NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F038581

Metagenome / Metatranscriptome Family F038581

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F038581
Family Type Metagenome / Metatranscriptome
Number of Sequences 165
Average Sequence Length 46 residues
Representative Sequence MSRRSSRRGRPYQPLPQRRVNWGARLLVVFVAFILVAGFAILTFAR
Number of Associated Samples 130
Number of Associated Scaffolds 165

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 68.48 %
% of genes near scaffold ends (potentially truncated) 19.39 %
% of genes from short scaffolds (< 2000 bps) 82.42 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.394 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(21.818 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.758 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 31.08%    β-sheet: 0.00%    Coil/Unstructured: 68.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 165 Family Scaffolds
PF00903Glyoxalase 13.94
PF13561adh_short_C2 7.88
PF05163DinB 7.88
PF03641Lysine_decarbox 4.24
PF12681Glyoxalase_2 1.82
PF04209HgmA_C 1.21
PF01035DNA_binding_1 1.21
PF02805Ada_Zn_binding 0.61
PF02511Thy1 0.61
PF00293NUDIX 0.61
PF10079BshC 0.61
PF02481DNA_processg_A 0.61
PF08327AHSA1 0.61
PF00005ABC_tran 0.61
PF01022HTH_5 0.61
PF12840HTH_20 0.61
PF07179SseB 0.61
PF01425Amidase 0.61
PF00300His_Phos_1 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 165 Family Scaffolds
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 7.88
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 4.24
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 1.21
COG0758Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptakeReplication, recombination and repair [L] 1.21
COG3508Homogentisate 1,2-dioxygenaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.21
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 1.21
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.61
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 0.61
COG2169Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domainsReplication, recombination and repair [L] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.39 %
UnclassifiedrootN/A0.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig187797All Organisms → cellular organisms → Bacteria760Open in IMG/M
2124908044|A5_c1_ConsensusfromContig63577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium637Open in IMG/M
2124908044|A5_c1_ConsensusfromContig68354All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300000956|JGI10216J12902_106358384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2292Open in IMG/M
3300001535|A3PFW1_10096735All Organisms → cellular organisms → Bacteria1879Open in IMG/M
3300001535|A3PFW1_10137459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium814Open in IMG/M
3300002120|C687J26616_10012367All Organisms → cellular organisms → Bacteria3333Open in IMG/M
3300002121|C687J26615_10101602All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300002122|C687J26623_10029758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1453Open in IMG/M
3300002407|C687J29651_10283299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium523Open in IMG/M
3300002503|C687J35164_10173323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium620Open in IMG/M
3300003203|JGI25406J46586_10093178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium906Open in IMG/M
3300003349|JGI26129J50193_1018476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium516Open in IMG/M
3300003987|Ga0055471_10060380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1046Open in IMG/M
3300003993|Ga0055468_10257985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium550Open in IMG/M
3300003998|Ga0055472_10086757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium857Open in IMG/M
3300004002|Ga0055477_10203961All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300004002|Ga0055477_10350483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium584Open in IMG/M
3300004013|Ga0055465_10247193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium600Open in IMG/M
3300004020|Ga0055440_10212876All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300004114|Ga0062593_100356458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1282Open in IMG/M
3300004114|Ga0062593_100541390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1092Open in IMG/M
3300004114|Ga0062593_102243529All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300004156|Ga0062589_102118298All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300004157|Ga0062590_101657654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium649Open in IMG/M
3300004463|Ga0063356_104734505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium585Open in IMG/M
3300004463|Ga0063356_104861432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium577Open in IMG/M
3300004479|Ga0062595_100069317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1722Open in IMG/M
3300004479|Ga0062595_101281878All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005093|Ga0062594_101328487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium724Open in IMG/M
3300005172|Ga0066683_10559211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium697Open in IMG/M
3300005294|Ga0065705_10220441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1321Open in IMG/M
3300005294|Ga0065705_10649230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium678Open in IMG/M
3300005440|Ga0070705_100003258All Organisms → cellular organisms → Bacteria7979Open in IMG/M
3300005440|Ga0070705_100936961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium699Open in IMG/M
3300005444|Ga0070694_100833166All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005445|Ga0070708_100092274All Organisms → cellular organisms → Bacteria2759Open in IMG/M
3300005445|Ga0070708_100402395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1291Open in IMG/M
3300005445|Ga0070708_100731031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium931Open in IMG/M
3300005467|Ga0070706_101780213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium560Open in IMG/M
3300005471|Ga0070698_100024732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6263Open in IMG/M
3300005556|Ga0066707_10304093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1044Open in IMG/M
3300005557|Ga0066704_10127814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1691Open in IMG/M
3300005558|Ga0066698_10074824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2192Open in IMG/M
3300005586|Ga0066691_10480863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium742Open in IMG/M
3300005875|Ga0075293_1069737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium526Open in IMG/M
3300005876|Ga0075300_1046459All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005878|Ga0075297_1031008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium607Open in IMG/M
3300005879|Ga0075295_1012670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium909Open in IMG/M
3300005886|Ga0075286_1004199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1636Open in IMG/M
3300006854|Ga0075425_100010252All Organisms → cellular organisms → Bacteria9991Open in IMG/M
3300006894|Ga0079215_10360115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium837Open in IMG/M
3300007740|Ga0104326_118295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1435Open in IMG/M
3300009012|Ga0066710_100312229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2308Open in IMG/M
3300009137|Ga0066709_100773927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1388Open in IMG/M
3300009162|Ga0075423_10366099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1512Open in IMG/M
3300009162|Ga0075423_11579340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium705Open in IMG/M
3300009166|Ga0105100_10267961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1022Open in IMG/M
3300009553|Ga0105249_13454205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium509Open in IMG/M
3300010041|Ga0126312_11381748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium522Open in IMG/M
3300010391|Ga0136847_11158873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1153Open in IMG/M
3300012010|Ga0120118_1104124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium688Open in IMG/M
3300012014|Ga0120159_1056199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1223Open in IMG/M
3300012019|Ga0120139_1139290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales627Open in IMG/M
3300012204|Ga0137374_10169496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1922Open in IMG/M
3300012355|Ga0137369_10173223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1693Open in IMG/M
3300012360|Ga0137375_10305333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1437Open in IMG/M
3300012914|Ga0157297_10307867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium599Open in IMG/M
3300012931|Ga0153915_10001148All Organisms → cellular organisms → Bacteria24417Open in IMG/M
3300012931|Ga0153915_10427547All Organisms → cellular organisms → Bacteria1503Open in IMG/M
3300013294|Ga0120150_1060097All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium729Open in IMG/M
3300013772|Ga0120158_10420306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium609Open in IMG/M
3300015209|Ga0167629_1025849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2109Open in IMG/M
3300015253|Ga0180081_1041928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium763Open in IMG/M
3300015371|Ga0132258_10123409All Organisms → cellular organisms → Bacteria6158Open in IMG/M
3300015371|Ga0132258_10981110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2135Open in IMG/M
3300015373|Ga0132257_100384207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1704Open in IMG/M
3300015374|Ga0132255_100329638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2205Open in IMG/M
3300017659|Ga0134083_10079692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1270Open in IMG/M
3300017997|Ga0184610_1077218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1027Open in IMG/M
3300017997|Ga0184610_1125617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium829Open in IMG/M
3300018052|Ga0184638_1206880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium689Open in IMG/M
3300018052|Ga0184638_1228815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium648Open in IMG/M
3300018053|Ga0184626_10172296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium919Open in IMG/M
3300018053|Ga0184626_10408448All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300018063|Ga0184637_10204795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1210Open in IMG/M
3300018063|Ga0184637_10225595All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300018071|Ga0184618_10000731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium7765Open in IMG/M
3300018071|Ga0184618_10030474All Organisms → cellular organisms → Bacteria1851Open in IMG/M
3300018075|Ga0184632_10003645All Organisms → cellular organisms → Bacteria6411Open in IMG/M
3300018076|Ga0184609_10577780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium506Open in IMG/M
3300018082|Ga0184639_10395188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium715Open in IMG/M
3300018429|Ga0190272_13198690All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300018469|Ga0190270_12938405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium539Open in IMG/M
3300019255|Ga0184643_1384494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium577Open in IMG/M
3300019888|Ga0193751_1000641All Organisms → cellular organisms → Bacteria25854Open in IMG/M
3300020059|Ga0193745_1072969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium748Open in IMG/M
3300021080|Ga0210382_10056643All Organisms → cellular organisms → Bacteria1555Open in IMG/M
3300021344|Ga0193719_10325345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium642Open in IMG/M
3300022213|Ga0224500_10021795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2738Open in IMG/M
3300022214|Ga0224505_10050323All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300025002|Ga0209001_1072612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium547Open in IMG/M
3300025159|Ga0209619_10445859All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300025160|Ga0209109_10004099All Organisms → cellular organisms → Bacteria7924Open in IMG/M
3300025160|Ga0209109_10016556All Organisms → cellular organisms → Bacteria3967Open in IMG/M
3300025160|Ga0209109_10331744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium720Open in IMG/M
3300025318|Ga0209519_10727680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium532Open in IMG/M
3300025325|Ga0209341_10081844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2727Open in IMG/M
3300025325|Ga0209341_10257246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1447Open in IMG/M
3300025325|Ga0209341_10758707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium740Open in IMG/M
3300025538|Ga0210132_1077481All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300025796|Ga0210113_1113170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium532Open in IMG/M
3300025817|Ga0210144_1186894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium584Open in IMG/M
3300025885|Ga0207653_10420548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium524Open in IMG/M
3300025912|Ga0207707_11186750All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300025922|Ga0207646_10026551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium5284Open in IMG/M
3300025922|Ga0207646_11528678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium577Open in IMG/M
3300025932|Ga0207690_11765245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium517Open in IMG/M
3300026089|Ga0207648_10372112All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300026089|Ga0207648_11689118All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300026535|Ga0256867_10025069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2528Open in IMG/M
3300027526|Ga0209968_1083997All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300027636|Ga0214469_1044530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1400Open in IMG/M
3300027647|Ga0214468_1030950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1431Open in IMG/M
3300027650|Ga0256866_1058731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1022Open in IMG/M
3300028708|Ga0307295_10075927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium888Open in IMG/M
3300028717|Ga0307298_10202195All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300028722|Ga0307319_10133038All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300028771|Ga0307320_10169826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium848Open in IMG/M
3300028784|Ga0307282_10099989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1345Open in IMG/M
3300028792|Ga0307504_10001246All Organisms → cellular organisms → Bacteria4971Open in IMG/M
3300028793|Ga0307299_10061817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1386Open in IMG/M
3300028807|Ga0307305_10435564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium591Open in IMG/M
3300028814|Ga0307302_10067640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1679Open in IMG/M
3300028819|Ga0307296_10194907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1099Open in IMG/M
3300028824|Ga0307310_10344706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium731Open in IMG/M
3300028828|Ga0307312_10216926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1232Open in IMG/M
3300028828|Ga0307312_10330637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium995Open in IMG/M
3300028828|Ga0307312_10365894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium944Open in IMG/M
3300028828|Ga0307312_11171691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium508Open in IMG/M
3300028878|Ga0307278_10315900All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300028884|Ga0307308_10568997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium543Open in IMG/M
3300030006|Ga0299907_10073378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2772Open in IMG/M
3300030006|Ga0299907_10524071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium933Open in IMG/M
3300030006|Ga0299907_10971487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium626Open in IMG/M
3300030619|Ga0268386_10797162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium604Open in IMG/M
3300031229|Ga0299913_10009031All Organisms → cellular organisms → Bacteria8795Open in IMG/M
3300031229|Ga0299913_10288539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1626Open in IMG/M
3300031229|Ga0299913_10778980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium931Open in IMG/M
3300031716|Ga0310813_11083452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium734Open in IMG/M
3300031740|Ga0307468_102433648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium511Open in IMG/M
3300031949|Ga0214473_11037980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium862Open in IMG/M
3300031965|Ga0326597_11322305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium703Open in IMG/M
3300031965|Ga0326597_12014785All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300032061|Ga0315540_10270651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium712Open in IMG/M
3300032075|Ga0310890_11327734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium589Open in IMG/M
3300032163|Ga0315281_10005598All Organisms → cellular organisms → Bacteria17962Open in IMG/M
3300032163|Ga0315281_10048394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium5201Open in IMG/M
3300033407|Ga0214472_10007440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium11458Open in IMG/M
3300033417|Ga0214471_10001362All Organisms → cellular organisms → Bacteria19415Open in IMG/M
3300033433|Ga0326726_10356027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1382Open in IMG/M
3300033433|Ga0326726_11234429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium727Open in IMG/M
3300033812|Ga0364926_149869Not Available501Open in IMG/M
3300033814|Ga0364930_0188474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium702Open in IMG/M
3300034773|Ga0364936_107331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium553Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.67%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands6.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil4.85%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.64%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.03%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.42%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.82%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.82%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.82%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.21%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.21%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.21%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.21%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.21%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.21%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.61%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.61%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.61%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.61%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.61%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.61%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300002121Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1EnvironmentalOpen in IMG/M
3300002122Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2EnvironmentalOpen in IMG/M
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300002503Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3EnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003349Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PMHost-AssociatedOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004002Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004020Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300005876Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401EnvironmentalOpen in IMG/M
3300005878Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104EnvironmentalOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300007740Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013294Permafrost microbial communities from Nunavut, Canada - A3_65cm_0MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015253Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300025002Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes)EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025538Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025817Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027636Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeqEnvironmentalOpen in IMG/M
3300027647Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeqEnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033812Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034773Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_034216402124908032SoilMSRRSSRRGRPYQPLPDHRSNWGAKLVVVFVAFILVAGFAILTFAR
A5_c1_009988002124908044SoilVSRRSSRRGRPYQPLPDRRSNWGAKLVVIFVALILVAGFAILTFAR
A5_c1_005379002124908044SoilMSRRSQRRGRPYQPLPERHINWGARLTVVVIAFILVIGFAILAFAR
JGI10216J12902_10635838423300000956SoilVTRRRQRGRPYQPLPARHVNWGARLLVVFVAFVLVAGFAILTFAR*
A3PFW1_1009673513300001535PermafrostGRPYQPLPARQVNWGARLVIVVVAVVLVAGFAILSFAR*
A3PFW1_1013745913300001535PermafrostMSRRSQRRGRPYQPLPARQVNWGARLVIVFVAFVLVAGFAILSFAR*
C687J26616_1001236763300002120SoilMSRRSSRRGRPYQPLPRRRVNWGARLLVVFVAFILVAGFAILTFAR*
C687J26615_1010160233300002121SoilMSRRSSRRGRPYQPLPVRRVNWVARLVVVFVAFILVAGFAILTFAR*
C687J26623_1002975843300002122SoilMSRRSSRRGRPYQPLPRRRVNWGARLLVVFVAFILVAGFAILTFA
C687J29651_1028329923300002407SoilMSRRSSRRGRPYQPLPRRRVNWGARLLVVFVAFILVAGFAIL
C687J35164_1017332323300002503SoilMSRRSSRRGRPYQPLPQRRVNWGARLLVVFVAFILVAGFAILTFAR*
JGI25406J46586_1009317823300003203Tabebuia Heterophylla RhizosphereMTRRRRGRPYQPYPVRSVNWGARLIIVAVGFIMIVGFAILTFTH*
JGI26129J50193_101847613300003349Arabidopsis Thaliana RhizosphereMSRRSSRKGRPYQPLPVRHTNWGARLVIISVAFILVAGFAILSFSR*
Ga0055471_1006038023300003987Natural And Restored WetlandsMSRRNRKRGRSYQPYPERNVNWGARLMIVAVAFIMVAGIAILTFAR*
Ga0055468_1025798523300003993Natural And Restored WetlandsMSRSRRSGRRGRPYQPYPERRTNWAARLIIVVVAFIMVAGIAVLTFTQ*
Ga0055472_1008675713300003998Natural And Restored WetlandsMSRRSGRKGRPYQPYPERRTNWAARLVIVVVAFIMVAGIAVLTFIR*
Ga0055477_1020396123300004002Natural And Restored WetlandsMSRRNRRGRVYQPLPKRQVNWGARLLIVVIGFVMVAGIAILAFAR*
Ga0055477_1035048323300004002Natural And Restored WetlandsVSRRGNRRGRPYQPYPDRRVNWGARLLIVAIAFVMVAGIAILAFAR*
