Basic Information | |
---|---|
Family ID | F038360 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 166 |
Average Sequence Length | 42 residues |
Representative Sequence | LDSFLNDTARLTSGGKLRLAALTAFNLLPFTEHVETVARFERA |
Number of Associated Samples | 153 |
Number of Associated Scaffolds | 166 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.01 % |
% of genes near scaffold ends (potentially truncated) | 95.78 % |
% of genes from short scaffolds (< 2000 bps) | 93.37 % |
Associated GOLD sequencing projects | 145 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.108 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (8.434 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.675 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (34.940 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.49% β-sheet: 26.76% Coil/Unstructured: 57.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 166 Family Scaffolds |
---|---|---|
PF06865 | Ppnp | 7.83 |
PF05199 | GMC_oxred_C | 4.22 |
PF01035 | DNA_binding_1 | 2.41 |
PF12840 | HTH_20 | 2.41 |
PF00753 | Lactamase_B | 2.41 |
PF13561 | adh_short_C2 | 1.81 |
PF13302 | Acetyltransf_3 | 1.81 |
PF11026 | DUF2721 | 1.81 |
PF12697 | Abhydrolase_6 | 1.81 |
PF04073 | tRNA_edit | 1.81 |
PF03061 | 4HBT | 1.81 |
PF00175 | NAD_binding_1 | 1.20 |
PF12833 | HTH_18 | 1.20 |
PF00005 | ABC_tran | 1.20 |
PF00067 | p450 | 1.20 |
PF01408 | GFO_IDH_MocA | 1.20 |
PF03372 | Exo_endo_phos | 1.20 |
PF02518 | HATPase_c | 1.20 |
PF13442 | Cytochrome_CBB3 | 1.20 |
PF01266 | DAO | 1.20 |
PF02894 | GFO_IDH_MocA_C | 1.20 |
PF07366 | SnoaL | 1.20 |
PF04030 | ALO | 0.60 |
PF12228 | DUF3604 | 0.60 |
PF02567 | PhzC-PhzF | 0.60 |
PF00903 | Glyoxalase | 0.60 |
PF06516 | NUP | 0.60 |
PF01546 | Peptidase_M20 | 0.60 |
PF04024 | PspC | 0.60 |
PF01738 | DLH | 0.60 |
PF07362 | CcdA | 0.60 |
PF02492 | cobW | 0.60 |
PF13545 | HTH_Crp_2 | 0.60 |
PF03104 | DNA_pol_B_exo1 | 0.60 |
PF03601 | Cons_hypoth698 | 0.60 |
PF04461 | DUF520 | 0.60 |
PF02566 | OsmC | 0.60 |
PF13279 | 4HBT_2 | 0.60 |
PF00970 | FAD_binding_6 | 0.60 |
PF03737 | RraA-like | 0.60 |
PF00848 | Ring_hydroxyl_A | 0.60 |
PF02826 | 2-Hacid_dh_C | 0.60 |
PF08327 | AHSA1 | 0.60 |
PF00378 | ECH_1 | 0.60 |
PF13659 | Obsolete Pfam Family | 0.60 |
PF01323 | DSBA | 0.60 |
PF13420 | Acetyltransf_4 | 0.60 |
PF16916 | ZT_dimer | 0.60 |
PF00563 | EAL | 0.60 |
PF07969 | Amidohydro_3 | 0.60 |
PF01643 | Acyl-ACP_TE | 0.60 |
PF00186 | DHFR_1 | 0.60 |
PF01758 | SBF | 0.60 |
PF02811 | PHP | 0.60 |
PF01479 | S4 | 0.60 |
PF13673 | Acetyltransf_10 | 0.60 |
PF00593 | TonB_dep_Rec | 0.60 |
PF02321 | OEP | 0.60 |
PF01176 | eIF-1a | 0.60 |
PF02678 | Pirin | 0.60 |
PF01699 | Na_Ca_ex | 0.60 |
PF08570 | DUF1761 | 0.60 |
PF07690 | MFS_1 | 0.60 |
PF13601 | HTH_34 | 0.60 |
PF05960 | DUF885 | 0.60 |
PF01663 | Phosphodiest | 0.60 |
PF02913 | FAD-oxidase_C | 0.60 |
PF03773 | ArsP_1 | 0.60 |
PF01545 | Cation_efflux | 0.60 |
PF00326 | Peptidase_S9 | 0.60 |
PF02781 | G6PD_C | 0.60 |
PF03466 | LysR_substrate | 0.60 |
PF03358 | FMN_red | 0.60 |
PF01814 | Hemerythrin | 0.60 |
PF10041 | DUF2277 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
---|---|---|---|
COG3123 | Pyrimidine/purine nucleoside phosphorylase YaiE/PpnP, UPF0345/DUF1255 family | Nucleotide transport and metabolism [F] | 7.83 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 4.22 |
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 2.41 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 2.41 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.20 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.20 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.20 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.20 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.20 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.60 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.60 |
COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.60 |
COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.60 |
COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.60 |
COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.60 |
COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.60 |
COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.60 |
COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.60 |
COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 0.60 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.60 |
COG1666 | Cyclic di-GMP-binding protein YajQ, UPF0234 family | Signal transduction mechanisms [T] | 0.60 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.60 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.60 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.60 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.60 |
COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.60 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.60 |
