Basic Information | |
---|---|
Family ID | F038297 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 166 |
Average Sequence Length | 48 residues |
Representative Sequence | MGQAAKPTRQNRTITVDFQDEATYFQLLGDTKAFVEFVLAFILS |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 166 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 94.58 % |
% of genes near scaffold ends (potentially truncated) | 81.33 % |
% of genes from short scaffolds (< 2000 bps) | 93.98 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.301 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.699 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.940 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.217 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.56% β-sheet: 0.00% Coil/Unstructured: 69.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 166 Family Scaffolds |
---|---|---|
PF12759 | HTH_Tnp_IS1 | 1.81 |
PF03050 | DDE_Tnp_IS66 | 1.20 |
PF01161 | PBP | 1.20 |
PF01381 | HTH_3 | 1.20 |
PF03631 | Virul_fac_BrkB | 1.20 |
PF00072 | Response_reg | 0.60 |
PF04365 | BrnT_toxin | 0.60 |
PF04255 | DUF433 | 0.60 |
PF00873 | ACR_tran | 0.60 |
PF05368 | NmrA | 0.60 |
PF13359 | DDE_Tnp_4 | 0.60 |
PF05016 | ParE_toxin | 0.60 |
PF00034 | Cytochrom_C | 0.60 |
PF00078 | RVT_1 | 0.60 |
PF13592 | HTH_33 | 0.60 |
PF14104 | DUF4277 | 0.60 |
PF00903 | Glyoxalase | 0.60 |
PF00892 | EamA | 0.60 |
PF07042 | TrfA | 0.60 |
PF02771 | Acyl-CoA_dh_N | 0.60 |
PF01656 | CbiA | 0.60 |
PF13586 | DDE_Tnp_1_2 | 0.60 |
PF00194 | Carb_anhydrase | 0.60 |
PF13701 | DDE_Tnp_1_4 | 0.60 |
PF01609 | DDE_Tnp_1 | 0.60 |
PF07045 | DUF1330 | 0.60 |
PF14384 | BrnA_antitoxin | 0.60 |
PF12686 | DUF3800 | 0.60 |
PF02350 | Epimerase_2 | 0.60 |
PF13714 | PEP_mutase | 0.60 |
PF00872 | Transposase_mut | 0.60 |
PF01850 | PIN | 0.60 |
PF00528 | BPD_transp_1 | 0.60 |
PF07592 | DDE_Tnp_ISAZ013 | 0.60 |
PF13551 | HTH_29 | 0.60 |
PF13145 | Rotamase_2 | 0.60 |
PF01594 | AI-2E_transport | 0.60 |
PF00239 | Resolvase | 0.60 |
PF13546 | DDE_5 | 0.60 |
PF01551 | Peptidase_M23 | 0.60 |
PF00296 | Bac_luciferase | 0.60 |
PF00684 | DnaJ_CXXCXGXG | 0.60 |
PF13640 | 2OG-FeII_Oxy_3 | 0.60 |
PF13560 | HTH_31 | 0.60 |
PF02796 | HTH_7 | 0.60 |
PF13751 | DDE_Tnp_1_6 | 0.60 |
PF01526 | DDE_Tnp_Tn3 | 0.60 |
PF13424 | TPR_12 | 0.60 |
PF01610 | DDE_Tnp_ISL3 | 0.60 |
PF00881 | Nitroreductase | 0.60 |
PF13340 | DUF4096 | 0.60 |
PF03400 | DDE_Tnp_IS1 | 0.60 |
PF13231 | PMT_2 | 0.60 |
PF01051 | Rep_3 | 0.60 |
PF01425 | Amidase | 0.60 |
PF02515 | CoA_transf_3 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
---|---|---|---|
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.20 |
COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.20 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.20 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.60 |
COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.60 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.60 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.60 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.60 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.60 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.60 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.60 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.60 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.60 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.60 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.60 |
COG3338 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.60 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.60 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.60 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.60 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.60 |
COG5527 | Protein involved in initiation of plasmid replication | Mobilome: prophages, transposons [X] | 0.60 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.90 % |
Unclassified | root | N/A | 24.10 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_103398717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum brasilense | 520 | Open in IMG/M |
3300000955|JGI1027J12803_104603783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 859 | Open in IMG/M |
3300000956|JGI10216J12902_108233531 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300000956|JGI10216J12902_113419885 | Not Available | 1110 | Open in IMG/M |
3300001139|JGI10220J13317_11365268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 707 | Open in IMG/M |
3300001228|SwM_135023 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 522 | Open in IMG/M |
3300001431|F14TB_101031071 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 663 | Open in IMG/M |
3300003993|Ga0055468_10164145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 668 | Open in IMG/M |
