDSSTQCWNDASRGLL
Ga0335084_121076311	3300033004	Soil	MKMESFVMPAWMAGIRAQDASGDIYVGLHSSTPCWNDGIEESY
Ga0214471_109147742	3300033417	Soil	MKMEIFVMPAWIAGIQIRKDASGDIHVNLDSSTPCWNDVS
Ga0364935_0304414_2_109	3300034151	Sediment	MPAWIAGIQARKDASGNIHVNLDSSTPCWNDVIVEF
Ga0370495_0205505_528_635	3300034257	Untreated Peat Soil	MPAWIAGIVIRKDASGDIHVDIATLDSSTPCWNDVI

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F039029

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences