NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037901

Metagenome / Metatranscriptome Family F037901

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037901
Family Type Metagenome / Metatranscriptome
Number of Sequences 167
Average Sequence Length 47 residues
Representative Sequence MHEIVNARRPVVGEKVVRDAATQNQGKVRLGEGAAPVFAPRAIR
Number of Associated Samples 131
Number of Associated Scaffolds 167

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.60 %
% of genes near scaffold ends (potentially truncated) 95.81 %
% of genes from short scaffolds (< 2000 bps) 91.62 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.407 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(33.533 % of family members)
Environment Ontology (ENVO) Unclassified
(44.910 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.317 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 22.22%    Coil/Unstructured: 77.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 167 Family Scaffolds
PF00892EamA 54.49
PF04392ABC_sub_bind 5.99
PF02743dCache_1 2.99
PF00027cNMP_binding 0.60
PF00196GerE 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 167 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 5.99
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 2.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.41 %
UnclassifiedrootN/A3.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_27213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium833Open in IMG/M
2228664022|INPgaii200_c0951530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium743Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2382420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1017Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10003621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4192Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1099446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10063282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium809Open in IMG/M
3300004633|Ga0066395_10822581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300005167|Ga0066672_11019452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300005332|Ga0066388_100746299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1579Open in IMG/M
3300005332|Ga0066388_104071510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium745Open in IMG/M
3300005332|Ga0066388_108607155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300005363|Ga0008090_10118572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium810Open in IMG/M
3300005363|Ga0008090_15886420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium796Open in IMG/M
3300005434|Ga0070709_10079451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2136Open in IMG/M
3300005439|Ga0070711_100403910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1109Open in IMG/M
3300005471|Ga0070698_100032257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5426Open in IMG/M
3300005471|Ga0070698_101358090Not Available661Open in IMG/M
3300005713|Ga0066905_101895867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300005764|Ga0066903_104883237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium712Open in IMG/M
3300005764|Ga0066903_106654418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium601Open in IMG/M
3300005764|Ga0066903_107875746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300005764|Ga0066903_108775840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300006028|Ga0070717_10795051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium860Open in IMG/M
3300006038|Ga0075365_10376358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1002Open in IMG/M
3300006042|Ga0075368_10512778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300006172|Ga0075018_10842412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300006844|Ga0075428_100572678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1207Open in IMG/M
3300006844|Ga0075428_100731335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1053Open in IMG/M
3300006854|Ga0075425_101970246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium654Open in IMG/M
3300007265|Ga0099794_10063301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1800Open in IMG/M
3300009094|Ga0111539_11886048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium693Open in IMG/M
3300009137|Ga0066709_101502265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium972Open in IMG/M
3300009147|Ga0114129_12810044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium578Open in IMG/M
3300009162|Ga0075423_10614781All Organisms → cellular organisms → Bacteria → Proteobacteria1145Open in IMG/M
3300010043|Ga0126380_10089759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1810Open in IMG/M
3300010046|Ga0126384_11116926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium723Open in IMG/M
3300010047|Ga0126382_10169685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1518Open in IMG/M
3300010047|Ga0126382_10715173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium842Open in IMG/M
3300010047|Ga0126382_11131296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium696Open in IMG/M
3300010048|Ga0126373_10146945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2236Open in IMG/M
3300010048|Ga0126373_11527913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium733Open in IMG/M
3300010358|Ga0126370_10711132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium884Open in IMG/M
3300010358|Ga0126370_11093938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium734Open in IMG/M
3300010359|Ga0126376_13001073Not Available521Open in IMG/M
3300010360|Ga0126372_13064139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300010361|Ga0126378_11994213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium661Open in IMG/M
3300010362|Ga0126377_10144706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2226Open in IMG/M
3300010362|Ga0126377_10731946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1044Open in IMG/M
3300010362|Ga0126377_10967062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium917Open in IMG/M
3300010371|Ga0134125_10385532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1555Open in IMG/M
3300010376|Ga0126381_102762362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium701Open in IMG/M
3300010398|Ga0126383_12929542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300011271|Ga0137393_11107392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium673Open in IMG/M
3300012096|Ga0137389_10274553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1422Open in IMG/M
3300012189|Ga0137388_10538497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1085Open in IMG/M
3300012198|Ga0137364_10661994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium788Open in IMG/M
3300012211|Ga0137377_11325078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300012211|Ga0137377_11433834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300012285|Ga0137370_10446284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium787Open in IMG/M
3300012353|Ga0137367_10414825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium954Open in IMG/M
3300012356|Ga0137371_11094985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium599Open in IMG/M
3300012360|Ga0137375_11002562Not Available657Open in IMG/M
3300012361|Ga0137360_11355284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium613Open in IMG/M
3300012363|Ga0137390_10779847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium914Open in IMG/M
3300012582|Ga0137358_10985007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300012948|Ga0126375_10829322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium735Open in IMG/M
3300012987|Ga0164307_10599002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium849Open in IMG/M
3300015371|Ga0132258_11457967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1729Open in IMG/M
3300016270|Ga0182036_10728858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium804Open in IMG/M
3300016294|Ga0182041_10964800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium769Open in IMG/M
3300016319|Ga0182033_11603849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium588Open in IMG/M
3300016319|Ga0182033_11901476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300016319|Ga0182033_11921718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300016319|Ga0182033_12180656Not Available506Open in IMG/M
3300016341|Ga0182035_11594868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium588Open in IMG/M
3300016357|Ga0182032_11850973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300016371|Ga0182034_10645689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium896Open in IMG/M
3300016404|Ga0182037_10355731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1194Open in IMG/M
3300016404|Ga0182037_11829844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300016422|Ga0182039_11889811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium548Open in IMG/M
3300016445|Ga0182038_10488701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1048Open in IMG/M
3300018031|Ga0184634_10363125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium664Open in IMG/M
3300018067|Ga0184611_1082865Not Available1101Open in IMG/M
3300018072|Ga0184635_10140242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium964Open in IMG/M
3300018073|Ga0184624_10020398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2466Open in IMG/M
3300018074|Ga0184640_10123238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1142Open in IMG/M
3300018077|Ga0184633_10151148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1204Open in IMG/M
3300018468|Ga0066662_10117285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1933Open in IMG/M
3300018469|Ga0190270_10004759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7004Open in IMG/M
3300018482|Ga0066669_11510019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium611Open in IMG/M
3300025898|Ga0207692_10063847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1915Open in IMG/M
3300025906|Ga0207699_10172417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1448Open in IMG/M
3300025910|Ga0207684_10026042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4985Open in IMG/M
3300025910|Ga0207684_10154147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1977Open in IMG/M
3300025915|Ga0207693_10205560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1548Open in IMG/M
3300026550|Ga0209474_10033588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3814Open in IMG/M
3300026551|Ga0209648_10776193All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300026551|Ga0209648_10779025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300027663|Ga0208990_1186328Not Available532Open in IMG/M
3300027874|Ga0209465_10396809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium690Open in IMG/M
3300028755|Ga0307316_10003250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5066Open in IMG/M
3300028782|Ga0307306_10263488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300028793|Ga0307299_10002419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6341Open in IMG/M
3300028819|Ga0307296_10008523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5363Open in IMG/M
3300030990|Ga0308178_1012879All Organisms → cellular organisms → Bacteria → Proteobacteria1210Open in IMG/M
3300031543|Ga0318516_10248116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1029Open in IMG/M
3300031543|Ga0318516_10304398All Organisms → cellular organisms → Bacteria → Proteobacteria921Open in IMG/M
3300031545|Ga0318541_10420177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium747Open in IMG/M
3300031545|Ga0318541_10497059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium682Open in IMG/M
3300031546|Ga0318538_10302713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium861Open in IMG/M
3300031561|Ga0318528_10118733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1397Open in IMG/M
3300031561|Ga0318528_10118897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1396Open in IMG/M
3300031564|Ga0318573_10028683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2585Open in IMG/M
3300031572|Ga0318515_10282228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium890Open in IMG/M
3300031573|Ga0310915_10343402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1057Open in IMG/M
3300031573|Ga0310915_11249950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300031668|Ga0318542_10410807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300031679|Ga0318561_10777040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300031724|Ga0318500_10037516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1989Open in IMG/M
3300031736|Ga0318501_10830301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300031747|Ga0318502_10202098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1149Open in IMG/M
3300031763|Ga0318537_10109254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1025Open in IMG/M
3300031764|Ga0318535_10125059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1138Open in IMG/M
3300031764|Ga0318535_10439817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300031771|Ga0318546_10510839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium843Open in IMG/M
3300031782|Ga0318552_10227612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium945Open in IMG/M
3300031796|Ga0318576_10418004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium633Open in IMG/M
3300031832|Ga0318499_10111106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1063Open in IMG/M
3300031833|Ga0310917_10676233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium699Open in IMG/M
3300031835|Ga0318517_10341512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300031845|Ga0318511_10047305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1713Open in IMG/M
3300031845|Ga0318511_10377771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium647Open in IMG/M
3300031859|Ga0318527_10169566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium919Open in IMG/M
3300031860|Ga0318495_10500011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300031879|Ga0306919_10262743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1301Open in IMG/M
3300031890|Ga0306925_11142133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium784Open in IMG/M
3300031896|Ga0318551_10283833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium929Open in IMG/M
3300031897|Ga0318520_11054321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300031910|Ga0306923_10743292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1088Open in IMG/M
3300031910|Ga0306923_10826943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1020Open in IMG/M
3300031912|Ga0306921_12350008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300031941|Ga0310912_10426302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1033Open in IMG/M
3300031941|Ga0310912_10991234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300031942|Ga0310916_11090885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300031942|Ga0310916_11473750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300031946|Ga0310910_10631781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium848Open in IMG/M
3300031947|Ga0310909_10420989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1121Open in IMG/M
3300031947|Ga0310909_11540518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300031954|Ga0306926_10205060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2446Open in IMG/M
3300031959|Ga0318530_10310246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium652Open in IMG/M
3300032008|Ga0318562_10679498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300032044|Ga0318558_10068015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1614Open in IMG/M
3300032051|Ga0318532_10186984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium735Open in IMG/M
3300032052|Ga0318506_10367069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300032054|Ga0318570_10533047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300032055|Ga0318575_10345061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium754Open in IMG/M
3300032055|Ga0318575_10404999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium692Open in IMG/M
3300032059|Ga0318533_10533425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium860Open in IMG/M
3300032059|Ga0318533_11169272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300032065|Ga0318513_10155290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1093Open in IMG/M
3300032065|Ga0318513_10258183All Organisms → cellular organisms → Bacteria → Proteobacteria844Open in IMG/M
3300032065|Ga0318513_10557352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300032090|Ga0318518_10439471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium668Open in IMG/M