Ga0055465_1024719313300004013Natural And Restored WetlandsMTRRRGRGRPYQPYPERRTNWGARLLVVFVGFVLIAGFAILTFAR*
Ga0055440_1021287623300004020Natural And Restored WetlandsVSRRSSRRGRPYQPLPPRRTNWGARLVIVFVAFILVAGFAVLTFVK*
Ga0062593_10035645833300004114SoilMSRRSQRRGRPYQPLPTRRVNWGARLVIISVAFVLVAGFAILSFAR*
Ga0062593_10054139023300004114SoilLTRRRRGRPYQPYPTRSVNWGARLLIVVIGFIMVLGIAILTFTR*
Ga0062593_10224352923300004114SoilMSRRSQRRGRPYQPLPERQVNWGARLVIIFVAFVLIAGFAILSFAR*
Ga0062589_10211829813300004156SoilMSRRSSRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR*
Ga0062590_10165765423300004157SoilLTRRRRGRPYQPYPTRSVDWGARLLIVVIGFIMVLGIAILTFTR*
Ga0063356_10473450523300004463Arabidopsis Thaliana RhizosphereMSRRSNRRGRPYQPLPTRRVNWGARLVIIFVAFVLVAGFAILSFAR*
Ga0063356_10486143213300004463Arabidopsis Thaliana RhizosphereRRRRGRPYQPYPTRSVNWGARLLIVVIGFIMVVGIAILTFTR*
Ga0062595_10006931723300004479SoilMSRRSPRRGRPYQPLPARSVNWGARLVIVVVAVVLVAGFAILSFAR*
Ga0062595_10128187823300004479SoilVGPMSRRSQRRGRPYQPLPTRRVNWGARLVIISVAFVLVAGFAILSFAR*
Ga0062594_10132848723300005093SoilMSRRSQRRGRPYQPLPTRRVNWGARLVIVIVAFVLVAGFAILSFAR*
Ga0066683_1055921123300005172SoilVSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGFAILTFSK*
Ga0065705_1022044133300005294Switchgrass RhizosphereHSRGADDPVPAPPRVGPMSRRSSRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR*
Ga0065705_1064923013300005294Switchgrass RhizosphereMSRRSQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFAR*
Ga0070705_10000325843300005440Corn, Switchgrass And Miscanthus RhizosphereMSRRSSRKGRPYQPLPERRVNWGARLVIIFVAFILVAGFAILSFAR*
Ga0070705_10093696123300005440Corn, Switchgrass And Miscanthus RhizosphereMSRRSSRRGRPYQPLPERRVNWGARLVIVVVAFILVAGIAVLSFAR*
Ga0070694_10083316613300005444Corn, Switchgrass And Miscanthus RhizosphereAPRVGPMSRRSSRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR*
Ga0070708_10009227453300005445Corn, Switchgrass And Miscanthus RhizosphereMSRRSPRRGRPYQPLPTRTVNWGARLVIVIVAVVLVAGFAILSFAR*
Ga0070708_10040239523300005445Corn, Switchgrass And Miscanthus RhizosphereVSRRSTRKGRPYQPLPERRGSWVAKIVVLFVAFILVIGFAILTFAK*
Ga0070708_10073103123300005445Corn, Switchgrass And Miscanthus RhizosphereMSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGFAVLTFSR*
Ga0070706_10178021313300005467Corn, Switchgrass And Miscanthus RhizosphereMSRRSSRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFAR*
Ga0070698_10002473253300005471Corn, Switchgrass And Miscanthus RhizosphereMSRRSSRRGRPYQPLPERRVNWGARLVIVVVAFILVAGFAILSFAR*
Ga0066707_1030409323300005556SoilVSRRSARRGRPYQPLPERRGNWVAKLVVLFVAFILVVGFAVLTFSR*
Ga0066704_1012781423300005557SoilVSRRSARRGRPYQPLPERRGNWAAKLVVLFVAFILVVGFAVLTFSR*
Ga0066698_1007482443300005558SoilMSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGFAILTFSK*
Ga0066691_1048086323300005586SoilRGRPYQPLPERRGNWAAKLVVLFVAFILVVGFAVLTFSR*
Ga0075293_106973723300005875Rice Paddy SoilVSRRSQRRGRPYQPLPSRRTNWTARLVVVFVAFILVAGFAILTFAR*
Ga0075300_104645923300005876Rice Paddy SoilRSQRRGRPYQPLPSRRTNWTARLVVVFVAFILVAGFAILTFAR*
Ga0075297_103100823300005878Rice Paddy SoilMSRRSNRRGRPYQPLPERHVNWGARLTVVLVALVLVIGFAILTFAR*
Ga0075295_101267023300005879Rice Paddy SoilVSRRSRRRGRPYQPLPSRRTNWTARLVVVFVAFILVAGFAILTFAR*
Ga0075286_100419913300005886Rice Paddy SoilMSRRSGRRGRPYQPYPERRVNWGARLLVVFVAFVMIASIAILTFVR*
Ga0075425_10001025243300006854Populus RhizosphereMTRRSSRRGRPYQPLPEKRSNWGARLLVLLVAVILVGGFAVLTFTH*
Ga0079215_1036011513300006894Agricultural SoilMSRRRRGRPYQPYPTRNVNWGARLLIVLVGFIMVVGIAILTFTR*
Ga0104326_11829533300007740SoilVSRRSSRRGRPYQPLPDRRSNWGAKLVVIFVALILVAGFAILTFAR*
Ga0066710_10031222953300009012Grasslands SoilSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGFAILTFSK
Ga0066709_10077392723300009137Grasslands SoilMSRRSSRRGRPYQPLPVRRVNWAARLVIVVVAVVLVAGFAILSFAR*
Ga0075423_1036609923300009162Populus RhizosphereMTRRSSRRGRLYQPLPEKRSNWGARLLVLLVAVILVGGFAVLTFTH*
Ga0075423_1157934023300009162Populus RhizosphereMSRRSSRKGRPYQPLPVRHTNWGARLVIIFVALILVVGFAILSFAR*
Ga0105100_1026796123300009166Freshwater SedimentVGPVSRRSSRKGRPYQPDPEKRVNWVARVLVVAVAFIMIAGFAILTFVR*
Ga0105249_1345420523300009553Switchgrass RhizosphereMSRRSQRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR*
Ga0126312_1138174823300010041Serpentine SoilMSRRRRSGRPYQPYPTRRQNWGARLLIVGIGFVMVIGIAILAFTR*
Ga0136847_1115887313300010391Freshwater SedimentMSRRSSRRGRPYQPLPERRVNWGARLAVVFVTFILVAGFAILTFAR*
Ga0120118_110412423300012010PermafrostMSRRSSRRGRPYQPLPARQVNWGARLVIVVVAVVLVAGFAILSFAR*
Ga0120159_105619913300012014PermafrostMSRRSSRRGRPYQPLPARQVNWGARLGIVVVAVVLVAGFAILSFAR*
