


| Basic Information | |
|---|---|
| Family ID | F038892 |
| Family Type | Metagenome |
| Number of Sequences | 165 |
| Average Sequence Length | 42 residues |
| Representative Sequence | SSFFTPELRAFFESQGARIVRWKALLAADPAQRPRFKQI |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 165 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.18 % |
| % of genes from short scaffolds (< 2000 bps) | 91.52 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.182 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.212 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.515 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.394 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.88% β-sheet: 0.00% Coil/Unstructured: 76.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 165 Family Scaffolds |
|---|---|---|
| PF00685 | Sulfotransfer_1 | 35.76 |
| PF10459 | Peptidase_S46 | 6.06 |
| PF13469 | Sulfotransfer_3 | 6.06 |
| PF13884 | Peptidase_S74 | 4.85 |
| PF05635 | 23S_rRNA_IVP | 3.64 |
| PF00196 | GerE | 2.42 |
| PF13495 | Phage_int_SAM_4 | 0.61 |
| PF07992 | Pyr_redox_2 | 0.61 |
| PF07730 | HisKA_3 | 0.61 |
| PF02371 | Transposase_20 | 0.61 |
| PF01797 | Y1_Tnp | 0.61 |
| PF02518 | HATPase_c | 0.61 |
| PF13517 | FG-GAP_3 | 0.61 |
| PF01738 | DLH | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 165 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.61 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.61 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.61 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.61 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.18 % |
| Unclassified | root | N/A | 1.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17269635 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1870 | Open in IMG/M |
| 2189573004|GZGWRS402IOMOI | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300000956|JGI10216J12902_100585364 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300000956|JGI10216J12902_112146047 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300004479|Ga0062595_100690756 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300004479|Ga0062595_101533104 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 617 | Open in IMG/M |
| 3300004633|Ga0066395_11021882 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
| 3300004643|Ga0062591_102785678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300005166|Ga0066674_10321743 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 727 | Open in IMG/M |
| 3300005174|Ga0066680_10733147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300005178|Ga0066688_10082890 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300005180|Ga0066685_10218017 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300005293|Ga0065715_10973002 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 553 | Open in IMG/M |
| 3300005295|Ga0065707_10271344 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300005332|Ga0066388_102568880 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300005366|Ga0070659_100456076 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005445|Ga0070708_101409671 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005447|Ga0066689_10028464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2820 | Open in IMG/M |
| 3300005457|Ga0070662_101415569 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 599 | Open in IMG/M |
| 3300005526|Ga0073909_10630676 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005535|Ga0070684_102261156 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
| 3300005536|Ga0070697_100033802 | All Organisms → cellular organisms → Bacteria | 4120 | Open in IMG/M |
| 3300005552|Ga0066701_10232233 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300005554|Ga0066661_10119439 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300005555|Ga0066692_10170249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1348 | Open in IMG/M |
| 3300005556|Ga0066707_10061881 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300005559|Ga0066700_10877366 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005569|Ga0066705_10299837 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300005569|Ga0066705_10668044 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 630 | Open in IMG/M |