3300032094|Ga0318540_10414738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300033289|Ga0310914_10931124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium768Open in IMG/M
3300033289|Ga0310914_11283558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium634Open in IMG/M
3300033290|Ga0318519_10995262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil33.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.19%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.99%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.80%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.20%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.20%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.60%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.60%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_000550002199352025SoilMHEIVNARRPVVGDKVERDAATCNQGKVRLGDAAPVFAP
INPgaii200_095153012228664022SoilMNANLNAPRSVRCGDKVERDTATCNQGQVQLGDAAPVFAPRRPVIGD
ICChiseqgaiiDRAFT_238242023300000033SoilMHEIVNARRPVVGDKVERDAATCNQGKVRLGDAAPVFAPRRPVVGDKVERD
AF_2010_repII_A1DRAFT_1000362113300000597Forest SoilMYEIVNARRPVVGDKVMRDAATHNPGKVQLGDGAPVFAPPAIRAGDK
AF_2010_repII_A100DRAFT_109944623300000655Forest SoilMHEIVNARRPVVGDKVERDAATHNQGKVRLGEGSAPVFAPRAIRSGE
AF_2010_repII_A001DRAFT_1006328223300000793Forest SoilMHEIVNARRPVVGDKVERDAATHNQGKVRLGEGSA
Ga0066395_1082258123300004633Tropical Forest SoilMREIVNARMPVVGEKVVRDAATHNPGKVQLGDGAPVFAPPA
Ga0066672_1101945213300005167SoilMHEIVNARRPVLGEKVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVRD
Ga0066388_10074629933300005332Tropical Forest SoilMQEIVNARRPVSGEKVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVR
Ga0066388_10407151023300005332Tropical Forest SoilMHEIVNARRPVVGEKVVRDAATHNPGKVQLGEGSAPVFAPRAIR
Ga0066388_10860715523300005332Tropical Forest SoilMYEIVNARRPVVGDKVMRDAATHNPGKVQLGDGAPVFAPPAI
Ga0008090_1011857213300005363Tropical Rainforest SoilMHEIVNARRPVVGAKVVRDAATHNPGKVQLGEGSAPAFAPRAIRSGEKVVRDAATHN
Ga0008090_1588642013300005363Tropical Rainforest SoilMHKIVNARRPVVGENVVRDAATHNQGKVHLGEGAAPAFAPRAIRSGE
Ga0070709_1007945113300005434Corn, Switchgrass And Miscanthus RhizosphereMYEIVNARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAP
Ga0070711_10040391023300005439Corn, Switchgrass And Miscanthus RhizosphereMYEIVNARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFTPRA
Ga0070698_10003225713300005471Corn, Switchgrass And Miscanthus RhizosphereMYEIVNARRPVVGDKVMRDAASHNAGKVQLGDGAPVFAPPAIRAGDKVMRDA
Ga0070698_10135809013300005471Corn, Switchgrass And Miscanthus RhizosphereMSANLNAPRPIRCGDKVGRDTATRNEGKVQLGDAAPIFAPRRAVMGDKVGRD
Ga0066905_10189586723300005713Tropical Forest SoilMYEIVNARRPVVGDKVMRDAATHNPGKVQLGDGAPVFAPPAIRAGDKVMRDAATHNP
Ga0066903_10488323713300005764Tropical Forest SoilMHEIVNARRPVVGEKVVRDAATQNQGKVRLGEGAAPVFAPRAIRSGEKVVRD
Ga0066903_10665441823300005764Tropical Forest SoilMHKIVNARGPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKV
Ga0066903_10787574623300005764Tropical Forest SoilMRKIVNARRPVVGERVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVRDAA
Ga0066903_10877584023300005764Tropical Forest SoilMHEIVNTRRPVVGEKVVRDAATHNPGKVQLGEGSAPVFA
Ga0070717_1079505123300006028Corn, Switchgrass And Miscanthus RhizosphereMYEIVNARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFTPRAIRSGEKVVRDAATHNQ
Ga0075365_1037635813300006038Populus EndosphereMHEIVNARRPVAGDKVERDAATCNQGKVRLGDAAPVFAPRRP
Ga0075368_1051277813300006042Populus EndosphereMHKIVNVRRPVVGQKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSG
Ga0075018_1084241223300006172WatershedsMHEIVNARRPVVGDKVERDAATCNQGKVRLGDAAPVFAPRRPVVG
Ga0075428_10057267823300006844Populus RhizosphereMHKIVNVRRPVVGEKVVRDDATHNQGKVQLGEGAAPVFAPRA
Ga0075428_10073133523300006844Populus RhizosphereMHEIVNARRPVVGDNVERDAATCNQGKVRLGDAAPVFAPRRPAMGDTVERDAATC
Ga0075425_10197024623300006854Populus RhizosphereMHEIVKVRRPVVGEKVVRDAATLNQGKVQLGEGAAPVFAPRAIR
Ga0099794_1006330123300007265Vadose Zone SoilMLEIVKVRRPVVGEKVVRDAATQNQGTVQLGEGAAPVFGR*
Ga0111539_1188604823300009094Populus RhizosphereMHEIVNPRRPVVGDKVERDAATCNQGKVRLGDAAPVFAPR
Ga0066709_10150226513300009137Grasslands SoilMHEIVKVRRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRPIRSGEKVV
Ga0114129_1281004423300009147Populus RhizosphereMHEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFAPRRPVMGERVE
Ga0075423_1061478123300009162Populus RhizosphereMHEIVNARRPVMGERVERDAATGNQGKVRLGDSAPAFGR*
Ga0126380_1008975933300010043Tropical Forest SoilMHEIVNARRPVVGDKVERDAATHNQGKVRLGEGSAPVFAPRAIRS
Ga0126384_1111692623300010046Tropical Forest SoilMYEIVNARRPVVGDKVMRDAATHNPGKVQLGDGAPVFAPPAIRAGD
Ga0126382_1016968533300010047Tropical Forest SoilMREIVNARRPVAGEKIVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVRD
Ga0126382_1071517313300010047Tropical Forest SoilMYEIVNARRPVVGDKVERDAATHNPGKVQLGDGAP
Ga0126382_1113129623300010047Tropical Forest SoilMHEIVNARRPVVGEKVVRDAATHNPGKVQLGEGSAPVFGR*
Ga0126373_1014694513300010048Tropical Forest SoilMYEIVNARRPVVGDKVMRDAATHNPGKVQLGDGAPVFAPPAIRAGDKVT
Ga0126373_1152791323300010048Tropical Forest SoilMHEIVNARRPVVGDRVERNAATGNQGKVRLGDAAPAFAPRRPVMGDRAERDA
Ga0126370_1071113213300010358Tropical Forest SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDSAPVFAP
Ga0126370_1109393823300010358Tropical Forest SoilMREIVNARTPVVGEKVVRDAATHNPSKVQLGDGAPVFAPPAIRAGDKVMRDAATH
Ga0126376_1300107323300010359Tropical Forest SoilMHEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFAPRRPVMGE
Ga0126372_1306413913300010360Tropical Forest SoilMHEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFAP
Ga0126378_1199421313300010361Tropical Forest SoilMHEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFAPRRPV
Ga0126377_1014470633300010362Tropical Forest SoilMHEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFAPRRPVMGERVERDAA
Ga0126377_1073194613300010362Tropical Forest SoilMCEIVNARRPVVGEKVVRDAATHNQGKVQLGEGSAPVF
Ga0126377_1096706223300010362Tropical Forest SoilMYEIVNARRPVVGDKVMRDAATHNPGKVQLGDGAPVFAPPAIRAG
Ga0134125_1038553213300010371Terrestrial SoilMYEIVNARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEK
Ga0126381_10276236223300010376Tropical Forest SoilMREIVNARMPVVGEKVVRDAATHNPGKVQLGDGAPVFAPPAIRAGDKVMR
Ga0126383_1292954223300010398Tropical Forest SoilMHKIVNARRPVVGENVVRDAATHNQGKVHLGEGAAPAFAPRAIRSGEKVVR
Ga0137393_1110739213300011271Vadose Zone SoilMHEIVNARRPVVGEKVVRDAATQNQGTVQLGEGAAPVFGR*
Ga0137389_1027455313300012096Vadose Zone SoilMHEIVNARRPVVGEKVVRDAATQNQGTVQLGEGAAPVFAPRAIRSGE
Ga0137388_1053849723300012189Vadose Zone SoilMHEIVNARRPVVGEKVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVRDAATH
Ga0137364_1066199423300012198Vadose Zone SoilMQKIVNARRPVVGEKVVRDAATQNQGKVHLGEGSAPMFAPRAIRSGEKVVRDAATQNQ
Ga0137377_1132507823300012211Vadose Zone SoilMHEIVNARRPVLGEKVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVR
Ga0137377_1143383423300012211Vadose Zone SoilMHEIVKVRRPVVGEKVVRDAATHNQGKVQLGEGAAPVF
Ga0137370_1044628423300012285Vadose Zone SoilMQKIVNARRPVVGEKVVRDPATQNQGNVHMGEGSAPVFAPR
Ga0137367_1041482523300012353Vadose Zone SoilMNEFVNARRPVVGDKVERNAATRNEGKVQLGDGAPVFAPASIRAGDKA
Ga0137371_1109498513300012356Vadose Zone SoilMHEIVNARRPVVGDKVERDAATGNQGKVRLGDAAPVFAPRRPV
Ga0137375_1100256223300012360Vadose Zone SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDSAPVFAPRRPVMG
Ga0137360_1135528413300012361Vadose Zone SoilMHEIVKVRRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDA
Ga0137390_1077984723300012363Vadose Zone SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDAATQN
Ga0137358_1098500713300012582Vadose Zone SoilMSEIVNARRPVVGEKVVRDAATHNHGNVQLGEGSAPVFAPRAIRSGEK
Ga0126375_1082932223300012948Tropical Forest SoilMCEIVNARRPVVGEKVVRDAATHNQGKVQPGEGYAPVFAPRAIRSGEKVVRDAAT
Ga0164307_1059900223300012987SoilMYEIVNARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDAA
Ga0132258_1145796713300015371Arabidopsis RhizosphereMQKIVNARRPVVGEKVVRDAATQNQGTVHLGEGAAPVFAP
Ga0182036_1072885813300016270SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDAATHNQ
Ga0182041_1096480023300016294SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDAAT
Ga0182033_1160384923300016319SoilMREIVNARRPVVGEKVVRDAATHNQGKVQLGEGSAPAFAPRAIRSGEKVVRD
Ga0182033_1190147623300016319SoilMHEIVNARRPVVGEKVERDAATHNQGKVRLGEGSAPVFAPRA
Ga0182033_1192171823300016319SoilMHEIVIARRPVMGERVERDLATGNQGKVQLGDSAPVFAPRRPVMGERVERDL
Ga0182033_1218065613300016319SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVFAPRRPVMGE
Ga0182035_1159486813300016341SoilMHGIVNARRPVVGEKVVRDAATQNQGKVRLGEGAAPVFAPRAIRSGEKVVRDA
Ga0182032_1185097313300016357SoilMHEIVNARRPVVGEKVVRDAATQNQGKVRLGEGSAP