3300003998|Ga0055472_10215793 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 595 | Open in IMG/M |
3300005174|Ga0066680_10926648 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300005180|Ga0066685_10303386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S5133MH4 | 1106 | Open in IMG/M |
3300005294|Ga0065705_11043480 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 513 | Open in IMG/M |
3300005295|Ga0065707_10484862 | Not Available | 770 | Open in IMG/M |
3300005332|Ga0066388_107116195 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 563 | Open in IMG/M |
3300005332|Ga0066388_107947287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 530 | Open in IMG/M |
3300005334|Ga0068869_101339848 | Not Available | 632 | Open in IMG/M |
3300005343|Ga0070687_100893150 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 636 | Open in IMG/M |
3300005441|Ga0070700_100835798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
3300005445|Ga0070708_100464003 | Not Available | 1195 | Open in IMG/M |
3300005471|Ga0070698_100109841 | All Organisms → cellular organisms → Bacteria | 2724 | Open in IMG/M |
3300005518|Ga0070699_100212679 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
3300005536|Ga0070697_101174459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 684 | Open in IMG/M |
3300005557|Ga0066704_10926008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 539 | Open in IMG/M |
3300005559|Ga0066700_10321319 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 1092 | Open in IMG/M |
3300005598|Ga0066706_11529299 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005617|Ga0068859_102851079 | Not Available | 530 | Open in IMG/M |
3300005764|Ga0066903_104170610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 773 | Open in IMG/M |
3300005937|Ga0081455_10001877 | All Organisms → cellular organisms → Bacteria | 25286 | Open in IMG/M |
3300006032|Ga0066696_10673174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 666 | Open in IMG/M |
3300006046|Ga0066652_101564162 | Not Available | 608 | Open in IMG/M |
3300006196|Ga0075422_10015791 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
3300006800|Ga0066660_10317182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 1251 | Open in IMG/M |
3300006846|Ga0075430_100102972 | All Organisms → cellular organisms → Bacteria | 2383 | Open in IMG/M |
3300006846|Ga0075430_100676095 | Not Available | 851 | Open in IMG/M |
3300006847|Ga0075431_100230643 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
3300006847|Ga0075431_101451759 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 645 | Open in IMG/M |
3300006853|Ga0075420_101757865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 531 | Open in IMG/M |
3300006880|Ga0075429_100449988 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1128 | Open in IMG/M |
3300007076|Ga0075435_100937765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 755 | Open in IMG/M |
3300007076|Ga0075435_100985474 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 736 | Open in IMG/M |
3300007255|Ga0099791_10222667 | Not Available | 892 | Open in IMG/M |
3300007255|Ga0099791_10463770 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300007258|Ga0099793_10152254 | Not Available | 1095 | Open in IMG/M |
3300009012|Ga0066710_101958790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 872 | Open in IMG/M |
3300009089|Ga0099828_10335104 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1363 | Open in IMG/M |
3300009089|Ga0099828_10925811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 778 | Open in IMG/M |
3300009089|Ga0099828_11302406 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 643 | Open in IMG/M |
3300009090|Ga0099827_11132380 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 680 | Open in IMG/M |
3300009090|Ga0099827_11580018 | Not Available | 571 | Open in IMG/M |
3300009100|Ga0075418_10185694 | Not Available | 2214 | Open in IMG/M |
3300009137|Ga0066709_101974321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 809 | Open in IMG/M |
3300009137|Ga0066709_102341820 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 729 | Open in IMG/M |
3300009137|Ga0066709_104324052 | Not Available | 518 | Open in IMG/M |
3300009143|Ga0099792_10940391 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300009147|Ga0114129_10056696 | All Organisms → cellular organisms → Bacteria | 5486 | Open in IMG/M |
3300009147|Ga0114129_10788692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1213 | Open in IMG/M |
3300009147|Ga0114129_11562689 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 809 | Open in IMG/M |
3300009147|Ga0114129_11700228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 770 | Open in IMG/M |
3300009147|Ga0114129_13189654 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 533 | Open in IMG/M |