| 3300005574|Ga0066694_10344519 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 707 | Open in IMG/M |
| 3300005587|Ga0066654_10028835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2294 | Open in IMG/M |
| 3300005598|Ga0066706_10828066 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005598|Ga0066706_10906385 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005598|Ga0066706_11511225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
| 3300005764|Ga0066903_100529599 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
| 3300005764|Ga0066903_105350908 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005983|Ga0081540_1193617 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300006028|Ga0070717_11527959 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006031|Ga0066651_10656257 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 561 | Open in IMG/M |
| 3300006046|Ga0066652_100780819 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006163|Ga0070715_10166989 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300006173|Ga0070716_101624632 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
| 3300006796|Ga0066665_10132210 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1874 | Open in IMG/M |
| 3300006797|Ga0066659_10382623 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300009012|Ga0066710_100257806 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2528 | Open in IMG/M |
| 3300009012|Ga0066710_103013043 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300009012|Ga0066710_103205601 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 628 | Open in IMG/M |
| 3300009088|Ga0099830_11295789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 605 | Open in IMG/M |
| 3300009098|Ga0105245_13063470 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009137|Ga0066709_100424208 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300009137|Ga0066709_101599786 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300009137|Ga0066709_102545774 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 688 | Open in IMG/M |
| 3300009792|Ga0126374_10290111 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300010320|Ga0134109_10263597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 653 | Open in IMG/M |
| 3300010320|Ga0134109_10491223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
| 3300010321|Ga0134067_10444182 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 528 | Open in IMG/M |
| 3300010321|Ga0134067_10480536 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 511 | Open in IMG/M |
| 3300010325|Ga0134064_10131448 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300010325|Ga0134064_10430814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
| 3300010335|Ga0134063_10400980 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300010359|Ga0126376_10465569 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1160 | Open in IMG/M |
| 3300010359|Ga0126376_12984843 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010361|Ga0126378_10557118 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1261 | Open in IMG/M |
| 3300010361|Ga0126378_11517564 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300010366|Ga0126379_12404433 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 626 | Open in IMG/M |
| 3300010373|Ga0134128_12249701 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 601 | Open in IMG/M |
| 3300010376|Ga0126381_100755207 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1394 | Open in IMG/M |
| 3300010398|Ga0126383_13275204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 529 | Open in IMG/M |
| 3300012096|Ga0137389_11479228 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012198|Ga0137364_10978092 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 640 | Open in IMG/M |
| 3300012199|Ga0137383_10839472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 671 | Open in IMG/M |