COG3884 | Acyl-ACP thioesterase | Lipid transport and metabolism [I] | 0.60 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.60 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.60 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.60 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.60 |
COG5042 | Purine nucleoside permease | Nucleotide transport and metabolism [F] | 0.60 |
COG5302 | Post-segregation antitoxin (ccd killing mechanism protein) encoded by the F plasmid | Mobilome: prophages, transposons [X] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.11 % |
Unclassified | root | N/A | 22.89 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459003|FZ032L002FN5A0 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 515 | Open in IMG/M |
3300000546|LJNas_1020709 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300001396|JGI20175J14863_1006598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 1948 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101084594 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300003322|rootL2_10279949 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300003465|P52013CM_1097081 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300003858|Ga0031656_10253568 | Not Available | 597 | Open in IMG/M |
3300004082|Ga0062384_100553599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
3300004146|Ga0055495_10076824 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300004155|Ga0066600_10712733 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300004480|Ga0062592_100638064 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300005331|Ga0070670_102134275 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300005538|Ga0070731_10280584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1106 | Open in IMG/M |
3300005844|Ga0068862_100436188 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300005921|Ga0070766_11130526 | Not Available | 541 | Open in IMG/M |
3300005952|Ga0080026_10039249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1213 | Open in IMG/M |
3300006059|Ga0075017_100677604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
3300006059|Ga0075017_101398453 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300006174|Ga0075014_100068316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1579 | Open in IMG/M |
3300006176|Ga0070765_101642169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
3300006176|Ga0070765_102025975 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300006354|Ga0075021_11062941 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300006358|Ga0068871_100256605 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300006930|Ga0079303_10236439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
3300009075|Ga0105090_10641778 | Not Available | 645 | Open in IMG/M |
3300009075|Ga0105090_10658028 | Not Available | 636 | Open in IMG/M |
3300009078|Ga0105106_11083998 | Not Available | 569 | Open in IMG/M |
3300009081|Ga0105098_10130290 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300009091|Ga0102851_10256794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1680 | Open in IMG/M |
3300009165|Ga0105102_10533188 | Not Available | 641 | Open in IMG/M |
3300009167|Ga0113563_12447197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 629 | Open in IMG/M |
3300009167|Ga0113563_12729405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 598 | Open in IMG/M |
3300009179|Ga0115028_10187714 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300009545|Ga0105237_12395476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 538 | Open in IMG/M |
3300009651|Ga0105859_1295985 | Not Available | 506 | Open in IMG/M |
3300009686|Ga0123338_10350186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 633 | Open in IMG/M |
3300009697|Ga0116231_10535054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 641 | Open in IMG/M |
3300009701|Ga0116228_10077043 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2547 | Open in IMG/M |
3300009709|Ga0116227_10049199 | All Organisms → cellular organisms → Bacteria | 3890 | Open in IMG/M |
3300009762|Ga0116130_1126753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 803 | Open in IMG/M |
3300010051|Ga0133939_1008302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18707 | Open in IMG/M |
3300010877|Ga0126356_10881818 | Not Available | 612 | Open in IMG/M |
3300012212|Ga0150985_100217282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 566 | Open in IMG/M |
3300012469|Ga0150984_113131246 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300012924|Ga0137413_11258737 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300012927|Ga0137416_11466828 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012982|Ga0168317_1068366 | Not Available | 838 | Open in IMG/M |
3300014168|Ga0181534_10451564 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300014168|Ga0181534_10637465 | Not Available | 617 | Open in IMG/M |
3300014169|Ga0181531_10280807 | Not Available | 1018 | Open in IMG/M |
3300014200|Ga0181526_10956477 | Not Available | 538 | Open in IMG/M |
3300014201|Ga0181537_10187282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1422 | Open in IMG/M |
3300014495|Ga0182015_10633430 | Not Available | 677 | Open in IMG/M |
3300014499|Ga0182012_11083387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 501 | Open in IMG/M |
3300014654|Ga0181525_10326027 | Not Available | 840 | Open in IMG/M |
3300014654|Ga0181525_10497019 | Not Available | 675 | Open in IMG/M |
3300014658|Ga0181519_10219566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1193 | Open in IMG/M |
3300015162|Ga0167653_1067397 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300017996|Ga0187891_1296143 | Not Available | 529 | Open in IMG/M |
3300018017|Ga0187872_10163624 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300018024|Ga0187881_10269800 | Not Available | 710 | Open in IMG/M |
3300018025|Ga0187885_10329332 | Not Available | 689 | Open in IMG/M |
3300018038|Ga0187855_10231594 | Not Available | 1085 | Open in IMG/M |
3300018047|Ga0187859_10363512 | Not Available | 790 | Open in IMG/M |
3300020004|Ga0193755_1005614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4054 | Open in IMG/M |
3300020021|Ga0193726_1230121 | Not Available | 763 | Open in IMG/M |
3300020579|Ga0210407_10626158 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300020580|Ga0210403_10150174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1905 | Open in IMG/M |
3300021086|Ga0179596_10428046 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300021168|Ga0210406_11004972 | Not Available | 620 | Open in IMG/M |
3300021181|Ga0210388_10672813 | Not Available | 902 | Open in IMG/M |
3300021404|Ga0210389_11066550 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300021405|Ga0210387_10224217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1638 | Open in IMG/M |
3300021411|Ga0193709_1002327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5237 | Open in IMG/M |
3300021433|Ga0210391_10046539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3456 | Open in IMG/M |
3300021475|Ga0210392_10317183 | Not Available | 1121 | Open in IMG/M |
3300021478|Ga0210402_11648300 | Not Available | 568 | Open in IMG/M |
3300022208|Ga0224495_10292406 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300022309|Ga0224510_10529769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 699 | Open in IMG/M |
3300022896|Ga0247781_1021662 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
3300023070|Ga0247755_1047274 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300023078|Ga0247756_1109595 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 540 | Open in IMG/M |
3300023274|Ga0247763_1129735 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300024056|Ga0124853_1029435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 531 | Open in IMG/M |
3300025457|Ga0208850_1080935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 521 | Open in IMG/M |
3300025627|Ga0208220_1189471 | Not Available | 506 | Open in IMG/M |
3300025679|Ga0207933_1008404 | All Organisms → cellular organisms → Bacteria | 5181 | Open in IMG/M |
3300025934|Ga0207686_11811253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300025972|Ga0207668_11782079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 556 | Open in IMG/M |
3300026121|Ga0207683_11566122 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 608 | Open in IMG/M |
3300026557|Ga0179587_10223621 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300027496|Ga0208987_1026992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
3300027516|Ga0207761_1029222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1090 | Open in IMG/M |
3300027559|Ga0209222_1055394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 763 | Open in IMG/M |
3300027629|Ga0209422_1149519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 524 | Open in IMG/M |
3300027660|Ga0209736_1002977 | All Organisms → cellular organisms → Bacteria | 5636 | Open in IMG/M |
3300027693|Ga0209704_1169043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 635 | Open in IMG/M |
3300027698|Ga0209446_1157625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 586 | Open in IMG/M |
3300027721|Ga0209492_1166571 | Not Available | 765 | Open in IMG/M |
3300027803|Ga0209910_10010546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 732 | Open in IMG/M |
3300027812|Ga0209656_10001029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17992 | Open in IMG/M |
3300027829|Ga0209773_10125305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1066 | Open in IMG/M |
3300027831|Ga0209797_10048716 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
3300027860|Ga0209611_10162725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1401 | Open in IMG/M |
3300027869|Ga0209579_10413627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 731 | Open in IMG/M |
3300027885|Ga0209450_10697052 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300027889|Ga0209380_10214894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1130 | Open in IMG/M |
3300027896|Ga0209777_10576901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
3300027897|Ga0209254_10857521 | Not Available | 609 | Open in IMG/M |
3300027900|Ga0209253_10629255 | Not Available | 783 | Open in IMG/M |
3300028574|Ga0302153_10285617 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300028665|Ga0302160_10063450 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300028710|Ga0307322_10234045 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 507 | Open in IMG/M |
3300028776|Ga0302303_10174125 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300028866|Ga0302278_10312574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
3300028879|Ga0302229_10293139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 732 | Open in IMG/M |
3300028906|Ga0308309_10572263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 980 | Open in IMG/M |
3300028906|Ga0308309_11557639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 563 | Open in IMG/M |
3300029883|Ga0311327_10547752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia | 702 | Open in IMG/M |
3300029913|Ga0311362_10736185 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300029923|Ga0311347_10195829 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300029987|Ga0311334_11645881 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 545 | Open in IMG/M |
3300029999|Ga0311339_10180790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae | 2421 | Open in IMG/M |
3300030007|Ga0311338_11779681 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300030011|Ga0302270_10144436 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300030046|Ga0302305_1209346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 703 | Open in IMG/M |
3300030053|Ga0302177_10429655 | Not Available | 688 | Open in IMG/M |
3300030058|Ga0302179_10175485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 947 | Open in IMG/M |
3300030617|Ga0311356_10301394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1606 | Open in IMG/M |
3300030677|Ga0302317_10071229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1700 | Open in IMG/M |
3300030763|Ga0265763_1022195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 675 | Open in IMG/M |
3300030862|Ga0265753_1107962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 571 | Open in IMG/M |
3300030937|Ga0138302_1721480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
3300031122|Ga0170822_15536552 | Not Available | 1327 | Open in IMG/M |
3300031231|Ga0170824_109534092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300031234|Ga0302325_11486388 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300031469|Ga0170819_15323986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Luteibacter → Luteibacter yeojuensis | 504 | Open in IMG/M |
3300031525|Ga0302326_13418269 | Not Available | 530 | Open in IMG/M |
3300031708|Ga0310686_107736707 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300031726|Ga0302321_101061237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 924 | Open in IMG/M |
3300031820|Ga0307473_10404792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
3300031834|Ga0315290_10461186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1111 | Open in IMG/M |
3300031873|Ga0315297_10095223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2351 | Open in IMG/M |
3300031902|Ga0302322_103832048 | Not Available | 514 | Open in IMG/M |
3300032143|Ga0315292_10966431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 708 | Open in IMG/M |
3300032156|Ga0315295_11742460 | Not Available | 593 | Open in IMG/M |
3300032177|Ga0315276_10935731 | Not Available | 923 | Open in IMG/M |
3300032256|Ga0315271_11734485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 536 | Open in IMG/M |
3300032397|Ga0315287_11184224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
3300033406|Ga0316604_10741312 | Not Available | 540 | Open in IMG/M |
3300033416|Ga0316622_102355600 | Not Available | 615 | Open in IMG/M |
3300033434|Ga0316613_10198853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1292 | Open in IMG/M |
3300033481|Ga0316600_10627327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica | 752 | Open in IMG/M |
3300033482|Ga0316627_102330190 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300033482|Ga0316627_102391755 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300033482|Ga0316627_102640661 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300033483|Ga0316629_10070103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1855 | Open in IMG/M |
3300033483|Ga0316629_11099162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 630 | Open in IMG/M |
3300033483|Ga0316629_11772494 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300033487|Ga0316630_11665282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 579 | Open in IMG/M |