3300009147|Ga0114129_13331907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 519 | Open in IMG/M |
3300009156|Ga0111538_13511793 | Not Available | 544 | Open in IMG/M |
3300009162|Ga0075423_10258563 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
3300009168|Ga0105104_10041755 | All Organisms → cellular organisms → Bacteria | 2524 | Open in IMG/M |
3300009545|Ga0105237_12439863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Acaryochloridaceae → Acaryochloris | 533 | Open in IMG/M |
3300009800|Ga0105069_1040441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
3300009811|Ga0105084_1012525 | Not Available | 1328 | Open in IMG/M |
3300010043|Ga0126380_11808671 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 553 | Open in IMG/M |
3300010046|Ga0126384_10798930 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 844 | Open in IMG/M |
3300010046|Ga0126384_11150674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 713 | Open in IMG/M |
3300010046|Ga0126384_11714874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 594 | Open in IMG/M |
3300010047|Ga0126382_10808472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 800 | Open in IMG/M |
3300010047|Ga0126382_11079590 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 710 | Open in IMG/M |
3300010047|Ga0126382_11837303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 571 | Open in IMG/M |
3300010047|Ga0126382_11845744 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300010047|Ga0126382_11852449 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 569 | Open in IMG/M |
3300010048|Ga0126373_10555038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1197 | Open in IMG/M |
3300010359|Ga0126376_11169416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 782 | Open in IMG/M |
3300010359|Ga0126376_11833387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 645 | Open in IMG/M |
3300010360|Ga0126372_10821608 | Not Available | 923 | Open in IMG/M |
3300010362|Ga0126377_10696862 | Not Available | 1068 | Open in IMG/M |
3300010362|Ga0126377_11777375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
3300010366|Ga0126379_11794320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 717 | Open in IMG/M |
3300010399|Ga0134127_12708356 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300011119|Ga0105246_11789550 | Not Available | 587 | Open in IMG/M |
3300011119|Ga0105246_12240392 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 532 | Open in IMG/M |
3300012096|Ga0137389_11468008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 578 | Open in IMG/M |
3300012199|Ga0137383_10613239 | Not Available | 796 | Open in IMG/M |
3300012199|Ga0137383_11319114 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 514 | Open in IMG/M |
3300012201|Ga0137365_10567619 | Not Available | 832 | Open in IMG/M |
3300012202|Ga0137363_10396645 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1149 | Open in IMG/M |
3300012203|Ga0137399_10902590 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300012205|Ga0137362_10465926 | Not Available | 1094 | Open in IMG/M |
3300012205|Ga0137362_11489024 | Not Available | 563 | Open in IMG/M |
3300012207|Ga0137381_10934377 | Not Available | 749 | Open in IMG/M |
3300012350|Ga0137372_10350272 | Not Available | 1131 | Open in IMG/M |
3300012351|Ga0137386_11179749 | Not Available | 537 | Open in IMG/M |
3300012358|Ga0137368_10419342 | Not Available | 875 | Open in IMG/M |
3300012361|Ga0137360_10139365 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
3300012362|Ga0137361_10263676 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300012582|Ga0137358_10384043 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 950 | Open in IMG/M |
3300012898|Ga0157293_10160780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 644 | Open in IMG/M |
3300012925|Ga0137419_10093036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia yuzhufengensis | 2068 | Open in IMG/M |
3300012929|Ga0137404_10109221 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
3300012929|Ga0137404_11126095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 720 | Open in IMG/M |
3300012930|Ga0137407_10730431 | Not Available | 933 | Open in IMG/M |
3300012930|Ga0137407_11149474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
3300012930|Ga0137407_11411883 | Not Available | 662 | Open in IMG/M |
3300012948|Ga0126375_10592007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 845 | Open in IMG/M |
3300012948|Ga0126375_11453576 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300012971|Ga0126369_10573435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1195 | Open in IMG/M |
3300012971|Ga0126369_13375257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 523 | Open in IMG/M |