| 3300012201|Ga0137365_10131098 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1884 | Open in IMG/M |
| 3300012201|Ga0137365_10677172 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 754 | Open in IMG/M |
| 3300012202|Ga0137363_11632534 | Not Available | 537 | Open in IMG/M |
| 3300012205|Ga0137362_10748229 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 839 | Open in IMG/M |
| 3300012205|Ga0137362_11787236 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300012209|Ga0137379_10274759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1597 | Open in IMG/M |
| 3300012211|Ga0137377_10237370 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1751 | Open in IMG/M |
| 3300012285|Ga0137370_10377931 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300012354|Ga0137366_10147104 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1774 | Open in IMG/M |
| 3300012355|Ga0137369_10372999 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1036 | Open in IMG/M |
| 3300012361|Ga0137360_11275513 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 635 | Open in IMG/M |
| 3300012362|Ga0137361_10913540 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012685|Ga0137397_10575956 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300012923|Ga0137359_10489352 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300012929|Ga0137404_10369869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1259 | Open in IMG/M |
| 3300012948|Ga0126375_11841475 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012948|Ga0126375_11925063 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300012957|Ga0164303_10670765 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 694 | Open in IMG/M |
| 3300012961|Ga0164302_11555442 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012961|Ga0164302_11634204 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012984|Ga0164309_10794576 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300012986|Ga0164304_10366959 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1012 | Open in IMG/M |
| 3300013308|Ga0157375_10269816 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1863 | Open in IMG/M |
| 3300014150|Ga0134081_10266081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
| 3300014968|Ga0157379_12548609 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 512 | Open in IMG/M |
| 3300015053|Ga0137405_1371651 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300015356|Ga0134073_10026302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1435 | Open in IMG/M |
| 3300015372|Ga0132256_100594603 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1221 | Open in IMG/M |
| 3300015373|Ga0132257_101081689 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300015374|Ga0132255_104609169 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300016270|Ga0182036_10676339 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300016319|Ga0182033_11338291 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300016341|Ga0182035_10872333 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300016357|Ga0182032_10372729 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300016371|Ga0182034_10506240 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300016445|Ga0182038_10670539 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300018054|Ga0184621_10084901 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300018081|Ga0184625_10161493 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300018431|Ga0066655_11020008 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
| 3300018433|Ga0066667_10728685 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 835 | Open in IMG/M |
| 3300018433|Ga0066667_10881001 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300018433|Ga0066667_11450363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 605 | Open in IMG/M |
| 3300019866|Ga0193756_1035389 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300019998|Ga0193710_1020922 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300020002|Ga0193730_1107480 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300020012|Ga0193732_1029955 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300020015|Ga0193734_1080744 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300020021|Ga0193726_1145410 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1037 | Open in IMG/M |