Ga0120139_113929023300012019PermafrostAPRSHRRGRPSQPLPPSRTNWGARLIVIFVAFILVAGFAILTFTK*
Ga0137374_1016949623300012204Vadose Zone SoilMTRRRQRGRAYQPLPARHVNWGARLLVVFVAFVLVAGFAILTFAR*
Ga0137369_1017322333300012355Vadose Zone SoilRAYQPLPARHVNWGARLLVVFVAFVLVAGFAILTFAR*
Ga0137375_1030533313300012360Vadose Zone SoilMSRRSNRRGRPYQPLPERRVNWAARLVIVIVAFVRVAGFAILTFAR*
Ga0157297_1030786723300012914SoilMSRRSSRKGRPYQPLPVRHTNWGARLVIIFVTFILVAGFAILSFSR*
Ga0153915_10001148233300012931Freshwater WetlandsMSRRTSRRGRPYQPLPERRTHWGARLVIVFVAFILVAGFAVLTFVK*
Ga0153915_1042754723300012931Freshwater WetlandsVSRRSSRRGRPYQPLPERRTNWGARLVVIFVAFILVAGFAVLTFVK*
Ga0120150_106009723300013294PermafrostMSRRSQRRGRPYQPLPARQVNWGARLVIIFVAFVLVAGFAILSFAR*
Ga0120158_1042030623300013772PermafrostMSRRSPRRGRPYQPLPERRGNWVAKLVVLFVAFILVVGIAVLAFSR*
Ga0167629_102584913300015209Glacier Forefield SoilMSRRSQRRGRPYQPLPPSRTNWGARLIVIFVAFILVAGFAILTFTK*
Ga0180081_104192813300015253SoilMSRRSPRRGRPYQPLPERRVNWGARITVVFVAFILVAGFAILTFAR*
Ga0132258_1012340953300015371Arabidopsis RhizosphereMTRRRRGRPYQPYPTRRVNWGARIVIVAVGFIMVVGFAILTFTH*
Ga0132258_1098111033300015371Arabidopsis RhizosphereMSRRSSRRGRPYQPLPKRDVNWGARLVIIFVAFVLIAGFAILSFAR*
Ga0132257_10038420713300015373Arabidopsis RhizosphereMSRRSSRRGRPYQPLPKLDVNWGARLVIIFVAFVLIAGFAILSFAR*
Ga0132255_10032963813300015374Arabidopsis RhizosphereKGRPYQPYPARTTNWAARLVIVAIGFIMVIGIAVLAFSR*
Ga0134083_1007969233300017659Grasslands SoilVSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGFAILTFSK
Ga0184610_107721833300017997Groundwater SedimentMSRRSSRRGRPYQPLPERRVNWAARLVIIVVAFVLVAGFAILTFAR
Ga0184610_112561713300017997Groundwater SedimentMSRRSNRRGRPYQPLPTRQVNWGARLVIIFVAFVLIAGFAILSFAR
Ga0184638_120688023300018052Groundwater SedimentMPGRSSRRGRPYQPLPARRTSWGARLVVVFIALILVGGFAILTFVR
Ga0184638_122881523300018052Groundwater SedimentMSRRSNRRGRPYQPLPTRQVNWGARLVIIFVAFVLIAGFA
Ga0184626_1017229623300018053Groundwater SedimentVSRRSSRRGRPYQPLPERRGSWMAKLVVLFVAFILVLGFAILTFTK
Ga0184626_1040844823300018053Groundwater SedimentMSRRSNRRGRPYQPLPTRRVNWGARLLIIFVAFILVAGFAILSFAR
Ga0184637_1020479513300018063Groundwater SedimentMSRRSSRRGRPYQPIPLRRVNWGARLVVVFVAFILVASFVILTFTR
Ga0184637_1022559513300018063Groundwater SedimentRSSRRGRPYQPLPARRANWGARLVVVFVAFVLVAGFAILTFAR
Ga0184618_1000073183300018071Groundwater SedimentMSRRSSRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR
Ga0184618_1003047443300018071Groundwater SedimentAEDGMSRRSQRRGRPYQPLPARRVNWGARLVIVIVAFILVAGFVILSFAR
Ga0184632_1000364593300018075Groundwater SedimentMTRRSGRRGRPYQPLPARHVNWGARLLVVFVAFVLVAGFAILTFTR
Ga0184609_1057778013300018076Groundwater SedimentMTRRRQRGRAYQPLPARHVNWGARLLVVFVAFVLVAGFAILTFAR
Ga0184639_1039518823300018082Groundwater SedimentMSRRSSRRGRPYQPLPVRPINWGARLVVIFVAFILVAGFAILTFAR
Ga0190272_1319869013300018429SoilMSRRSQRRGRPYQPMPVRRVNWVARLVIVFIAFTLVAGFAILTFAR
Ga0190270_1293840523300018469SoilMSRKSQRRGRPYQPLPTRHVNWGARLVIIFVAFVLVAGFAILSFAR
Ga0184643_138449423300019255Groundwater SedimentMSRRSQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR
Ga0193751_100064193300019888SoilMSRRSPRRGRPYQPLPERRGSWVAKLVVLFVAFILVVGIAVLAFSR
Ga0193745_107296923300020059SoilMSRRSQRRGRPYQPLPARRVNWGARLVIVIVAFILVAGFAILSFAR
Ga0210382_1005664323300021080Groundwater SedimentMSRRSQRRGRPYQPLPARRVNWGARLVIVVVAFILVAGFAILSFAR
Ga0193719_1032534523300021344SoilVSRRSSRRGRPYQPLPERHTNWGARLLVLFVAVILIAGFAILTFTR
Ga0224500_1002179523300022213SedimentVGPVSRRSSRRGRPYQPLPQRNVNWGARLLVVFVAFIMVAGFAILTFAR
Ga0224505_1005032343300022214SedimentVSRRSSRRGRPYQPLPQRNVNWGARLLVVFVAFIMVAGFAILTFAR
Ga0209001_107261223300025002SoilMSRRSSRRGRPYQPLPQRRVNWGARLLVVFVAFILVAGFAILTFAR
Ga0209619_1044585913300025159SoilALPPAPRVGPMSRRSSRRGRPYQPLPQRRVNWGARLLVVFVAFVLVAGFAILTFAR
Ga0209109_10004099103300025160SoilMSRRSSRRGRPYQPLPVRRVNWVARLVVVFVAFILVAGFAILTFAR
Ga0209109_1001655663300025160SoilMSRRSSRRGRPYQPLPQRRVNWGARLLVVFVAFVLVAGFAILTFAR
Ga0209109_1033174423300025160SoilMSRRSPRRGRPYQPLPKRHVNWGARLTVVFVAFILVVGFAILTFAR
Ga0209519_1072768013300025318SoilSSRRGRPYQPLPQRRVNWGARLLVVFVAFILVAGFAILTFAR
Ga0209341_1008184433300025325SoilMSRRSPRRGRPYQPLPVRRVNWVARLVVVFIAFVLVASFAIITFTR
Ga0209341_1025724633300025325SoilMSRRSSRRGRPYQPLPVRRVNWVARLVVVFVAFVLVAGFAILTFAR
Ga0209341_1075870723300025325SoilMSRRSPRRGRPYQPLPQRHVNWGARLTVVFVAFILVVGFAILTFAR
Ga0210132_107748123300025538Natural And Restored WetlandsVSRRSSRRGRPYQPLPPRRTNWGARLVIVFVAFILVAGFAVLTFVK
Ga0210113_111317023300025796Natural And Restored WetlandsMSRSRRSGRRGRPYQPYPERRTNWAARLIIVVVAFIMVAGIAVLTFTQ
Ga0210144_118689423300025817Natural And Restored WetlandsVSRRGNRRGRPYQPYPDRRVNWGARLLIVAIAFVMVAGIAILAFAR