3300012977|Ga0134087_10040338 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
3300013306|Ga0163162_10113364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 2810 | Open in IMG/M |
3300013306|Ga0163162_10514035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1327 | Open in IMG/M |
3300014267|Ga0075313_1012241 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
3300014268|Ga0075309_1184189 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanophagales → unclassified Methanophagales → Methanophagales archaeon | 546 | Open in IMG/M |
3300014487|Ga0182000_10303976 | Not Available | 666 | Open in IMG/M |
3300015054|Ga0137420_1355591 | Not Available | 1674 | Open in IMG/M |
3300015241|Ga0137418_11097173 | Not Available | 567 | Open in IMG/M |
3300015245|Ga0137409_10594060 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300015371|Ga0132258_12046924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1440 | Open in IMG/M |
3300015371|Ga0132258_13928528 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300015374|Ga0132255_104230749 | Not Available | 609 | Open in IMG/M |
3300016357|Ga0182032_11799502 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300016422|Ga0182039_11582007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 598 | Open in IMG/M |
3300017947|Ga0187785_10588209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 569 | Open in IMG/M |
3300018053|Ga0184626_10251120 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 742 | Open in IMG/M |
3300018076|Ga0184609_10093654 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300018076|Ga0184609_10358367 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 680 | Open in IMG/M |
3300018082|Ga0184639_10261615 | Not Available | 914 | Open in IMG/M |
3300018431|Ga0066655_11166115 | Not Available | 543 | Open in IMG/M |
3300018433|Ga0066667_11841452 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 549 | Open in IMG/M |
3300018466|Ga0190268_11906049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 541 | Open in IMG/M |
3300018468|Ga0066662_10514072 | Not Available | 1095 | Open in IMG/M |
3300019361|Ga0173482_10071433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium | 1189 | Open in IMG/M |
3300019377|Ga0190264_11665226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 566 | Open in IMG/M |
3300019789|Ga0137408_1246318 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300020170|Ga0179594_10279184 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 632 | Open in IMG/M |
3300021081|Ga0210379_10440805 | Not Available | 577 | Open in IMG/M |
3300024330|Ga0137417_1391597 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
3300025901|Ga0207688_11059162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 512 | Open in IMG/M |
3300025915|Ga0207693_10144515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1870 | Open in IMG/M |
3300025915|Ga0207693_11134781 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 592 | Open in IMG/M |
3300025940|Ga0207691_10933939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 725 | Open in IMG/M |
3300025961|Ga0207712_10339340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1245 | Open in IMG/M |
3300025961|Ga0207712_10342671 | Not Available | 1240 | Open in IMG/M |
3300026075|Ga0207708_11303774 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300026116|Ga0207674_11372550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 676 | Open in IMG/M |
3300026308|Ga0209265_1179079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 560 | Open in IMG/M |
3300026507|Ga0257165_1089155 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300027490|Ga0209899_1109345 | Not Available | 522 | Open in IMG/M |
3300027643|Ga0209076_1077554 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300027643|Ga0209076_1187214 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300027846|Ga0209180_10321271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Competibacteraceae → Candidatus Competibacter → Candidatus Competibacter phosphatis | 885 | Open in IMG/M |
3300027880|Ga0209481_10278154 | Not Available | 846 | Open in IMG/M |
3300027882|Ga0209590_10689483 | Not Available | 654 | Open in IMG/M |
3300027903|Ga0209488_10202739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1494 | Open in IMG/M |
3300028792|Ga0307504_10228800 | Not Available | 672 | Open in IMG/M |
3300031228|Ga0299914_11494928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 527 | Open in IMG/M |
3300031421|Ga0308194_10145184 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 727 | Open in IMG/M |
3300031740|Ga0307468_100208889 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