| 3300021418|Ga0193695_1018001 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1469 | Open in IMG/M |
| 3300021418|Ga0193695_1052426 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300021559|Ga0210409_10841575 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300021560|Ga0126371_12492074 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 626 | Open in IMG/M |
| 3300022756|Ga0222622_10939628 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 634 | Open in IMG/M |
| 3300025315|Ga0207697_10021895 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
| 3300025320|Ga0209171_10092541 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
| 3300025910|Ga0207684_11258199 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025914|Ga0207671_11423198 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 537 | Open in IMG/M |
| 3300025916|Ga0207663_10196084 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300025920|Ga0207649_11630925 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300025929|Ga0207664_10109828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2292 | Open in IMG/M |
| 3300026088|Ga0207641_11997293 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300026305|Ga0209688_1080981 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300026306|Ga0209468_1097515 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300026308|Ga0209265_1193262 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 544 | Open in IMG/M |
| 3300026316|Ga0209155_1104290 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300026317|Ga0209154_1011638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4293 | Open in IMG/M |
| 3300026333|Ga0209158_1083176 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300026524|Ga0209690_1221787 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300026528|Ga0209378_1052842 | All Organisms → cellular organisms → Bacteria | 1960 | Open in IMG/M |
| 3300026548|Ga0209161_10256556 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300026550|Ga0209474_10168308 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300026550|Ga0209474_10259098 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300026557|Ga0179587_10983536 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 556 | Open in IMG/M |
| 3300027667|Ga0209009_1094040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
| 3300027874|Ga0209465_10429426 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300028379|Ga0268266_10389086 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300028381|Ga0268264_10049902 | All Organisms → cellular organisms → Bacteria | 3483 | Open in IMG/M |
| 3300028708|Ga0307295_10174711 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 603 | Open in IMG/M |
| 3300028814|Ga0307302_10031484 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300028881|Ga0307277_10347451 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 660 | Open in IMG/M |
| 3300028885|Ga0307304_10394235 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 624 | Open in IMG/M |
| 3300031057|Ga0170834_112477691 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300031122|Ga0170822_13415419 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300031122|Ga0170822_16374525 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300031231|Ga0170824_114109119 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300031446|Ga0170820_11426966 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300031446|Ga0170820_14063988 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300031474|Ga0170818_112833336 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