3300033521|Ga0316616_101593665 | Not Available | 850 | Open in IMG/M |
3300033521|Ga0316616_102514547 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300033521|Ga0316616_103306264 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300034053|Ga0373890_086035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
3300034130|Ga0370494_017035 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
3300034162|Ga0373915_015448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.43% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.02% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.82% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.22% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.22% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.61% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 3.01% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.01% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.01% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.01% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.41% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.41% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.41% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.41% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.41% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.41% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.41% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.81% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.20% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.20% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.20% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.20% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.60% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.60% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.60% |
Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.60% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.60% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.60% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.60% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.60% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.60% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.60% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.60% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.60% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.60% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.60% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.60% |
Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.60% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.60% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.60% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.60% |
Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.60% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300001396 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
3300009686 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG | Environmental | Open in IMG/M |
3300009697 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022896 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L184-509B-5 | Environmental | Open in IMG/M |
3300023070 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4 | Environmental | Open in IMG/M |
3300023078 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4 | Environmental | Open in IMG/M |
3300023274 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4 | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027803 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
3300030046 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300034053 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.3 | Engineered | Open in IMG/M |
3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
3300034162 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.1 | Engineered | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E4A_05734700 | 2170459003 | Grass Soil | LYISCGLDSFLNDAARLTAFGKLRLGALSAYNLLPFTGHVETVARFERA |
LJNas_10207091 | 3300000546 | Quercus Rhizosphere | LLDDTAQLTSRGRLRLTGLTAFNLMPFTEHVETVARFERV* |
JGI20175J14863_10065981 | 3300001396 | Arctic Peat Soil | LLNDTARLISYGKLRLGALTAFNLFPFTGHVETVAGFERV* |
JGIcombinedJ26739_1010845941 | 3300002245 | Forest Soil | LLHDTAQLTSRGRLRLTGLAAFNLMPFTEHVETVARFERV* |
rootL2_102799493 | 3300003322 | Sugarcane Root And Bulk Soil | YVSCGLDSFLSDTERLLAGGRLRLSALTAFNLIPFTAHVETVARFERM* |
P52013CM_10970811 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | SFLQDAERLTSAGKLRLASLTAFNLMPFTEHVETVARFERA* |
Ga0031656_102535681 | 3300003858 | Freshwater Lake Sediment | CGLESFLDDTRYLTSLGRLRLLNLAAFNQMPFTEHVETVACFERV* |
Ga0062384_1005535993 | 3300004082 | Bog Forest Soil | VYVSCGLDSFLADAARLTSRGTLCLTALSAFNLLPFTEHVETVARFERA* |
Ga0055495_100768241 | 3300004146 | Natural And Restored Wetlands | SLLADTARLTEGGQHRLAGLSAFNLMPYTGHVETVAYFERA* |