3300031854|Ga0310904_10538861 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300031858|Ga0310892_10603220 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300032002|Ga0307416_101607438 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 755 | Open in IMG/M |
3300032205|Ga0307472_101577274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 644 | Open in IMG/M |
3300034147|Ga0364925_0260210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 646 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.05% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.43% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.61% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.41% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.81% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.81% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.20% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.20% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.20% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.20% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.20% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.60% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.60% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.60% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.60% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.60% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300001228 | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined | Host-Associated | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009800 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1033987171 | 3300000955 | Soil | MGQSAKPTRQNRTITVDFHDETTYAELLGNTKAFVEFVLAFL |
JGI1027J12803_1046037832 | 3300000955 | Soil | MGQTAKPPRQNRTITVDFHNETTYFALVGNPKAFVEFVLAFLLS |
JGI10216J12902_1082335311 | 3300000956 | Soil | MGQSAKSPRQNRTITVDFHDETTYAALIGNPKAFVEFVLAFLLSLGFQLL |
JGI10216J12902_1134198854 | 3300000956 | Soil | MGQTAKATRANRTITVDFHDEATYDRLLDDTKAFVELILAFLLST |
JGI10220J13317_113652682 | 3300001139 | Soil | MTRKNRTITVDFHNEATYDQLLDDTKAFVEFVLAFLLAL |
SwM_1350231 | 3300001228 | Switchgrass Rhizosphere | MGQAAKPTRHNRTITVDFHDETTYLALLDTPHAFVEFVLAFLLALSAFSSSTKPAAV |
F14TB_1010310711 | 3300001431 | Soil | MGQTAKPTRHNRTITVDFHDETTYFALLDNSQAFVEFV |
Ga0055468_101641451 | 3300003993 | Natural And Restored Wetlands | MGQTAKAPRQNRTITVDFQDESTYFQLIHDGKAFVEFVLAF |
Ga0055472_102157931 | 3300003998 | Natural And Restored Wetlands | MGQTAKAPRQNRTITVDFQDESTYFQLIHDGKAFVEFVLAFILS |
Ga0066680_109266482 | 3300005174 | Soil | MGHAAKPIRHNRTLTVDFHDEATYFGLLAHTNAFVEFVLAFLLALGFQLLHKASCSE |
Ga0066685_103033862 | 3300005180 | Soil | MGQAAKPTRHNRTLTIDFHDETTYAELLGNTKAFVEFVFAFVLSIGFQ |
Ga0065705_110434801 | 3300005294 | Switchgrass Rhizosphere | MGQSAKPTRQNRTITVDFHDETTYAELLGNTKAFVEFVLAFILCLGFQLIHTQN* |
Ga0065707_104848621 | 3300005295 | Switchgrass Rhizosphere | MAQAAKTPRQNRTITVDFHDEATYSQLLDDTKAFIECVLAFIL |
Ga0066388_1071161951 | 3300005332 | Tropical Forest Soil | VSIAAKPRRENRTITIDFHNEATYFRLIDDGKAFVECVLAFLLALGFQLLHK |
Ga0066388_1079472871 | 3300005332 | Tropical Forest Soil | MGHAAKATRQNRTITVDFQDPSTYFQLINDRKAFVEFVLAFLL |
Ga0068869_1013398481 | 3300005334 | Miscanthus Rhizosphere | MGHAAKPTRHNRTLTIDFHDETTYAEILGNTKAFVEFVLAFIL |
Ga0070687_1008931501 | 3300005343 | Switchgrass Rhizosphere | MGQTVKPTRHNRTITVDFHDETTYAELLGHTKAFLEVVFAFLL |
Ga0070700_1008357982 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQTAKPIRENRTITIDFHDESTYAELLGNTKAFVEFVFAFIRVAGKIMSW* |
Ga0070708_1004640031 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQTAKATRENRTITVDSHDETTYFALLGNTKAFVEFVFAFLLALGFQLLHKASCSEG |
Ga0070698_1001098412 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MASDQGMKQGHAAKPTHYNRTLTIDFHDETTSAALLGHTKAFVEFVLAFLLSLGFQLLHQTSGRAGGSLTRHSP* |
Ga0070699_1002126792 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MASDQGMKQGTAAKPTHYNRTLTIDFHDETTSAALLGHTKAFVEFVLAFLLSLGFQLLHQTSGRAGGSLTRHSP* |
Ga0070697_1011744592 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LAKAATQTRHNRTITVDFHDETTYPHLLDDGNAFLEWVLAFIL* |
Ga0066704_109260081 | 3300005557 | Soil | MGQSAKAIRHNRTITVDFQDQSTYFQLLSDGKAFVEFVLAFLLA |
Ga0066700_103213193 | 3300005559 | Soil | MGPAAKPTRHNRTISVDFQDEVTYFQLLGDTKAFVEFVL |
Ga0066706_115292991 | 3300005598 | Soil | MGQAAKPTRHNRTLTIDFHDETTYAELLGNTKAFVEFVLAFILAIGCQLTHKASCSEGGS |
Ga0068859_1028510791 | 3300005617 | Switchgrass Rhizosphere | MGHAAKPPRHNRTITVDFHDETTYVALLGNTTAFVECVLAFLLALRLSAPPQGQL |
Ga0066903_1041706101 | 3300005764 | Tropical Forest Soil | MDNAAKAIRENRTITVDVQDQSTYFQLISDGKAFVEFV |
Ga0081455_1000187729 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGQTAKATRANRTITVDFHDEATYDRLLGDTKAFVECILAFLLSTG |
Ga0066696_106731742 | 3300006032 | Soil | MGPAAKPTRHNRTISVDFQDEVTYFQLLGDTKAFVEFVLAFILSLGFQLLHKASC |
Ga0066652_1015641621 | 3300006046 | Soil | MGPAAKPPRHNRTSSVDFQDEVTYFQLLGDTKAFVEFVLAFILSLGFQLLH |
Ga0075422_100157913 | 3300006196 | Populus Rhizosphere | MRQGSKRIRYNRTITIDFQDEATYFRLLDNGKAFVECVLAFLLSRVAGNRV* |