| 3300031954|Ga0306926_10994287 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300031954|Ga0306926_12179996 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300032076|Ga0306924_11309324 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300032076|Ga0306924_12321474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 543 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.45% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.21% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.21% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.61% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02444820 | 2088090014 | Soil | FNRRADGSSFFTPERRAFFESQGARLRRWKALLAADPKQRPRFKQTR |
| FG2_08410610 | 2189573004 | Grass Soil | FTPELRAFFESQGARIGRWKALLAADPAERPRFKMV |
| JGI10216J12902_1005853641 | 3300000956 | Soil | RPDGSSFFTSELRACFLSEGARIFRSKALLAADPAQRPRFKQT* |
| JGI10216J12902_1121460471 | 3300000956 | Soil | FNPRRDGESFFTPALRACLLAKGARIFRSKALFAADSAKRPRFKQT* |
| Ga0062595_1006907561 | 3300004479 | Soil | DGSSFFTPELRTFFESQGALIVRWKALLARDPNEKPRFKQLK* |
| Ga0062595_1015331042 | 3300004479 | Soil | RRADGSSFFTPELRAFFNSQGARIVRWKALLAADPAERPRFKQI* |
| Ga0066395_110218821 | 3300004633 | Tropical Forest Soil | FNRRADGSSFFTPGLRKFFEAQGARIVRWKALLAADPAERPQFKQIR* |
| Ga0062591_1027856781 | 3300004643 | Soil | NPRPDGSSFFTDELRAFFESQGARIFRWKALLAADPNRRPRFKQTRKL* |
| Ga0066674_103217432 | 3300005166 | Soil | GSSFFTEEWRDFFEAQGARILRWKALLAADPNRRARFKMV* |
| Ga0066680_107331471 | 3300005174 | Soil | EELRACFLGQGARIFRRKALLAADASERPRFKQVKQVTSDG* |
| Ga0066688_100828903 | 3300005178 | Soil | DFNPRPDGSSFFTNELRACFLSEGARIFRSKALFATDPARRPRFKQT* |
| Ga0066685_102180173 | 3300005180 | Soil | PDGSSFFTKELRTCFLSQGARIRRWKALLAADPNQRPHFKQT* |
| Ga0065715_109730022 | 3300005293 | Miscanthus Rhizosphere | ELRAFFESQGARIIRWKALLAADPAERPRFKQTSLQRSGKR* |
| Ga0065707_102713441 | 3300005295 | Switchgrass Rhizosphere | FTDELRVFFESQGARIFRWKALLAADPSQRPRFKQIQKL* |
| Ga0066388_1025688801 | 3300005332 | Tropical Forest Soil | QDGSSFFTDELRAIFMSQGARILRWKALLGTDPSKKPRFKLL* |
| Ga0070659_1004560762 | 3300005366 | Corn Rhizosphere | DGSSFFTPELRAFFKSQGARIVRWKALLAADPAERPRFKQI* |
| Ga0070708_1014096711 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SFFTPELRALFLAQGARIFRSKALFAADPNQRPLFKQTNRRVLPGTKIL* |
| Ga0066689_100284644 | 3300005447 | Soil | QDGSSFFTPELRAFFQSQGARIFRWKALLAADANQRPRFNNK* |
| Ga0070662_1014155692 | 3300005457 | Corn Rhizosphere | RPDGSSFFTEELRALFESHGARIFRSKALLAADPNERPRFRKI* |
| Ga0073909_106306762 | 3300005526 | Surface Soil | SSFFTPELRAFFESQGARIVRWKALLAADPAERPRFKMV* |
| Ga0070684_1022611561 | 3300005535 | Corn Rhizosphere | DGSSFFTPELRAFFESQGARIVRWKALLAADPAQRPRFNNSGK* |
| Ga0070697_1000338021 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PDGSSFFTKKLRVCFLSEGARIFRSKALLAADPNQRPRFKQTR* |
| Ga0066701_102322331 | 3300005552 | Soil | ELRAFFESQGARIFRRKALLAADPNERPHFKQPRKL* |
| Ga0066661_101194391 | 3300005554 | Soil | DGSSFFTPELRAFFESQGARIVRWKALLAQNPNQRPRFKQIR* |
| Ga0066692_101702491 | 3300005555 | Soil | SFFTPELRAFFQSQGARIFRWKALLAADANQRPRFKQI* |
| Ga0066707_100618812 | 3300005556 | Soil | ELRAFFESQGARIVRWKALLAADPNQRPRFKQIR* |
| Ga0066700_108773662 | 3300005559 | Soil | SFFTPELRAFFESQGARIVRWKALLAADPNQRPRFKQIR* |
| Ga0066705_102998371 | 3300005569 | Soil | GSSFFTPQLREFFLSQGARIFRSKALLDVDPNQRPRFKQTGMGD* |
| Ga0066705_106680442 | 3300005569 | Soil | FFTEKWRAFFLSQGARIRRWKALLAADPNQRPRFKQTKLQGRRVA* |
| Ga0066694_103445191 | 3300005574 | Soil | PELRAFFESQGARIVRWKALLARDPAERPRFKQIR* |
| Ga0066654_100288351 | 3300005587 | Soil | PDGSSFFTKELRACFLSQGARIRRWKALLAADPTQRPKFNKSKW* |
| Ga0066706_108280661 | 3300005598 | Soil | ELRAFFESQGARIVRWKALLARDPAERPRFKQIR* |
| Ga0066706_109063851 | 3300005598 | Soil | GSSFFTPELRAFFQSQGARILRWKALLAADANQRPRFNNK* |
| Ga0066706_115112251 | 3300005598 | Soil | GSSFFTPELRACFRSLGARIFRSKALLAADPSDRPRFKQKKR* |
| Ga0066903_1005295991 | 3300005764 | Tropical Forest Soil | SFFTDELRAFFESQGARITRWKALLDADSKRRPRFKLL* |
| Ga0066903_1053509081 | 3300005764 | Tropical Forest Soil | ELREFFEAQGARIVRWKALLAANPADRPRFKQTR* |
| Ga0081540_11936171 | 3300005983 | Tabebuia Heterophylla Rhizosphere | EFNRRADGCSFFTPELRAFFKSQGARIVRWKALLAADPTERPRFKQLR* |
| Ga0070717_115279592 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GSSFFTKKLRAYFLFEGARIFRSKALLAADPNQHPRFKQTTRTIDKSL* |
| Ga0066651_106562571 | 3300006031 | Soil | RPDGSSFFTRELRACFLAQGARIFRSKALLAADPNERPRFKQT* |