Ga0066600_107127332 | 3300004155 | Freshwater | GLESFLEDTARLTARGRLRLIGFTAFDLMPFTEHVETVACFDRG* |
Ga0062592_1006380641 | 3300004480 | Soil | YVSCGLDSFLDDTARLTANGKLRLSDLRAFNLMPFTQHVETVACFDRALVAAPRQA* |
Ga0070670_1021342752 | 3300005331 | Switchgrass Rhizosphere | GCGLESFLADAQRLTAAGVMRLSDLRAFNLMPYTEHVETVACFERA* |
Ga0070731_102805841 | 3300005538 | Surface Soil | TARLLTPGRLRLAALTAFNLMPYTDHVETLVRFERP* |
Ga0068862_1004361881 | 3300005844 | Switchgrass Rhizosphere | IYVSCGFESFLKDTAQLTAGKLRLTGLTAFNLIPFTDHVETVARFERA* |
Ga0070766_111305262 | 3300005921 | Soil | SCGLDSFLDDTAKLTARGKLKLVGLTAFNLMPFTDHVEIVARFEPA* |
Ga0080026_100392492 | 3300005952 | Permafrost Soil | LLHDAAQLTSRGKLRLVSLAAFNLMPFTEHVETVARFERIKSSDLA* |
Ga0075017_1006776041 | 3300006059 | Watersheds | YVSCALESLLRDAVVLTSSGTLRLSSLAAFNLMPFTEHVETVACFDRV* |
Ga0075017_1013984532 | 3300006059 | Watersheds | SCDLNSLVSDSESLTAAGTLRLGSLRAFNLMPYTEHVETVACFERC* |
Ga0075014_1000683163 | 3300006174 | Watersheds | QLCMGGRMRLAGLTAWNLMPYTEHVETVAWFDRT* |
Ga0070765_1016421692 | 3300006176 | Soil | PDQFVYVSCGLESFLGDVARLTSPRKLRLVALSAFNLSPFTLHVETVARFERT* |
Ga0070765_1020259752 | 3300006176 | Soil | FLYISCGLESFLSDAARLTAAGKLRLTSLTAFNLLPFTEHVETVAGFVRG* |
Ga0075021_110629412 | 3300006354 | Watersheds | QLTSRGKLRLVEITAFNLLPFTEHVETVARFERR* |
Ga0068871_1002566054 | 3300006358 | Miscanthus Rhizosphere | ESFLSDSEQLLARGKLRLSALTAFNLIPFTEHVETVARFERA* |
Ga0079303_102364393 | 3300006930 | Deep Subsurface | LYVSCGLESLVEDTARLTSGGNLRLRGLTAFNLMPFTEHVEIVARFERA* |
Ga0105090_106417781 | 3300009075 | Freshwater Sediment | SFLSDTAQLTAAGTLRLADLSAFNLMPYTEHVETVACFERA* |
Ga0105090_106580282 | 3300009075 | Freshwater Sediment | ADAAQLTAAGILRLTDLSAFNLMPYTEHVETVACFARA* |
Ga0105106_110839982 | 3300009078 | Freshwater Sediment | FLSDTAQLTAAGTLRLADLSAFNLMPYTEHVETVACFERA* |
Ga0105098_101302901 | 3300009081 | Freshwater Sediment | LSDTARLTAGGGLRLASLAAFNLMPFTEHVETLAWFERA* |
Ga0102851_102567941 | 3300009091 | Freshwater Wetlands | SFLADTQRLTASGAMRLSDLRVFNLMPYTEHVETVACFERA* |
Ga0105102_105331881 | 3300009165 | Freshwater Sediment | VSCGLESFLDDTRYLTSRGSLRLRNLAAFNLMPFTEHVETVACFERA* |
Ga0113563_124471972 | 3300009167 | Freshwater Wetlands | LTSPGRLRLHGLAAFNLMPFTEHVETVGCFERARSQSSGR* |
Ga0113563_127294051 | 3300009167 | Freshwater Wetlands | GLDSFLTDSARLTTGGTMRLSDLRVFNLMPYTEHVETVARFERA* |
Ga0115028_101877141 | 3300009179 | Wetland | VSCGLESFLRDTARLTAGGGLRLRSLAAFDLMPFTEHVETVACLDRA* |
Ga0105237_123954762 | 3300009545 | Corn Rhizosphere | DSFLRDAEQLTLSGRMRLRTLTVFDFFPFTQHVETVARFEHI* |
Ga0105859_12959852 | 3300009651 | Permafrost Soil | DSLKGDTARLVSGGKLRLASLRAFNLLPFTEHVESVAVFDAIP* |
Ga0123338_103501861 | 3300009686 | Glacier Valley | SFSSDVERLTSRGSLRLTALTAFNLMPFTEHVETVARFERA* |
Ga0116231_105350542 | 3300009697 | Host-Associated | EAFIADTARLTASGRLRLIGLTAFNLLPYTEHVETVGRFERVYRK* |
Ga0116228_100770431 | 3300009701 | Host-Associated | ARLTASGALRLAALAAFNLFPFTEHVETVALFEAA* |
Ga0116227_100491994 | 3300009709 | Host-Associated | LSDAARLTSRGRLRLRALTAFNLLPFTEHVETVARFERV* |
Ga0116130_11267533 | 3300009762 | Peatland | GLESFLGDAARLTSNRKLRLGALTAYNLLPFTEHVETVARFERA* |
Ga0133939_10083021 | 3300010051 | Industrial Wastewater | LESFLADTARLTSGGGLRLTGLAAFDLMPHTEHVETVGVFERG* |
Ga0126356_108818182 | 3300010877 | Boreal Forest Soil | AQLTSRGKLRLRALTAFNLMPFTEHVETVARFERA* |
Ga0150985_1002172822 | 3300012212 | Avena Fatua Rhizosphere | SFLSDSEQLLARGKLRLSALTAFNLIPFTEHVETVARFERA* |
Ga0150984_1131312461 | 3300012469 | Avena Fatua Rhizosphere | FLSDTERLTGSGALRLTQLTAFNLMPFTEHVESVARFERA* |
Ga0137413_112587371 | 3300012924 | Vadose Zone Soil | VSCGLESLLRDTARLTARGRLRLGALTAFNLLPFTEHVETVACFERV* |
Ga0137416_114668282 | 3300012927 | Vadose Zone Soil | VSCGLESFLNDTAQLTARGKLRLDALTAFNLLPFTGHVETVARFERA* |
Ga0168317_10683662 | 3300012982 | Weathered Mine Tailings | LEDSATLTAAGTLRLTELTAFNLLPFTGHVETVALFERG* |
Ga0181534_104515641 | 3300014168 | Bog | SLIKDCAQLTSRGKLRLAELTAYNLMPFTEHVETVARFERA* |
Ga0181534_106374652 | 3300014168 | Bog | LHDTQRLLASGGLELRELTAFNLLPFTDHVETVAMFRRSPAAALRDG* |
Ga0181531_102808071 | 3300014169 | Bog | DVERLTAAGKLRLASLTAFNLLPFTEHVETVAVLERA* |
Ga0181526_109564771 | 3300014200 | Bog | FIYVSCGLDSFLADAARLTSGGTLQLTALTAFNLLPYTEHVEIVARFERP* |
Ga0181537_101872821 | 3300014201 | Bog | DSFLRDAARLTSRGGLRLRSLTAFNLLPFTEHVETVARFERA* |
Ga0182015_106334302 | 3300014495 | Palsa | GIQRLIAPGRLRLVALTAFNLLPFTDHVETLARLERV* |
Ga0182012_110833872 | 3300014499 | Bog | ESFLHDAARLTAHGKLRLVALTAFNLLPFTEHVETVARFERA* |
Ga0181525_103260272 | 3300014654 | Bog | FLRDTARLTAGGRLRLAALTAFNLMPFTLHIEAVARFDRT* |
Ga0181525_104970192 | 3300014654 | Bog | AARLTAHGKLRLAALTAFNLLPFTGHVETIARFEHA* |
Ga0181519_102195661 | 3300014658 | Bog | AAQLTLRGRLRLAGLTAFNLLPFTEHVETVARFERA* |
Ga0167653_10673971 | 3300015162 | Glacier Forefield Soil | GLESFLSDAARLTSRGTLRLGALCAFNLLPFTGHVETVARFERA* |
Ga0187891_12961431 | 3300017996 | Peatland | SLLDDIARLTSARAMRLAELTAFNLMPFTDHVETVARLERC |