Ga0066660_103171821 | 3300006800 | Soil | MGQAAKPTRHNRTITVDFQDEATYFQLLGDTQAFVEFVLAFLLSLGF |
Ga0075430_1001029725 | 3300006846 | Populus Rhizosphere | MGQTAKVTRKNRTITVDFHNEATYDQLLDDTKAFVE |
Ga0075430_1006760952 | 3300006846 | Populus Rhizosphere | MGQTAQPTRHNRTITVDFHDETTYFTLVGNPKAFVEFVLAFLLSLGFQLLHKA |
Ga0075431_1002306433 | 3300006847 | Populus Rhizosphere | MRQTAKPTRENRTITVDFHDETTYFALLGNTKAFIE |
Ga0075431_1014517592 | 3300006847 | Populus Rhizosphere | MGPAAKPTRQNRTITVDFQDEATYFQLLGDSQAFVEFVLAFL |
Ga0075420_1017578652 | 3300006853 | Populus Rhizosphere | MRHRAKATRHNRTITVDFCDESTYFQVLSDGKAFVE |
Ga0075429_1004499883 | 3300006880 | Populus Rhizosphere | MGHTAKPTRQNRTITVDFQDETTYFQLLGDTQAFVEFVCA |
Ga0075435_1009377652 | 3300007076 | Populus Rhizosphere | MAQTTQVTRQNRTLTVDFQNPSTYFELINDGKAFVEFVFAFILSIGFQLAHK |
Ga0075435_1009854741 | 3300007076 | Populus Rhizosphere | MGHAAKPIRHNRTITVDFRDETTYFALLGDTKAFVECVLAFLLSLG |
Ga0099791_102226671 | 3300007255 | Vadose Zone Soil | MGHAAKPIRHNRTLTVDFHDEATYFGLLDHTNAFVEFVLAFLLALGFQLLHKASCSE |
Ga0099791_104637703 | 3300007255 | Vadose Zone Soil | MGQRAKPTRHTRTITVDFHDETTYAELLGNTKAFVEFV |
Ga0099793_101522541 | 3300007258 | Vadose Zone Soil | MGNAAKSTRQNRTLTVDFHDETTYFALLDNTKAFVEFLLAFLLSIG |
Ga0066710_1019587903 | 3300009012 | Grasslands Soil | MGHAAKPRRHTRTLPVDFHDEATSFGLLDNALAFVEFVLACLLARA |
Ga0099828_103351041 | 3300009089 | Vadose Zone Soil | MGQAAKPTRQNRTITVDFQDEATYFQLLGDTKAFVEFVLAFILS |
Ga0099828_109258113 | 3300009089 | Vadose Zone Soil | MAQAATLTRENRTITVDFHDETTYVGLLGNSHAFVEFVLAFLLALGFQLL |
Ga0099828_113024061 | 3300009089 | Vadose Zone Soil | MGQTAKVTRENRTLTVDFHDETTYFALLGTTKACVEFVLAFLLSIGFQLLHK |
Ga0099827_111323801 | 3300009090 | Vadose Zone Soil | MVQAVKPPRSNRTLTVDFHDETTYFALLGNTHAFVEFVLAFLL |
Ga0099827_115800181 | 3300009090 | Vadose Zone Soil | MGQSAKATRQNCTIIVDFHDESTYLQLLSDGKAFVE* |
Ga0075418_101856941 | 3300009100 | Populus Rhizosphere | MPQAAKSKRHNRTITVDFHDEATYSQLLGDGKAFIEFVLAFI |
Ga0066709_1019743213 | 3300009137 | Grasslands Soil | MGQAAKPPRQNRTLTLDFRDETTYSELLGNTKAFVEFVLAFILAIGCQLTHKASCSEGGSLTRH |
Ga0066709_1023418203 | 3300009137 | Grasslands Soil | MEQAAKPTRQNRTITVDFQDEATYFQLLGDTKAFVEFVLAFLLSLGF |
Ga0066709_1043240521 | 3300009137 | Grasslands Soil | MGQTVKATRANRTITVDCHNAATYGQLLDATKACVECVLAFLLSTGFQLLHKASCSAGGR |
Ga0099792_109403911 | 3300009143 | Vadose Zone Soil | MGQTAIPTRHNRTLTVDFHDETTYFALLDNTHAFVEFVLAFLLALGFQLLHKAS |
Ga0114129_100566961 | 3300009147 | Populus Rhizosphere | MGQSAKPTRQNRTITVDFHDETTYAELLGNTKAFVEFVLAF |
Ga0114129_107886921 | 3300009147 | Populus Rhizosphere | MGNATKATRQNRTLTVDFHDETTYCALLDNTKAFVEFVLAFILSI |
Ga0114129_115626892 | 3300009147 | Populus Rhizosphere | MGHAAKPTRQNRTLTVDFRDETTYAELLGTPKAFVEF |
Ga0114129_117002281 | 3300009147 | Populus Rhizosphere | MGQATQRIQQNRTITVDFQDEATYFQLLGDTKMCVEF |
Ga0114129_131896542 | 3300009147 | Populus Rhizosphere | MGQSAKPRRENRTITVDFHDASTYFQLIDDGKAFMEFVLAFI |
Ga0114129_133319071 | 3300009147 | Populus Rhizosphere | VGQSAKPPRQNRTITVDFQEPSTYVQLMNDGKAFV |
Ga0111538_135117932 | 3300009156 | Populus Rhizosphere | VTRTNRTITVDFHNEATYDQLRDDTKAFVEFVLAFL |
Ga0075423_102585632 | 3300009162 | Populus Rhizosphere | MEQAAKPTRHNRTITVDFQDEATYFQLLGDTQAFV* |
Ga0105104_100417554 | 3300009168 | Freshwater Sediment | MGQTTKATRENRTITVDFHDETTYSELLGNTRAFVEFVLAFLFSLSAFSSSTRLAAVRAGV* |
Ga0105237_124398632 | 3300009545 | Corn Rhizosphere | MGQTAKPIRENRTITIDFHDESTYAELLDNTKAFVEFVFAFILS |
Ga0105069_10404411 | 3300009800 | Groundwater Sand | MGHAAKPIRHNRTITVDFRDEATYFALLGTTKAFVELVLAFLLSLGFQLT |
Ga0105084_10125251 | 3300009811 | Groundwater Sand | MAQAATLTRENRTITVDFHDETTYFGLLGNPHAFVEFVLAFLLALGF |
Ga0126380_118086711 | 3300010043 | Tropical Forest Soil | MRQTAKPTRENRTITVDFHDETTYFALLGNTQAFLEFVLAFFLSIGFQLAHKAT |
Ga0126384_107989301 | 3300010046 | Tropical Forest Soil | MAQTTQVTRQNRTLTVDFQDPSTYFELIHDGKAFVEFVFAFILSLGFQLA |
Ga0126384_111506743 | 3300010046 | Tropical Forest Soil | MGQTAKPTRHNRTITVDFHDETTYFALVGNPKAFV* |
Ga0126384_117148741 | 3300010046 | Tropical Forest Soil | MGQSAKPTRQNRTITVDFQEPSTYLQLMNDGKAFVE |
Ga0126382_108084722 | 3300010047 | Tropical Forest Soil | MAQTTKVTRQNRTLTVDFQDPSTYSELIRNGKAFVEFVLA |
Ga0126382_110795902 | 3300010047 | Tropical Forest Soil | MGPLAKPTRENRIITVDFHDEMTSFALLGHTKAFVEIVLAFILSIGFQLKHQATCSARGSLTRHSP* |
Ga0126382_118373031 | 3300010047 | Tropical Forest Soil | MGHAAKSTRQNRTITVDFQDPSTYFQLINDRKAFVEFVLAFLLSL |
Ga0126382_118457442 | 3300010047 | Tropical Forest Soil | MRQTATPTRKNRTITVDFHDEATYFALLGDTKAFVEFVLAFIL |
Ga0126382_118524492 | 3300010047 | Tropical Forest Soil | MGQRAKPTRQNRTITVDFNDETTYCQLLDDTKAFVEFVFAFILSLGFQL |
Ga0126373_105550381 | 3300010048 | Tropical Forest Soil | MEQAAKSARHNRTITVDFHDEATYFQLLDDPQAFVEC |