| Ga0066652_1007808192 | 3300006046 | Soil | RADGSSFFTPELRTFFESQGARIVRWKALLAANPAERPRFKQI* |
| Ga0070715_101669891 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EFNRRADGSSFFTPELRAFFESHGARIVRWKALLAADPTERPRFKQV* |
| Ga0070716_1016246322 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SSFFTEEWRDFFEAQGARILRWKALLAADPNRRARFKML* |
| Ga0066653_105586911 | 3300006791 | Soil | RELRACFLAQGARIFRSKALLAANPIQRPRFKQI* |
| Ga0066665_101322101 | 3300006796 | Soil | NGSSFFTPELRACFRSLGARIFRSKALLAADPSDRPRFKQIGRGD* |
| Ga0066659_103826231 | 3300006797 | Soil | RPDGSSFFTPELRDFFLSQGARIFRSKALLAADPNQEPRFKQT* |
| Ga0066710_1002578064 | 3300009012 | Grasslands Soil | EELRAFFESQGARIFRWKALLAADPNERPRFKRTGRSD |
| Ga0066710_1030130432 | 3300009012 | Grasslands Soil | SSFFTEELRAFFESQGARIFRRKALLAADPNERPRFKQVKQVTSDG |
| Ga0066710_1032056011 | 3300009012 | Grasslands Soil | PDGSSFFTEELRAFFESQGARIFRRKALLAADPAERPRFKQARKL |
| Ga0099830_112957891 | 3300009088 | Vadose Zone Soil | NPRLDGSSFFTPELRACFLGEGARIFRSKALLAADPSDRPRFKQTGRGD* |
| Ga0105245_130634701 | 3300009098 | Miscanthus Rhizosphere | DGSSFFTDELRAFFESQGARIFRWKALLAADPSQRPRFKQIGR* |
| Ga0066709_1004242081 | 3300009137 | Grasslands Soil | RQDGSSFFTPELRAFFQSQGARIFRWKALLAADANQRPRFNNK* |
| Ga0066709_1015997861 | 3300009137 | Grasslands Soil | ELRTFFESQGARIVRWKALLAANPAERPRFKTRSGGL* |
| Ga0066709_1025457742 | 3300009137 | Grasslands Soil | FTEELRAFFESQGARIFRWKALLAADPNERPRFKRTGRSD* |
| Ga0126374_102901113 | 3300009792 | Tropical Forest Soil | FTPELRAFFESQGARIVRWKALLAADPTERPRFKQI* |
| Ga0134109_102635972 | 3300010320 | Grasslands Soil | RRADGSSFFTPELRTFFESQGARIVRWKALLAANPAERPRFKQI* |
| Ga0134109_104912231 | 3300010320 | Grasslands Soil | RRADGSSFFTPELRTFFESQGARIVRWKALLAANPAERPRFKTRSGGL* |
| Ga0134067_104441821 | 3300010321 | Grasslands Soil | FFTNELRARFLSEGARIFRSKALLAADPNQRPRFKQTRC* |
| Ga0134067_104805361 | 3300010321 | Grasslands Soil | AHGCSFFTEEWRACFESQGARILRSKALLAADPTERPRFKMV* |
| Ga0134064_101314482 | 3300010325 | Grasslands Soil | GFSFFTPELRAFFESQGARIVRWKALLAADPNQRPRFKQIR* |
| Ga0134064_104308142 | 3300010325 | Grasslands Soil | SFFTKELRACFLSQGARIFRWKALLAANPNQRPQFKQTQKL* |
| Ga0134063_104009801 | 3300010335 | Grasslands Soil | RPDGSSFFTRELRACFLAQGARIFRSKALLAANPSRRPRFKQT* |
| Ga0126376_104655692 | 3300010359 | Tropical Forest Soil | RRADGSSFFTPELRAFFNSQGARIVRWKALLAADLAERPRFKQI* |
| Ga0126376_129848432 | 3300010359 | Tropical Forest Soil | SSFFTPDLRAFFESQGARIVRWKALLAADPAEQPRFKQI* |
| Ga0126378_105571181 | 3300010361 | Tropical Forest Soil | RRQDGSSFFTPELRAFFESQGARIIRWKALLSADPNQRPRFKQI* |
| Ga0126378_115175642 | 3300010361 | Tropical Forest Soil | TPELRAFFESQGARIVRWKALLAFDPNQHPRFKQI* |
| Ga0126379_124044332 | 3300010366 | Tropical Forest Soil | DGSSFFTPELRALFESQGVRIFRRKALFAADPNERPRFKQSRKL* |
| Ga0134128_122497011 | 3300010373 | Terrestrial Soil | PELREFFESQGACIIRWKALLAANPSERPRFKMV* |
| Ga0126381_1007552071 | 3300010376 | Tropical Forest Soil | RADGSSFFTPELRAFFESQGARIVRWKALLAADPNQRPCFRQIK* |
| Ga0126383_132752041 | 3300010398 | Tropical Forest Soil | PELRAFFESQGARIVRWKALLAADPNQMPRFKQIGRGD* |
| Ga0137389_114792282 | 3300012096 | Vadose Zone Soil | RWDGSSFFTPELRACFLSEGARIFRSKALLAADPKRRPRFKQTTRRD* |
| Ga0137364_109780922 | 3300012198 | Vadose Zone Soil | GNSFFTNELRACFLSEGARIFRSKALLATDPAERPRFKQT* |
| Ga0137383_108394722 | 3300012199 | Vadose Zone Soil | SSFFTPELRALFESQGARIFRRKALLAADQSERPRFKQI* |
| Ga0137365_101310983 | 3300012201 | Vadose Zone Soil | SFFTEELRAFFESQGARIFRRKALLAADRNERPRFRKI* |
| Ga0137365_106771722 | 3300012201 | Vadose Zone Soil | QRPDGSSFFTRELRACFQAQGARIFRSKALLAADPNERPRFKQT* |
| Ga0137363_116325342 | 3300012202 | Vadose Zone Soil | SSFFTSELRSFFISQGARIRRSKALFGANPAERPRFKQTNQQ* |
| Ga0137362_107482293 | 3300012205 | Vadose Zone Soil | FFTRELRSFFISQGARIRRSKALFAANPAQRPRFKQTNQR* |
| Ga0137362_117872362 | 3300012205 | Vadose Zone Soil | TPELRAFFESQGARIVRWKALLAQNPNQRPRFKQV* |
| Ga0137379_102747593 | 3300012209 | Vadose Zone Soil | PDGSSFFTKELRACFLSQGARIFRWKALLAADPNQRPHFKQT* |
| Ga0137377_102373704 | 3300012211 | Vadose Zone Soil | PELRAFFQSQGARILRWKALLAADANQRPRFKML* |
| Ga0137370_103779311 | 3300012285 | Vadose Zone Soil | TDELRAFFESQGARIFRWKALLAADPRQRPRFKQF* |