Ga0182034_1064568913300016371SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVFAPRRPVMGER
Ga0182037_1035573123300016404SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVFAPRWPVVGDRVERDAATSNQ
Ga0182037_1182984423300016404SoilMHEIVNARRPVVGEKVVRDAATHNQGKVQLGEGSAPAFAPRAIRSGEK
Ga0182039_1188981123300016422SoilMRKIVNARRPVVGERVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKV
Ga0182038_1048870123300016445SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVFAPRWPVMGERVER
Ga0184634_1036312513300018031Groundwater SedimentMHEIVNARRPAMGDKVERDAATCNQGKVRLGDAAPVFAPRRPATGDKVERDA
Ga0184611_108286513300018067Groundwater SedimentMTETVNVRRPVAGDKVERNEATSNQGKVKLGDASPVFAPRPDSK
Ga0184635_1014024223300018072Groundwater SedimentMHEIVNARRPAMGDKVERDAATCNQGKVRLGDAAPVFAPRR
Ga0184624_1002039833300018073Groundwater SedimentMHEIVNARRPVVGDKVERDAATCNQGKVRLGDAAPVFAPRRPATGDKVERDA
Ga0184640_1012323823300018074Groundwater SedimentMHEIVNARRPVVGDKVERDAATCNQGKVRLGDAAPVF
Ga0184633_1015114823300018077Groundwater SedimentMHEIVNARRPVVGDKVERDAATCNQGKVRLGDAAPVFAPRRP
Ga0066662_1011728513300018468Grasslands SoilMHEIVNARRPVLGEKVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVRDA
Ga0190270_1000475913300018469SoilMHEIVNARRPVAGDKVERDAATCNQGKVRLGDAAPV
Ga0066669_1151001913300018482Grasslands SoilMHEIVKVRRPVVGEKVVRDAATLNQGKVQLGEGAAPVFAPRAIRSGEKVVRDAAT
Ga0207692_1006384713300025898Corn, Switchgrass And Miscanthus RhizosphereMYEIVNARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIR
Ga0207699_1017241713300025906Corn, Switchgrass And Miscanthus RhizosphereMYEIVNARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFTPRAI
Ga0207684_1002604213300025910Corn, Switchgrass And Miscanthus RhizosphereMYEIVNARRPVVGDKVMRDAASHNAGKVQLGDGAPVFAPPAIRAGDKV
Ga0207684_1015414713300025910Corn, Switchgrass And Miscanthus RhizosphereMHEIVKVRRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVV
Ga0207693_1020556013300025915Corn, Switchgrass And Miscanthus RhizosphereMYEIVNARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFTPRAIRSGEKDVRDA
Ga0209474_1003358843300026550SoilMQKIVNARRPVVGEKVVRDAATQNQGNVHLGEGAAPMFAPRAIRS
Ga0209648_1077619323300026551Grasslands SoilRHSMHEIVNARRPVVGEKVVRDAATQNQGTVQLGEGAAPVFGR
Ga0209648_1077902513300026551Grasslands SoilMHEIVNARRPVVGEKVVRDAATQNQGTVQLGEGAAPVFAPRPIR
Ga0208990_118632813300027663Forest SoilMSEILNARRPVMGEKVVRDVATHNQGKVQLGEGAPVFIP
Ga0209465_1039680923300027874Tropical Forest SoilMYEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFAPR
Ga0307316_1000325013300028755SoilMHEIVNARRPVVGDKVERDAATCNQGKVRLGDAAPVFAPRRPAT
Ga0307306_1026348813300028782SoilMSEILNARRPVMGEKVVRDAATHNQGKVQLGEGAPV
Ga0307299_1000241963300028793SoilMHEIVNARRPVVGDKVERDAATCNQGKVRLGDAAPVFAPRRPSTGD
Ga0307296_1000852313300028819SoilMHEIVNARRPVVGDKVERDAATCNQGKVRLGDAAP
Ga0308178_101287933300030990SoilKRDFDKGRHSMSEILNARRPVMGEKVVRDAATHNQGKVQLGEGAPVFGR
Ga0318516_1024811613300031543SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEK
Ga0318516_1030439813300031543SoilIVNARRPVVGEKVVRDAATQNQGKVQLGEGAAPVFGR
Ga0318541_1042017723300031545SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDAATHNQG
Ga0318541_1049705913300031545SoilMRKIVNARRPVVGERVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVRDAAIHN
Ga0318538_1030271313300031546SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDSAPVFAPRR
Ga0318528_1011873323300031561SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDAAPAFAPRRPVMGE
Ga0318528_1011889723300031561SoilMHEIVNARRPVVGEKVVRDAATQNQGKVRLGEGSAPVFAPRAIRSGEKVVRDAATQN
Ga0318573_1002868333300031564SoilHSMYEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFGR
Ga0318515_1028222823300031572SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDAAPVFTPRRPV
Ga0310915_1034340213300031573SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDAAPAFAPRRPVMGD
Ga0310915_1124995013300031573SoilMHEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFASSRPV
Ga0318542_1041080713300031668SoilMYEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVY
Ga0318561_1077704013300031679SoilMHGIVNARRPVVGEKVVRDAATQNQGKVRLGEGAAPVFAPRAIRSGEKV
Ga0318500_1003751633300031724SoilMHEIVNARRPVVGEKVVRDAATQNQGKVRLGEGAAPVFAPRAIR
Ga0318501_1083030123300031736SoilMHEIVNARRPVVGEKVVRDAATQNQGKVRLGEGSAPV
Ga0318502_1020209823300031747SoilMHEIVNARRPVVGEKVVRDAATQNQGKVRLGEGSAPVFAPRAIRSGEKVVRDAA