Ga0126376_111694161 | 3300010359 | Tropical Forest Soil | MAQTTQMTRQNRTLTVDFQDPSTYFELINDGKAFVEFVFAFLLSIGFQLAHKTRFSRISW |
Ga0126376_118333872 | 3300010359 | Tropical Forest Soil | MGPTVKPTRQNRTITIDFHDESTYFQLLSDGKAFVELILAFLLSIGFQLTHKATCTSGGCLT |
Ga0126372_108216081 | 3300010360 | Tropical Forest Soil | MAQTTQVTRQNRTLTVDFQDPSTYFELINDGKAFVEFVFAFILS |
Ga0126377_106968622 | 3300010362 | Tropical Forest Soil | VGQAAKATRANCTITVDFHDEATYDRLLDDTKAFV |
Ga0126377_117773752 | 3300010362 | Tropical Forest Soil | MGHAAKPTRHNRTITVDFHDEATYFRLLGDGKVFVDLVLAFLWTLGF* |
Ga0126379_117943202 | 3300010366 | Tropical Forest Soil | VQATKATRQNRTLTIDFQDPSTYFELINDGKAFVECVLAFILSIG |
Ga0134127_127083561 | 3300010399 | Terrestrial Soil | MAQTTQVTRQNRTLTVDFQDPSTYFELINDGKEFVEFVFAFILSLGFQLAHK |
Ga0105246_117895501 | 3300011119 | Miscanthus Rhizosphere | MGHAAKSTRQNRTLTVDFHDETTYFALLDNTKAFVEFVLAFILSIGFQLHH |
Ga0105246_122403922 | 3300011119 | Miscanthus Rhizosphere | MGQTAKPIRENRTITIDFHDESTYAALLGNTKAFVEFVFAFIRVAGKIM* |
Ga0137389_114680081 | 3300012096 | Vadose Zone Soil | MGLSAKPTRQNRTITVDFQEPSTYLQLMNDGKAFVEFVFAFLLS |
Ga0137383_106132391 | 3300012199 | Vadose Zone Soil | MGQTVKATRANRTITVDFHNAATYGQLLDDTKACVE |
Ga0137383_113191141 | 3300012199 | Vadose Zone Soil | MGHATKPIRHNRTITVDFRDETTYCALLGNTTAFVEFVFAFFLTLGFQ |
Ga0137365_105676191 | 3300012201 | Vadose Zone Soil | MGQTAKVTRENRTITVNFHHEATYDQLLDHPKAFVEFVLAFLLSI |
Ga0137363_103966452 | 3300012202 | Vadose Zone Soil | MGQTAKPIRANRTITIDFHEESTYAALLGNTKALVECVFAFILSLGFQLTHKSTCSSGGC |
Ga0137399_109025901 | 3300012203 | Vadose Zone Soil | MGQAAKPIRQNRTITVDFQDETTYVQLLDDGKAFVELVLAFLLAL |
Ga0137362_104659261 | 3300012205 | Vadose Zone Soil | MGQAAKPTRQNRTITVDFQDEATYFQLLGDTQAFVEFVRAFLLS |
Ga0137362_114890241 | 3300012205 | Vadose Zone Soil | MGQAATPTRHNRTIIVDFQDEATYLQLLGDTKAFVEFVLAFLLSLGFQLLHKASCSE |
Ga0137381_109343771 | 3300012207 | Vadose Zone Soil | MGQAAKPTRHHRTLTIDFHDETTYAALLGNTTAFVEFGPACAFKQ* |
Ga0137372_103502721 | 3300012350 | Vadose Zone Soil | MGPAAKPTRQNRTITVDFQDEATYFQLLGDTTVFVEFV |
Ga0137386_111797491 | 3300012351 | Vadose Zone Soil | MGQTAKVTRKNRTITVDFHNEATYDQLLDDTKAFVEF |
Ga0137368_104193423 | 3300012358 | Vadose Zone Soil | MGKAAKRPRHNRTITVDVHDEATYFQLLDNGKAFVELVIAFILALGFQLR |
Ga0137360_101393651 | 3300012361 | Vadose Zone Soil | MGQRAKPTRDNRTITVDFHDETTCVALLGNTKALVEFVLAFHLSMGLQRTPQARGSAGGGRP |
Ga0137361_102636761 | 3300012362 | Vadose Zone Soil | MGQTAKPRRENRTITIDFHDETTYFALLGNTKAFVEFVFAFVLSIGFQL |
Ga0137358_103840433 | 3300012582 | Vadose Zone Soil | MGQRAKPTRDNRTITVDFHDETTCVALLGNTKALVEFVLAFHLSMGLQRTPQAAAARAAAGRATSMRPVSVWAL |
Ga0157293_101607801 | 3300012898 | Soil | TTRQNRTLTVDFQDSSTYFELISDGKAFVEFVLTFILSIGFQLAHKATCRGGGCF* |
Ga0137419_100930363 | 3300012925 | Vadose Zone Soil | MGQTAKPIRADRTITIDFHDETTYFALLGNTKAFVEFVFAFVLSIGFQLTHKP |
Ga0137404_101092212 | 3300012929 | Vadose Zone Soil | MGKAAKRPRHNRTITVDFHDEATYFQLLDDGKALVELVLAFI* |
Ga0137404_111260951 | 3300012929 | Vadose Zone Soil | MGQTAKPTRENRTIIVDFHDETTYFTLLGNTKGFVEFVLAFLLSLSFQLQHKATCH |
Ga0137407_107304313 | 3300012930 | Vadose Zone Soil | MGQTAKPPRQNRTLTVDFHNETTYFALLGHTKAFIECVLAFILS |
Ga0137407_111494741 | 3300012930 | Vadose Zone Soil | MGQTAKPTRHNRTSTVACHDETTSCALLDNPQAVVEFVLAFLL |
Ga0137407_114118831 | 3300012930 | Vadose Zone Soil | MGQTATVTRKNRTITVDFHHEATYDQLLDDTKAFVEFVLAWLLALGFQLLPKARC |
Ga0126375_105920072 | 3300012948 | Tropical Forest Soil | MGQTATPTRQNRTITVDFHDETTYFELLSNTKAFVEFVLAFVLSLGFQLLQRAAAARAGA |
Ga0126375_114535762 | 3300012948 | Tropical Forest Soil | MRQTATPTRKNRTITVDFHDEATYFALLGDTKAFVEFVL |
Ga0126369_105734352 | 3300012971 | Tropical Forest Soil | VTRQNRTLTVDFKDPSTYFELINDGKAFVEFVFAFLLSIGFQLAHKTRFSRISW* |
Ga0126369_133752571 | 3300012971 | Tropical Forest Soil | MAKTANRIRKNRTLTVDFQDESTYFQLMDNGKAFVEFVLAFILALGFQLT |
Ga0134087_100403381 | 3300012977 | Grasslands Soil | MGPAAKPTRHNRTISVDFQDEATYFQLLGDTKAFVEFVLAFILSLGFQLLHTQN* |
Ga0163162_101133645 | 3300013306 | Switchgrass Rhizosphere | MAQTTKTTRQNRIITVDFQDPSTYFQLISDGKAFAEFVLAFILSLGFQLTHKATCTSGGSL* |
Ga0163162_105140351 | 3300013306 | Switchgrass Rhizosphere | MILTAKPTRENRTITVDFHDETTYFALLGNTQAFIEFVLAFLLSIGFQL |
Ga0075313_10122411 | 3300014267 | Natural And Restored Wetlands | MGQAAKATRQNRTITVDFQDESTYFQLIHDGKALVEFVLAFI |
Ga0075309_11841892 | 3300014268 | Natural And Restored Wetlands | MGQTAKAPRENRTITVDFQDDSTYFELIHDGKAFVEFVL |
Ga0182000_103039761 | 3300014487 | Soil | MGRTTKAIRENRAITVDFHDETTYSELLGNTKAFVEFVLAF |
Ga0137420_13555911 | 3300015054 | Vadose Zone Soil | MGQAAKPTRHNRTLTIDFHDETTYAALLGNTKAFVEFVLAFLLALGFQ |
Ga0137418_110971731 | 3300015241 | Vadose Zone Soil | MGQAAKPTRHNRTLTIDFHDETTYAALLGNTKAFVEFVLAFLLALGFQLLHKASCSEGGSLTRHS |
Ga0137409_105940601 | 3300015245 | Vadose Zone Soil | MGNATKAPGDNRTMTVDFQDESTYVPLPSDGKAFVEFVVALLLALGFQL |
Ga0132258_120469241 | 3300015371 | Arabidopsis Rhizosphere | MVQAAKSTRAIRTLTVDVNDETFFFALLGNTHAFVE |