| Ga0137366_101471043 | 3300012354 | Vadose Zone Soil | EFNRRADGSSFFTPELRAFFNSQGARIVRWKALLAADPAERPRFKQI* |
| Ga0137369_103729991 | 3300012355 | Vadose Zone Soil | PDGSSFFTEELGAFFESQGARIFRRKALLATDPAERPRFKQIR* |
| Ga0137360_112755131 | 3300012361 | Vadose Zone Soil | PDGSSFFAPQLRQLFLSQGARIFRSKALLAKNPNDRPRFRVIS* |
| Ga0137361_109135401 | 3300012362 | Vadose Zone Soil | SSFFTPELRAFFESQGARIVRWKALLAQNPNQHPRFKQV* |
| Ga0137390_106115822 | 3300012363 | Vadose Zone Soil | FTPQLRNVLIAQGARIFRSKALLAADLTKRPRFKIA* |
| Ga0137397_105759562 | 3300012685 | Vadose Zone Soil | RAFFESQGARIVRWKALLAADPAERPRFKTGSGGL* |
| Ga0137359_104893521 | 3300012923 | Vadose Zone Soil | GSSFFTPELRACFRSLGARIFRSKALLAADPSERPRFKQKKR* |
| Ga0137404_103698691 | 3300012929 | Vadose Zone Soil | NRRQDGSSFFTEEWRDFFEAQGARILRWKALLAADPNQRPRFKMV* |
| Ga0126375_118414751 | 3300012948 | Tropical Forest Soil | RRADGSSFFTPRLRAFFQSQGARIVRWKALLAADPAERPRFKLV* |
| Ga0126375_119250631 | 3300012948 | Tropical Forest Soil | QDSSEFFNDELRACFLSQGARIFRRKALLAAGPNQRPRFKQT* |
| Ga0164303_106707652 | 3300012957 | Soil | PDGSSVFTEELRALFESQGARIFRRKALLAADPKERPRFKEI* |
| Ga0164302_115554422 | 3300012961 | Soil | FFTPELRAFFKSQGARIVRWKALLAADPAERPRFKMV* |
| Ga0164302_116342042 | 3300012961 | Soil | GSSFFTPELRAFFESQGARIVRWKALLAADPTERPRFKMV* |
| Ga0164309_107945762 | 3300012984 | Soil | SSFFTPELRSFFESQGARIVRWKALLAADPAQRPRFNNSGK* |
| Ga0164304_103669592 | 3300012986 | Soil | SSFFTQELRAFFESQGARIVRWKALLAADPAERPRFKQMK* |
| Ga0157375_102698163 | 3300013308 | Miscanthus Rhizosphere | FTPELRAFFESQGARIVRWKALLAADPAERPQFKQLR* |
| Ga0134081_102660811 | 3300014150 | Grasslands Soil | RPDGSSFFTEELRAFFESHGARIFRSKALFAADSAERPRFKQT* |
| Ga0157379_125486091 | 3300014968 | Switchgrass Rhizosphere | LLEFNRRADGSSFFTQELREFFEEEGARIVRWKALLAADPAERPRFKQL* |
| Ga0137405_13716512 | 3300015053 | Vadose Zone Soil | DGSSFFTPELRAFFESQGARIVRWKALLAADPAERPRFKTGSGGL* |
| Ga0134073_100263023 | 3300015356 | Grasslands Soil | YELRAFFKSQGARIFRWKALLASDPKQRPRFKPK* |
| Ga0132256_1005946033 | 3300015372 | Arabidopsis Rhizosphere | RADGSSFFTPELRAFFESQGARIVRWKALLAADPAQRPRFKQI* |
| Ga0132257_1010816892 | 3300015373 | Arabidopsis Rhizosphere | SSFFTPELRAFFESQGARIVRWKALLAADPAQRPRFKQI* |
| Ga0132255_1046091692 | 3300015374 | Arabidopsis Rhizosphere | FTPELRAFFESQGAQIVRWKALLAADPAERPRFKHIRKL* |
| Ga0182036_106763392 | 3300016270 | Soil | FFTEEWRDFFEAQGARILRWKALLAADPNRRARFKMV |
| Ga0182033_113382912 | 3300016319 | Soil | FFTQELCEFFEGQGARIVRWKALLAADPAERPRFKQI |
| Ga0182035_108723332 | 3300016341 | Soil | TQELREFFEGEGARSVRWKALLAADPAERPRFKQI |
| Ga0182032_103727291 | 3300016357 | Soil | ADGSSFFTPELREFFQAQGARIVRWKALLAADPAERPRFKQL |
| Ga0182034_105062401 | 3300016371 | Soil | DGSSFFTQELREFFEGEGARIVRWKALLAADPAERPRFKQI |
| Ga0182038_106705392 | 3300016445 | Soil | SSFFTQELREFFEGQGARIVRWKALLAADSAERPRFKQL |
| Ga0184621_100849012 | 3300018054 | Groundwater Sediment | QDGSSFFTDELRSFFESQGARILRWKALLGADPNQRPQFKQTSVKVDKLL |
| Ga0184625_101614931 | 3300018081 | Groundwater Sediment | RADGSSFFTPELRAFFESQGARIVRWKALLAADPAERPRFKMV |
| Ga0066655_110200082 | 3300018431 | Grasslands Soil | PHGSPFFTEEWGAGFESQGARIFRLQALLAADPPERPRFGKI |
| Ga0066667_107286851 | 3300018433 | Grasslands Soil | GSSFFTEKWRAFFLSQGARIRRWKALLAVDPNQRPRFKQTKLQGRRVA |
| Ga0066667_108810012 | 3300018433 | Grasslands Soil | FNPRPDGYSFFTRELRACFLGQGARIFRSKALLAADPNERPRFKQT |
| Ga0066667_114503632 | 3300018433 | Grasslands Soil | FTPELRALFESQGARIFRRKALLAADRSERPRFKQV |
| Ga0193756_10353891 | 3300019866 | Soil | CTDELRVFFESQGARIFRWKALLGADPNQRPRFRQIQKL |
| Ga0193710_10209221 | 3300019998 | Soil | RADGSSFFTPELRAFFEAQGARIMRWKALLAADPAGRPRFKTGSGGL |
| Ga0193730_11074802 | 3300020002 | Soil | LEFNRRQDGSSFFTPELRAFFESQGARIVRWKALLAADPAERPRFKMV |
| Ga0193732_10299551 | 3300020012 | Soil | FTPELRDFFISQGSRIRRWKALLAADPNERPFFKQTKL |
| Ga0193734_10807442 | 3300020015 | Soil | EFNRRADGSSFFTPELRAFFESQGARIVRWKALLAADPAERPRLKMV |
| Ga0193726_11454101 | 3300020021 | Soil | ADGSSFFTPELRAFFEAQGARIMRWKALLAADPAGRPRFKTGSGGL |
| Ga0193695_10180013 | 3300021418 | Soil | PELRAFFESQGARIVRWKALLAADPAQRPRFKTGGGAL |
| Ga0193695_10524262 | 3300021418 | Soil | NRRQDGSSFFTPEWRAFFESQGARIFRWKALFAADPDKHPRFKRTRL |