Ga0187872_101636242 | 3300018017 | Peatland | YVSCGLESFLNDAARLILHGKLRLGSLTAFNLLPFTGHVETVARFDRT |
Ga0187881_102698002 | 3300018024 | Peatland | VYVSCGLESFLNDAARLILHGKLRLGSLTAFNLLPFTGHVETVARFDRT |
Ga0187885_103293322 | 3300018025 | Peatland | LVSLLEDIARLTSAGTMRLAELAAFNLMPFTEHVETVARLERS |
Ga0187855_102315942 | 3300018038 | Peatland | AARLISHGKLRLGELTAFNLMPFTGHVETVARFERA |
Ga0187859_103635123 | 3300018047 | Peatland | FLDDAARLTSRGGLRLGALTAFNLLPFTEHVETVARFERA |
Ga0193755_10056145 | 3300020004 | Soil | DTAQLTSRGRLRLRALNAFNLLPFTEHVETVAHFERV |
Ga0193726_12301213 | 3300020021 | Soil | CSLQSFLLDTAQLTSGKLRLVRLTAFNLMPFTGHVELVAGFERR |
Ga0210407_106261581 | 3300020579 | Soil | DSFLNDTAHLTSHGKLRLAALTAFNLLPFTEHVETVARFERA |
Ga0210403_101501741 | 3300020580 | Soil | VYVSCGLESFLSDAARLTSHGTLRLGALTAFNLLPFTEHVEIVARFERA |
Ga0179596_104280461 | 3300021086 | Vadose Zone Soil | LSDAARLTLRGRLRLSALTAFNLLPFTEHVETVARFERA |
Ga0210406_110049722 | 3300021168 | Soil | HFLYVSCGLESLMNDTARLTSRGKLRLRSLNAFNLLPFTEHVETVARFDRA |
Ga0210388_106728131 | 3300021181 | Soil | LSSFMKDVAGLLSGGRLRLSELTAFNLMPFTDHVETVATFQRI |
Ga0210389_110665503 | 3300021404 | Soil | VYVSCSLESFLSDARRLTEGGALRLCALTAFNLMPFTEHVETVARFERA |
Ga0210387_102242171 | 3300021405 | Soil | SLRRDAAQLTAHGKLRLGGLTAFNLMPFTEHVETVARFERC |
Ga0193709_10023271 | 3300021411 | Soil | HDTAQLTSRGRLRLRALNAFNLLPFTEHVETVAHFERV |
Ga0210391_100465394 | 3300021433 | Soil | DAAQLTSRGTLRLGALTAFNLLPFTEHVETVARFERA |
Ga0210392_103171831 | 3300021475 | Soil | DTGLLLSGGQMRLAELTAFNLMPFTEHVETVACFRRQDRSSSA |
Ga0210402_116483002 | 3300021478 | Soil | VSCGLESFLNDTRELLAGGGLRLTALTAFSLLPFTEHVETVARFERA |
Ga0224495_102924061 | 3300022208 | Sediment | LADTERLTTSGAMRLGDLRAFNLMPFTEHVETVACFERA |
Ga0224510_105297691 | 3300022309 | Sediment | VSCGLDSLLADTQRLTASGQLRLHGLSAFNLMPYTGHVETVACFERG |
Ga0247781_10216624 | 3300022896 | Plant Litter | ESFLSDTERLLGGGKLRLSALTAFNLIPFTEHVETVARFERISRV |
Ga0247755_10472741 | 3300023070 | Plant Litter | GLESFLSDTERLLARDKLRLSALTAFNLMPFTDHVETVARFERSQ |
Ga0247756_11095951 | 3300023078 | Plant Litter | LSDSEHLLARGKLRLSALTAFNLIPNTDHVETVARFERV |
Ga0247763_11297353 | 3300023274 | Plant Litter | GLESFLHDAEHLLATGKLRLGALTAFNLIPFTDHVETVARFERA |
Ga0124853_10294352 | 3300024056 | Freshwater Wetlands | LESFLEDTKHLTSRGRLRLKDLAAFNLMPFTEHVETVACFERA |
Ga0208850_10809352 | 3300025457 | Arctic Peat Soil | TAQLTSRGKLRLGALTAFNLLPFTEHVETVARFERA |
Ga0208220_11894711 | 3300025627 | Arctic Peat Soil | AAQLTSDGRLRLVSLTAFNLMPYTEHVESVACFERN |
Ga0207933_10084041 | 3300025679 | Arctic Peat Soil | TAQLLERGTLRLRALTAFNLMPFTEHVETVARFERA |
Ga0207686_118112531 | 3300025934 | Miscanthus Rhizosphere | SCGVESFVDDTARLVSGGQLRLAALTAYNLMPFTDHVETVARFERV |
Ga0207668_117820792 | 3300025972 | Switchgrass Rhizosphere | VSCGLDSFLSDTAQLTASGKLRLSALTAFNLMPFTEHVETVARFERT |
Ga0207683_115661221 | 3300026121 | Miscanthus Rhizosphere | LESFLSDSEQLLARGKLRLSALTAFNLIPFTEHVETVARFERA |
Ga0179587_102236212 | 3300026557 | Vadose Zone Soil | LESLLEDSAQLTARGKLRLAGLTAFNLMPFTEHVETVARFERA |
Ga0208987_10269923 | 3300027496 | Forest Soil | SGLESFVRDAAQLTSRGKLRLVSLSAFNLMPFTEHVETVARFERG |
Ga0207761_10292222 | 3300027516 | Tropical Forest Soil | MARGKLRLAALAAFDFLPYTGHVETVARFERNYMN |
Ga0209222_10553941 | 3300027559 | Forest Soil | SCGLESLLRDAAQLTSRGTLRLASLTAFNLMPFTEHVETVARLERG |
Ga0209422_11495192 | 3300027629 | Forest Soil | GLESLLHDTAALTSRGKLRLGALTAFNLLPFTEHVETVARFERA |
Ga0209736_100297710 | 3300027660 | Forest Soil | FLNDTAHLTSHGKIRLAALTAFNLLPFTEHVETVARFERA |
Ga0209704_11690431 | 3300027693 | Freshwater Sediment | DTARLTAGGGLRLASLAAFNLMPFTEHVETLAWFERA |
Ga0209446_11576251 | 3300027698 | Bog Forest Soil | LDSFLADVARLTSRGTLRLVALSAFNLLPFTEHVETVARFESA |
Ga0209492_11665713 | 3300027721 | Freshwater Sediment | LGDTARLTSRGELRLAELAAFNLMPFTEHVETVACFERA |
Ga0209910_100105462 | 3300027803 | Thawing Permafrost | CSLPSFDLDARRLTADGRLRLAALSVFDLMPFTEHVEILARFERV |
Ga0209656_1000102920 | 3300027812 | Bog Forest Soil | YVSCGLESFLDDAARLTSLGRLRLGALTAFNLMPFTGHVETVARFERV |
Ga0209773_101253053 | 3300027829 | Bog Forest Soil | VTAARFLADVARLTSRGTLRLVALSAFNLLPFTEHVETVARFESA |
Ga0209797_100487162 | 3300027831 | Wetland Sediment | GLDSFLADTERLTSSGRLRLNGLAAFNLMPFTEHVETVACFERA |
Ga0209611_101627253 | 3300027860 | Host-Associated | FMNDAARLTSQGSLRLRELTAFNLLPFTEHVETVARFERV |
Ga0209579_104136271 | 3300027869 | Surface Soil | TARLLTPGRLRLAALTAFNLMPYTDHVETLVRFERP |
Ga0209450_106970521 | 3300027885 | Freshwater Lake Sediment | ARLTAGGAMRLRDLRVFNLMPYTEHVETVACFERA |
Ga0209380_102148943 | 3300027889 | Soil | MDSFLLDAARLTSRGKLRLVALSAFNLLPFTEHVETVARFERA |
Ga0209777_105769012 | 3300027896 | Freshwater Lake Sediment | ESLRHDTARLTSHGKLRLGALSAFNLFPFTGHVETVARFERA |
Ga0209254_108575211 | 3300027897 | Freshwater Lake Sediment | ESFLADTENLTASSVMRLRSLRAFNLMPYTEHVETVACFERA |
Ga0209253_106292553 | 3300027900 | Freshwater Lake Sediment | VSCGLGSFLDDTARLTAGGKLRLCGLTAFDLMPFTEHVETVACFDRA |
Ga0302153_102856171 | 3300028574 | Bog | FIYVSCSLDSLLADTELLLGSGRLRLTALYAFNLMPFTEHVETVACFERI |