Ga0207653_1042054823300025885Corn, Switchgrass And Miscanthus RhizosphereMSRRSSRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR
Ga0207707_1118675023300025912Corn RhizosphereMSRRSQRRGRPYQPLPTRRVNWGARLVIVIVAFVLVAGFAILSFAR
Ga0207646_1002655173300025922Corn, Switchgrass And Miscanthus RhizosphereMSRRSSRKGRPYQPLPERRVNWGARLVIIFVAFILVAGFAILSFAR
Ga0207646_1152867823300025922Corn, Switchgrass And Miscanthus RhizosphereMSRRSSRRGRPYQPLPERRVNWGARLVIVVVAFILVAGIAVLSFAR
Ga0207690_1176524513300025932Corn RhizosphereMSRRSQRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFAR
Ga0207648_1037211233300026089Miscanthus RhizosphereMSRRSQRKGRPYQPLPVRHTNWGARLVIIFVAFILVAGFAILSFSR
Ga0207648_1168911813300026089Miscanthus RhizosphereSCSAANGADKSMSRRSQRRGRPYQPLPTRRVNWGARLVIVIVAFVLVAGFAILSFAR
Ga0256867_1002506933300026535SoilVTRRSGRKGRPYQPYPVRRVNWAARLLIVAIAFIMVAGFAVLTFVR
Ga0209968_108399723300027526Arabidopsis Thaliana RhizosphereSRKGRPYQPLPVRHTNWGARLVIISVAFILVAGFAILSFSR
Ga0214469_104453023300027636SoilMSRRSRRGRPYQPYPQRRVNWGARLLIVAIAFILVAGFAILTFAR
Ga0214468_103095023300027647SoilMSRRTRRGRPYQPYPQRRVNWGARLLIVAIAFILVAGFAILTFAR
Ga0256866_105873123300027650SoilMSRRRKGRPYQPYPTRNVNWGARLLIVLVGFIMVVGIAILTFTR
Ga0307295_1007592723300028708SoilMSRRSQRRGRPYQPLPARRVNWGARLVIVFVAFVLVAGFAILSFAR
Ga0307298_1020219523300028717SoilMSRRSQRRGRPYQPLPTRRVNWGARLVIVFVAFVLVAGFAILSFAR
Ga0307319_1013303813300028722SoilQRRGRPYQPLPTRRVNWGARLVIVFVAFVLVAGFAILSFAR
Ga0307320_1016982623300028771SoilMSRRSNRRGRPYQPLPTRQVNWGARLVIIFVAFVLVAGFAILSFAR
Ga0307282_1009998933300028784SoilMSRRAQRRGRPYQPLPARRVNWGARLVIVVVAFILVAGFAILSFAR
Ga0307504_1000124663300028792SoilMSRRSTRRGRPYQPLPERRVNWGARLVVIFVAFFLIAGIAILSFTR
Ga0307299_1006181733300028793SoilMSRRSSHRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR
Ga0307305_1043556423300028807SoilMSRRSSRRGRPYQPLPERHTNWGARLLVLFVAVILIAGF
Ga0307302_1006764033300028814SoilMSRRSQRRGRPYQPLPPSRTSWGARLIVIFVAFVLVAGFAILTFSR
Ga0307296_1019490733300028819SoilRSPRRGRPYQPLPARRVNWGARLVIVVVAFILVAGFAILSFAR
Ga0307310_1034470623300028824SoilMTRRRRGRPYQPYPARQVNWGARVIIVIVGFIMILGIAILTFTR
Ga0307312_1021692613300028828SoilQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR
Ga0307312_1033063713300028828SoilSSRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR
Ga0307312_1036589423300028828SoilGAHDPVPAPSRVGPMSRRSQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFTR
Ga0307312_1117169113300028828SoilMSRRSQRRGRPYQPLPARRVNWGARLVIVIVAFILVAG
Ga0307278_1031590013300028878SoilMSRRSQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILSFAR
Ga0307308_1056899713300028884SoilSSFAASGAGEGMSRRSQRRGRPYQPLPERRVNWGARLVIFFVAFVLVAGFAILTFAR
Ga0299907_1007337843300030006SoilMSRRRRGRPYQPYPTRNVNWGARLLIVLVGFIMVVGIAILTFTR
Ga0299907_1052407123300030006SoilVTRRSGRKGRPYQPYPVRRVNWAARLLIVAIAFIMVAGFAVLTF
Ga0299907_1097148723300030006SoilMTRRGGRRGRAYQPIPTRRVNWGARLLVVFVAFIMVAGFAILTFAR
Ga0268386_1079716223300030619SoilMSRSRRSGRKGRPYQPYPERRTNWAARLIIVVVAFIMVAGIAVLTFTQ
Ga0299913_1000903143300031229SoilVSRRSGRKGRPYQPYPVRRVNWGARLLIVAVAFIMVAGFAVLTFAR
Ga0299913_1028853913300031229SoilRPYQPYPVRRVNWAARLLIVAIAFIMVAGFAVLTFVR
Ga0299913_1077898023300031229SoilMSRSRRSGSKGRPYQPYPERRTNWAARLIIVVVAFIMVAGIAVLTFTQ
Ga0310813_1108345223300031716SoilMTRRRRGRPYQPYPTRRVNWGARIVIVAVGFIMVVGFAILTFTH
Ga0307468_10243364823300031740Hardwood Forest SoilVSRRSSRRGRPYQPLPERRTNWGARLLVLFVAVILIAGFAILTFTR
Ga0214473_1103798013300031949SoilMSRRSSRRGRPYQPLPARRVNWGARLVIFFVAFVLVAGFAILSFAR
Ga0326597_1132230523300031965SoilMSRRSPRRGRPYQPLPERHVNWAARLVVIFVAFILVAGFAILTFAR
Ga0326597_1201478523300031965SoilMSRRSSRRGRPYQPLPERNVNWGARLTVVFVAFILVAGFAILTFAR
Ga0315540_1027065113300032061Salt Marsh SedimentMSRRSGRRGRPYQPYPERRANWGARLLVVFVAFVMIAGFAILTF
Ga0310890_1132773423300032075SoilVTRRRKGRAYQPYPARRSNWAARLVIVAIGFIMVLGIAVLAFTR
Ga0315281_10005598193300032163SedimentVRRRSSRRGRPYQPLPKSQSNWGARLIVVFVAFILVAGFAILTFAR
Ga0315281_1004839483300032163SedimentVGALNPVSRRSSRRGRPYQPLPVRRVNWGARLVVVFVAFILVAGFAILTFAR
Ga0214472_10007440173300033407SoilMSRRSSRRGRPYQPLPARRVNWGARLVIIFVAFVLVAGFAILSFSR
Ga0214471_10001362173300033417SoilVTRRSGRRGRAYQPMPTRRVNWGARLLVVFVAFIMVAGFAILTFAR
Ga0326726_1035602723300033433Peat SoilMSRRSPRRGRPYQPLPERNINWGARLTVVVIAFILVIGFAILAFAR
Ga0326726_1123442923300033433Peat SoilMSRRSPRRGRPYQPLPERNINWGARLTVVIIAFILVIGFAILAFSH
Ga0364926_149869_294_4343300033812SedimentMSRRSSRRGRPYQPLPARRANWGARLVVVFVAFVLVAGFAILTFAR
Ga0364930_0188474_165_3053300033814SedimentMSRRSPRRGRPYQPLPQRHVNWGARLTVVVVAFILIVGFAILTFAR
Ga0364936_107331_431_5533300034773SedimentMSRRSSRRGRPYQPLPASRVNWVARLVIIFIAFTLVAGFAI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.