| Ga0210409_108415751 | 3300021559 | Soil | LDGSSFFTPELRTCFLGEGARIFRSKALLAADPSDRPRFKQTETALTKIDR |
| Ga0126371_124920741 | 3300021560 | Tropical Forest Soil | SSFFTQELREFFEGQGARIVRWKALLAADPAEQPRFKQI |
| Ga0222622_109396282 | 3300022756 | Groundwater Sediment | QDGSSFFTDELRAFFESQGAHIFRWKALLAANPNERPRFNQTARED |
| Ga0207697_100218953 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | RRDDGSSFFTPELRAFFDSQGARIVRWKALLAADPAAKPRFKQI |
| Ga0209171_100925411 | 3300025320 | Iron-Sulfur Acid Spring | PRPDGSSFFTQELREFFSIQGARIFRSKALLGKNPNQRPRLKQTTG |
| Ga0207684_112581991 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PRPDGSSFFTEELRVCFESQGARIFRSKALLAGDPAERPRFKQAKL |
| Ga0207671_114231981 | 3300025914 | Corn Rhizosphere | FTDELRAFFESQGARIFRWKALLGADPSQRPRFKQIQKL |
| Ga0207663_101960841 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GSSFFTPELRAFFDSQGARIVRWKALLAADPAAKPRFKQI |
| Ga0207649_116309252 | 3300025920 | Corn Rhizosphere | SFFTPELRAFFESQGARIIRWKALLAANPSERPRFKMV |
| Ga0207664_101098281 | 3300025929 | Agricultural Soil | NPREDGSSFFTSELRALFFSQGARIFRSKALLARNPNERPRFKQ |
| Ga0207641_119972931 | 3300026088 | Switchgrass Rhizosphere | RGDGSSFFTPELRAFFESQGARIVRWKALLAADPAERPQFKQLR |
| Ga0209688_10809811 | 3300026305 | Soil | DGSSFFTPELRTFFESQGARIVRWKALLAANPAERPRFKTRSGGL |
| Ga0209468_10975152 | 3300026306 | Soil | DGSSFFTAELRDFFESQGARILRWKALLAADPNQRPRFKEIGRSD |
| Ga0209265_11932621 | 3300026308 | Soil | PDGSSFFTKELRACFLSQGARIRRWKALLAADPTQRPKFNKSKW |
| Ga0209155_11042902 | 3300026316 | Soil | EFNPRPDGSSFFTDELRASFESQGARIFRWKALLAADPAERPRFKQT |
| Ga0209154_10116386 | 3300026317 | Soil | DGSSFFTPELRAFFQSQGARIFRWKALLAADANQRPRFNNK |
| Ga0209158_10831762 | 3300026333 | Soil | NPRPDGSSFFTPELRTFVLSQGARIFRSKALLGGNANKKPRFKQRSDK |
| Ga0209690_12217872 | 3300026524 | Soil | RQDCSSFFTPELRAFFQSQGARILRWKALLAADANQRPRFNNK |
| Ga0209378_10528421 | 3300026528 | Soil | PELRAFFESQGARIVRWKALLAADPNQRPRFKQIR |
| Ga0209161_102565561 | 3300026548 | Soil | FTEELRAFFESQGARIFRWKALLAADPNERPRFKRTGRSD |
| Ga0209474_101683081 | 3300026550 | Soil | PHGCSFFTEEWRACFESQGARIFRRKALLAADPNERPRFKMV |
| Ga0209474_102590981 | 3300026550 | Soil | RRQDGSSFFSPELRAFFQSQGARIFRWKALLAADANQRPRFKQI |
| Ga0179587_109835361 | 3300026557 | Vadose Zone Soil | RADGSSFFTPELRAFFESQGARIVRWKALLAADPAERPRFKTGSGGL |
| Ga0209009_10940401 | 3300027667 | Forest Soil | LRACFLAEGARIFRSKALLAADPSDRPRFKQTNYVAGDE |
| Ga0209465_104294261 | 3300027874 | Tropical Forest Soil | TSELRAFFESQGAQIVRWKALLAADPNKRPRFKQA |
| Ga0268266_103890863 | 3300028379 | Switchgrass Rhizosphere | TDELRAFFESQGARIFRWKALLAAHPDDRPRFKQTAREN |
| Ga0268264_100499023 | 3300028381 | Switchgrass Rhizosphere | ADGSSFFTSELRAFFESQGARIVRWKALLAADPAERPRFKQI |
| Ga0307295_101747111 | 3300028708 | Soil | ADGSSFFTPELRAFFESQGARIVRWKALLAADPAERPRFKQMK |
| Ga0307302_100314841 | 3300028814 | Soil | NRRADGSSFFTPELRAFFESQGARIVRWKALFAADPAERPRFKTGSGSL |
| Ga0307277_103474511 | 3300028881 | Soil | LEFNRRQDGSSFFTEEWRDFFEAQGACILRWKALLAADPNRRARFKML |
| Ga0307304_103942352 | 3300028885 | Soil | SFFTPELRAFFESQGARIVRWKALLAADPAERPRFKTGSGGL |
| Ga0170834_1124776912 | 3300031057 | Forest Soil | PDDSSFFTKKLRACFLSEGARIFRSKALLGADPNQRPRFKQIR |
| Ga0170822_134154193 | 3300031122 | Forest Soil | SSFFTDELRAFFESQGARIFRWKALLAADPDQRPRFKPTRKL |
| Ga0170822_163745251 | 3300031122 | Forest Soil | PRPDDSSFFTKKLRACFLSEGARIFRSKALLGADPNQRPRFKQIR |
| Ga0170824_1141091191 | 3300031231 | Forest Soil | DDSSFFTKKLRACFLSEGARIFRSKALLGADPNQRPRFKQIR |
| Ga0170820_114269662 | 3300031446 | Forest Soil | LEFNRRADGSSFFTPELRAFFESQGARIVRWKALLAADPTERPRFKQV |
| Ga0170820_140639881 | 3300031446 | Forest Soil | GSSFFTPELRAFFKSQGAQIVRWKALLAADPAERPRFKMV |
| Ga0170818_1128333361 | 3300031474 | Forest Soil | ADGSSFFTPELRAFFESQGARIVRWKALLAADPTQRPRFKQI |
| Ga0306926_109942871 | 3300031954 | Soil | FFTQELREFFEGEGARIVRWKALLAADPAERPRFKQI |
| Ga0306926_121799961 | 3300031954 | Soil | FFTPELRAFFQSQGARILRWKALLAADANQRPRFKQTGSSD |
| Ga0306924_113093241 | 3300032076 | Soil | FTPELRAFFNSQGARIVRWKALLAADPAERPRFKQI |
| Ga0306924_123214742 | 3300032076 | Soil | RRADGSSFFTQELREFFEGQGARIVRWKALLAADPAERPRFKQL |
| ⦗Top⦘ |