Ga0302160_100634501 | 3300028665 | Fen | SEQLLAPGKLRLSALTAFNLIPNTCHVETVARFERV |
Ga0307322_102340452 | 3300028710 | Soil | SCGLESFLSDCARLLLHGKLRLSALTAFNLIPFTEHVETVARFERV |
Ga0302303_101741252 | 3300028776 | Palsa | LESFLEDAARLTSHGKLRLRELAVFNLLPFTGHVETVARFERA |
Ga0302278_103125742 | 3300028866 | Bog | CGVDSLLNDTARLTSGGALRLVSLTAFNLMPFTEHVETVAGFERVR |
Ga0302229_102931391 | 3300028879 | Palsa | LESLLRDVERLTCGGKLRLAALTAFNLLPFTEHVETVARFERAQP |
Ga0308309_105722631 | 3300028906 | Soil | SCGLESFLDDTAKLTSRGKLRLAGLTAFNLMPFTDHVETVARFEPA |
Ga0308309_115576392 | 3300028906 | Soil | VGDAARLVSSGKLRLAALSAFNFLPFTEHVETVARFERA |
Ga0311327_105477521 | 3300029883 | Bog | RSDAARLTYRGGLRMTSVTAFDLMPYTEHTETVACFERA |
Ga0311362_107361852 | 3300029913 | Bog | SFLKETARLTSGGRLRLVALSAFNLMPFTEHVETVARFERIA |
Ga0311347_101958293 | 3300029923 | Fen | DCEQLLAGGKMRLTALTAFNLIPFTEHVETVARFERA |
Ga0311334_116458811 | 3300029987 | Fen | AERLTERGTLRLRALTAFNLMPFTDHVETVARFERA |
Ga0311339_101807904 | 3300029999 | Palsa | FLRDTAQLTSRGKLRLCALAAFNLMPFTEHVETVARFERAVVFSGR |
Ga0311338_117796811 | 3300030007 | Palsa | FLRDTARLTHGGKLRLSALTAFNLLPFTEHVETVARFERS |
Ga0302270_101444361 | 3300030011 | Bog | TELLLGSGRLRLTALYAFNLMPFTEHVETVACFERI |
Ga0302305_12093462 | 3300030046 | Palsa | SFLRDTAQLTSRGKLRLCALAAFNLMPFTEHVETVARFERAVVFSGR |
Ga0302177_104296551 | 3300030053 | Palsa | DTAQLTAAGQVRLSALTAFNLLPFTTHVETLARFERA |
Ga0302179_101754851 | 3300030058 | Palsa | RDVERLTCGGKLRLAALTAFNLLPFTEHVETVARFERAQP |
Ga0311356_103013944 | 3300030617 | Palsa | LNDTALLTSRGKLRLVALTAFNLLPFTEHVETVARFERA |
Ga0302317_100712291 | 3300030677 | Palsa | SFRRDTAQLTARGKLRLSALTAFDLLPYTEHVETVACFELA |
Ga0265763_10221953 | 3300030763 | Soil | VSCGIESLLRDAAQLTSRGRLRLVSLTAFNLMPFTEHVESVACFERG |
Ga0265753_11079622 | 3300030862 | Soil | LPAPLDSLLRDAARLTARGTLRLGALTAFNLLPFTEHVEIVARFERA |
Ga0138302_17214803 | 3300030937 | Soil | LLRDAAQLTSGGKLRLVSLTAFNLMPFTEHVETVARFERS |
Ga0170822_155365521 | 3300031122 | Forest Soil | LDSFLNDTARLTSGGKLRLAALTAFNLLPFTEHVETVARFERA |
Ga0170824_1095340921 | 3300031231 | Forest Soil | SFIKDVAGLLGGGQLRLSELTAFNLMPFTDHVETVANFQRI |
Ga0302325_114863882 | 3300031234 | Palsa | VSCGLDSFLNDAAQLTSRGKLRLSTLTAFNLMPFTEHVETVACFDRR |
Ga0170819_153239862 | 3300031469 | Forest Soil | RFLYISCGLDSLLTDAARLTAPGKLRLGALSAYNLLPFTGHVETVARFERA |
Ga0302326_134182692 | 3300031525 | Palsa | AQLTGTGKLRLTALKAFNLLPFTTHVETLARFERA |
Ga0310686_1077367072 | 3300031708 | Soil | LKDTAQLTAGKLRLAALTAFNLMPFTEHVETLARFERA |
Ga0302321_1010612373 | 3300031726 | Fen | MSCALESLQRDTERLCAGGGLRLAGLQAWNLMPYTEHVETVAWFEHA |
Ga0307473_104047921 | 3300031820 | Hardwood Forest Soil | GLDSFLKDSAHLTSNGKLRLTAVTAFNLVPFTEHVETVARFERT |
Ga0315290_104611861 | 3300031834 | Sediment | VEDTARLTSGGRLRLCGLTAFNLMPFTEHVETVARFERA |
Ga0315297_100952231 | 3300031873 | Sediment | VSCGLESLLEDTARLTSGGRLRLCGLTAFNLMPFTEHVEAVARFERA |
Ga0302322_1038320481 | 3300031902 | Fen | VSCGLESFLSDAERLTERGTLRLRALTAFNLMPFTDHVETVARFERA |
Ga0315292_109664311 | 3300032143 | Sediment | GLESFLEDTARLTAGGKLRLSGLSAFNLMPFTEHVETVACFKRA |
Ga0315295_117424602 | 3300032156 | Sediment | ESLVEDTARLTSGGSLRLCGLTAFNLMPFTEHVETVARFERA |
Ga0315276_109357311 | 3300032177 | Sediment | VSCGLESFLEDTARLTATGRLRLSSLTAFNLMPFTEHVETVGCFERV |
Ga0315271_117344852 | 3300032256 | Sediment | GLESFLDDTTLLTSGGKLRLRDLSAFNLMPFTEHVETVACFERA |
Ga0315287_111842241 | 3300032397 | Sediment | DSFLADTERLTSSGKLRLGGLTVFNLMPFTEHVETVACFERA |
Ga0316604_107413122 | 3300033406 | Soil | GLDSLLADTGRLTSGGALRLSDLRAFNLMPYTEHVETVACFLRT |
Ga0316622_1023556001 | 3300033416 | Soil | DTARLTSPGKMRLRGLTAFNLMPFTEHVETVACFERA |
Ga0316613_101988531 | 3300033434 | Soil | LESFLRDTARLTAGGGLRLRSLAAFNLMPFTEHVETVACFDRA |
Ga0316600_106273273 | 3300033481 | Soil | SFIRDTAVLVAAGQLQLRGLTAFNLMPYTEHVETVGVFARA |
Ga0316627_1023301902 | 3300033482 | Soil | LESLLADTARLTSGGKLRLRGLTAFNLMPFTEHVETVACFERA |
Ga0316627_1023917551 | 3300033482 | Soil | VSCGLDSFMSDAALLAAGGRLRLAEITAFNLMPFTEHVETVACFDRT |
Ga0316627_1026406611 | 3300033482 | Soil | GLESFLADTARLTSGGKLRLRGLTAFNLMPFTEHVETVARFERT |
Ga0316629_100701034 | 3300033483 | Soil | CGLDSFMSDAAVLTASGQLRLAEITAFNLMPFTEHVETVACFDRT |
Ga0316629_110991621 | 3300033483 | Soil | LESFLRDIARLTAGGGLHLRSLAAFDLMPFTEHVETVACLDRA |
Ga0316629_117724942 | 3300033483 | Soil | TARLTSGGKLRLRGLTAFNLMPFTEHVETVARFERT |
Ga0316630_116652821 | 3300033487 | Soil | IYVSCGLESFLRDTARLTAGGGLRLRSLAAFNLMPFTEHVETVACLDRA |
Ga0316616_1015936651 | 3300033521 | Soil | ESLLEDTARLTSSGKLRLGNLTAFNLMPFTEHVETVACFERA |
Ga0316616_1025145472 | 3300033521 | Soil | CGLDSFMSDAALLAAGGRLRLAEITAFNLMPFTEHVETVACFDRT |
Ga0316616_1033062641 | 3300033521 | Soil | SFLSDTARLTSGGAMRLRDLTAFNLMPYTEHVETVGCFDPA |
Ga0373890_086035_2_151 | 3300034053 | Sediment Slurry | IYVSCGLASLLDDTERLTSSGRLRLGSLSAFNLMPFTGHVETVGCFERN |
Ga0370494_017035_1710_1853 | 3300034130 | Untreated Peat Soil | VSCGLASFLSDAERLITPGKLRLAALTAFNLLPFTEHVETVARFERG |
Ga0373915_015448_1_117 | 3300034162 | Sediment Slurry | LTATGALRLRELRAYNLMPYTDHVETLARFERTDQPRA |
⦗Top⦘ |