Ga0318537_1010925423300031763SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDAAP
Ga0318535_1012505913300031764SoilMHGIVNARRPVVGEKVVRDAATQNQGKVRLGEGAAPVFAPRAIRSG
Ga0318535_1043981723300031764SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDAAPAFAPRRPVMGDKVERDAATCN
Ga0318546_1051083923300031771SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVFAPRRP
Ga0318552_1022761223300031782SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFA
Ga0318576_1041800423300031796SoilMYEIVNARRPVMGERVERDAATCNQGKVRLGDAAPAFAPRRPVMGERVERDAAT
Ga0318499_1011110613300031832SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDAATHNQGK
Ga0310917_1067623313300031833SoilMHEIVNARRPVVGEKVVRDAATHNQGKVQLGEGSAPAFAPRAIRSGEKVVRD
Ga0318517_1034151213300031835SoilMHGIVNARRPVVGEKVVRDAATQNQGKVRLGEGAAPVFAPRAIRSGEKVV
Ga0318511_1004730513300031845SoilMHEIVKARRPVVGEKVVRDAVTHNQGKVQLGEGSAPV
Ga0318511_1037777123300031845SoilMRKIVNARRPVVGERVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGE
Ga0318527_1016956613300031859SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDSAPVFAPRRPVMGERVERDAATCN
Ga0318495_1050001123300031860SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDAATHN
Ga0306919_1026274323300031879SoilMHGIVNARRPVVGEKVVRDAATQNQGKVRLGEGAAPVFAPRAIRSGEKVVRD
Ga0306925_1114213323300031890SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVFAPRRPVM
Ga0318551_1028383323300031896SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVV
Ga0318520_1105432113300031897SoilMRKIVNARRPVVGERVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVRDAAIHNQGK
Ga0306923_1074329223300031910SoilMRKIVNARRPVVGDKVERDAATGNQGKVRLGDAAPVFAPRRPVVGDKV
Ga0306923_1082694313300031910SoilMRKIVNARRPVVGERVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVRDAAT
Ga0306921_1235000823300031912SoilMHGIVNARRPVVGEKVVRDAATQNQGKVRLGEGAAPVFAPRAIRSGEKVVRDAA
Ga0310912_1042630213300031941SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVFAPRRPVMGERV
Ga0310912_1099123413300031941SoilMYEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFAPRRPVMGERVE
Ga0310916_1109088523300031942SoilMHEIVNARRPVVGEKVVRDAATHNQGKVQLGEGSAPAFAPR
Ga0310916_1147375013300031942SoilMHGIVNARRPVVGEKVVRDAATQNQGKVRLGEGAAPVFAPRAIRSGEKVVRE
Ga0310910_1063178123300031946SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVF
Ga0310909_1042098913300031947SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVFAPRRPVMGERVE
Ga0310909_1154051823300031947SoilMREIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFA
Ga0306926_1020506013300031954SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDA
Ga0318530_1031024613300031959SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVFAPRRPVMGERVERDAATG
Ga0318562_1067949823300032008SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDAAPVFAPRRPV
Ga0318558_1006801513300032044SoilMYEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFAPTRPV
Ga0318532_1018698413300032051SoilMHEIVNARRPVVGEKVVRDAATQNQGKVRLGEGSAPVFAPRAIRSGEKVVRDDA
Ga0318506_1036706913300032052SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDAAPAFAPRRPVIGER
Ga0318570_1053304713300032054SoilMRKIVNARRPVVGERVVRDAATHNQGKVQLGEGSAPVFAPRAIRSGEKVVRDAATHNQG
Ga0318575_1034506113300032055SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDAA
Ga0318575_1040499923300032055SoilMHGIVNARRPVVGEKVVRDAATQNQGKVRLGEGSAPVFAPR
Ga0318533_1053342513300032059SoilMHEIVNARRPVMGERVERDAATSNQGKVRLGDSAPVFAPRRPVMGERVER
Ga0318533_1116927223300032059SoilMHEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVF
Ga0318513_1015529013300032065SoilMREIVNARRPVMGERVERDAATCNQGKVRLGDSAPVFAPRRPVMGERVERDAATC
Ga0318513_1025818313300032065SoilMYEIVNARRPVMGERVERDAATGNQGKVRLGDSAPVFGR
Ga0318513_1055735213300032065SoilMHEIVNARRPVVGEKVVRDAATHNQGKVQLGEGSA
Ga0318518_1043947113300032090SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDAAPVFGR
Ga0318540_1041473813300032094SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDAAPAFAPRRPVMGDKVERDA
Ga0310914_1093112413300033289SoilMHEIVKARRPVVGEKVVRDAATHNQGKVQLGEGAAPVFAPRAIRSGEKVVRDAASH
Ga0310914_1128355823300033289SoilMHEIVNARRPVMGERVERDAATCNQGKVRLGDAAPAFAPRRPVMG
Ga0318519_1099526223300033290SoilMHEIVNARRPVVGEKVERDAATHNQGKVRLGEGSAPVFAPRAICSGEKVVRDAATQNE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.