Ga0132258_139285282 | 3300015371 | Arabidopsis Rhizosphere | MGRAVKPTRHNRTITVDFHDETTYAALLGNTTAFVEFVLAFILSL* |
Ga0132255_1042307492 | 3300015374 | Arabidopsis Rhizosphere | MGRAVKPTRHNRTITVDFHDETTYAALLGNTTALVEFVLAFILCL* |
Ga0182032_117995022 | 3300016357 | Soil | MRQTATPTRKNRTITIDFHDEATYFALLGDTKAFVEFVLAFILSIGFQLAHKTTC |
Ga0182039_115820072 | 3300016422 | Soil | MRQTATPTRKNRTITIDFHDEATYFALLGDTKAFVEFVLAFILSIGFQLAHKTT |
Ga0187785_105882092 | 3300017947 | Tropical Peatland | MSSRQIPIRHNRTIYVDFKDEANYSKLIGSSKAFVEFV |
Ga0184626_102511201 | 3300018053 | Groundwater Sediment | MGQAAKPTRQNRTITVDFQDEATYFQLLGDTKAFVEFVLAFILSLGFQ |
Ga0184609_100936543 | 3300018076 | Groundwater Sediment | MGHTAKPTRENRTITVDCHDETTYFALVGHTKAFVEFVLAFILSIGLQLNHKTPCWRLSS |
Ga0184609_103583671 | 3300018076 | Groundwater Sediment | MGHAAKPPRHNRTITVDFHDETTYFALLGNPNAFVEF |
Ga0184639_102616151 | 3300018082 | Groundwater Sediment | MAQAAKPTRHNRTITVDFHNEATYFALLSDGKAFIEFVLAFFL |
Ga0066655_111661152 | 3300018431 | Grasslands Soil | MGQSAKPTRQNRTITVDFHDETTYSELLGNTKAFVEFVLAFILSLGFQLIHKAS |
Ga0066667_118414521 | 3300018433 | Grasslands Soil | MGPAAKPTRHNRTISVDFQDEVTYFQLLGDTKAFVEFVLAFIL |
Ga0190268_119060491 | 3300018466 | Soil | MAQTTKATRQNRTLTVDFQDPSTYFELIRNGQAFVE |
Ga0066662_105140721 | 3300018468 | Grasslands Soil | MGPTAKPIRQNRTITVNSHDESTYFQLLRDGKAFVELILAFMLLIGFQLTHK |
Ga0173482_100714331 | 3300019361 | Soil | MAQTTKTTRQNRTLTVDFQASSTYFELISDGKAFVEFVLAFVLSLG |
Ga0190264_116652261 | 3300019377 | Soil | MGNGAKTTRQNRTITVNFQDPSTYFQLISDGKAFVEFVLAFILSLGFQRHHQASSTATAL |
Ga0137408_12463181 | 3300019789 | Vadose Zone Soil | MGQFAKPTRENRTITVDFHDETTYFALVGNTKAFVEFVLAFILSIGFQSSST |
Ga0179594_102791841 | 3300020170 | Vadose Zone Soil | MGQLAKPTRENRTVTVDFHDETTYFELLGNTKAFVEFVLAFILSIGFQLKHKATCSG |
Ga0210379_104408051 | 3300021081 | Groundwater Sediment | MVQAVKPPRANRTLTVDFHDETTYFALLGNTHAFVEF |
Ga0137417_13915972 | 3300024330 | Vadose Zone Soil | MGQTAKPIRENRTITIDFHDETTYFALLGNTKAFVEFVFAFVLSIGFQLTHKPTL |
Ga0207688_110591621 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQTAKAPRQNRTITVNFHDPSTYFQLISDGKAFVEFVLAFILSLGFQLTHKATCTSGGS |
Ga0207693_101445152 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQTTKATRQNRTITVDFQDPSTYFQLISDGKAFVEFVQQQLDVFE |
Ga0207693_111347812 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQAAKPTRHNRTLTIDFQDETTYAELLGNTKAFVEFVLAFLLALGFQLLHKASCSEG |
Ga0207691_109339392 | 3300025940 | Miscanthus Rhizosphere | MAQDAKPTRHNRTITVDCHNEATFFALLSDGKAFIEFVLAFFLAL |
Ga0207712_103393401 | 3300025961 | Switchgrass Rhizosphere | MRQTAKPTRENRTITVDFHDETTYFALLGNTQAFIEFV |
Ga0207712_103426711 | 3300025961 | Switchgrass Rhizosphere | LATAAAQTRYNRTITIDFHDETTYAHLLNDGKAFLDYGLAFILSIGLQLI |
Ga0207708_113037741 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQTAKPIRENRTITIDFHDESTYAELLGNTKAFVEFVFAFIRVAGKIM |
Ga0207674_113725501 | 3300026116 | Corn Rhizosphere | MGPTTKPTRQNRTITVDFHDESTYFQLLSDGKAFVELIL |
Ga0209265_11790792 | 3300026308 | Soil | MAQTTKATRQNRTLTVDFQDPSTYFELIRNGQAFVEFVLAFILSIGFQLAH |
Ga0257165_10891551 | 3300026507 | Soil | MGQRAKPTRDNRTITVDFHDETTCVALLGNTKALVEFVLAFHLSMGLQRTPQAAAARAAAGRATSMR |
Ga0209899_11093451 | 3300027490 | Groundwater Sand | MGQTAKVTRENRTITVNFHNEATYDQLLDNTKAFVEFVLAFLLSIGFQLLHKTSCS |
Ga0209076_10775541 | 3300027643 | Vadose Zone Soil | MGQTAKPIRADRTITIDFHDETTYFALLGNTKAFVEFVFAFVL |
Ga0209076_11872141 | 3300027643 | Vadose Zone Soil | MGQRAKPTRDNRTITVDFHDETTCVALLGNTKALVEFVLAFHLSMGLQRTPQAAA |
Ga0209180_103212712 | 3300027846 | Vadose Zone Soil | MGQTAKVTRKNRTITVDFHNEATYDQLLDNTKAFVEFVLAFLLALGFQLLHK |
Ga0209481_102781542 | 3300027880 | Populus Rhizosphere | MGQTTKAPRENRTITVDFHNESTYFQLLDDGPALVEFVLAFILA |
Ga0209590_106894831 | 3300027882 | Vadose Zone Soil | MGHAAKPIRHNRTLTVDFHDEATYFGLLDNTNTFVEFVLAFLLALGF |
Ga0209488_102027391 | 3300027903 | Vadose Zone Soil | MAHTAKPTRENRTMTVDFHDAATYCALLSDGKAFVEFVLAVILSLGLQLTHKST |
Ga0307504_102288001 | 3300028792 | Soil | MGQTAKVTRVNRTITIDFHDETTSFALLGNTKAFVEFVFAFVLSIGFQLTHKPM |
Ga0299914_114949281 | 3300031228 | Soil | MGQTAKAPRQNRTLTVDFQDPSTYFELLSNGKAFVEFVLAFILSIGFQLTHKATCTGGG |
Ga0308194_101451842 | 3300031421 | Soil | MGQTAKPRRENRTITIDFRDETTYFALLGNTKAFVEFVFAFVLSIGFQHTHKPTCSGGGCLTR |
Ga0307468_1002088892 | 3300031740 | Hardwood Forest Soil | MGQTATPTRHNRTITVDFHDETTYFVLVANPKAFVEFVLAFLLSIGF |
Ga0310904_105388611 | 3300031854 | Soil | MGQTAKPTRHNRTITVDFHDETTYFALVGNPKAFVAFVLAFLLSLGFPLLHKASC |
Ga0310892_106032203 | 3300031858 | Soil | MGQTVKPTRQNRTITVDFHDETTYAELLGNTTAFLEVVFAFLLAIGFQLTHQA |
Ga0307416_1016074382 | 3300032002 | Rhizosphere | MEHAAKPIRHNRTITVNFRDEATYFALLGTTKAFVEFVLA |
Ga0307472_1015772741 | 3300032205 | Hardwood Forest Soil | ITVDFQDETTYFRLLDDGKVFVEFVLAFLLSLGLSTQT |
Ga0364925_0260210_219_368 | 3300034147 | Sediment | MAQAAKLTRENRTITVDFHDETTYFALVGNTKAFVEFVLAFGRVPTRCG |
⦗Top⦘ |