Basic Information | |
---|---|
Family ID | F037277 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 168 |
Average Sequence Length | 41 residues |
Representative Sequence | VFIRREDAERFIEEVRGDDPELASYLRIEERELEAGGLN |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 168 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 28.12 % |
% of genes near scaffold ends (potentially truncated) | 44.05 % |
% of genes from short scaffolds (< 2000 bps) | 82.14 % |
Associated GOLD sequencing projects | 128 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.976 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.476 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.143 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.905 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.85% β-sheet: 0.00% Coil/Unstructured: 70.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 168 Family Scaffolds |
---|---|---|
PF00171 | Aldedh | 7.74 |
PF07676 | PD40 | 2.38 |
PF00211 | Guanylate_cyc | 1.79 |
PF13458 | Peripla_BP_6 | 1.19 |
PF12680 | SnoaL_2 | 1.19 |
PF03176 | MMPL | 1.19 |
PF00589 | Phage_integrase | 1.19 |
PF00248 | Aldo_ket_red | 1.19 |
PF12681 | Glyoxalase_2 | 1.19 |
PF13191 | AAA_16 | 0.60 |
PF00196 | GerE | 0.60 |
PF00496 | SBP_bac_5 | 0.60 |
PF13474 | SnoaL_3 | 0.60 |
PF12695 | Abhydrolase_5 | 0.60 |
PF00107 | ADH_zinc_N | 0.60 |
PF00571 | CBS | 0.60 |
PF14373 | Imm_superinfect | 0.60 |
PF01042 | Ribonuc_L-PSP | 0.60 |
PF13239 | 2TM | 0.60 |
PF00578 | AhpC-TSA | 0.60 |
PF02481 | DNA_processg_A | 0.60 |
PF00027 | cNMP_binding | 0.60 |
PF07978 | NIPSNAP | 0.60 |
PF02371 | Transposase_20 | 0.60 |
PF03640 | Lipoprotein_15 | 0.60 |
PF13588 | HSDR_N_2 | 0.60 |
PF12728 | HTH_17 | 0.60 |
PF01351 | RNase_HII | 0.60 |
PF04278 | Tic22 | 0.60 |
PF07731 | Cu-oxidase_2 | 0.60 |
PF13223 | DUF4031 | 0.60 |
PF01551 | Peptidase_M23 | 0.60 |
PF13229 | Beta_helix | 0.60 |
PF14329 | DUF4386 | 0.60 |
PF13649 | Methyltransf_25 | 0.60 |
PF01872 | RibD_C | 0.60 |
PF00753 | Lactamase_B | 0.60 |
PF05345 | He_PIG | 0.60 |
PF01025 | GrpE | 0.60 |
PF07883 | Cupin_2 | 0.60 |
PF02325 | YGGT | 0.60 |
PF13480 | Acetyltransf_6 | 0.60 |
PF12697 | Abhydrolase_6 | 0.60 |
PF13473 | Cupredoxin_1 | 0.60 |
PF12903 | DUF3830 | 0.60 |
PF01266 | DAO | 0.60 |
PF10604 | Polyketide_cyc2 | 0.60 |
PF13537 | GATase_7 | 0.60 |
PF01476 | LysM | 0.60 |
PF07862 | Nif11 | 0.60 |
PF00565 | SNase | 0.60 |
PF00561 | Abhydrolase_1 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 168 Family Scaffolds |
---|---|---|---|
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 7.74 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 7.74 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 7.74 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.79 |
COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.19 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.19 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.19 |
COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 0.60 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.60 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.60 |
COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
COG0762 | Cytochrome b6 maturation protein CCB3/Ycf19 and related maturases, YggT family | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 0.60 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.60 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.60 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.98 % |
Unclassified | root | N/A | 22.02 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459015|G14TP7Y01EEAS7 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_10807340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
3300000550|F24TB_11775052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
3300000956|JGI10216J12902_107066698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1774 | Open in IMG/M |
3300000956|JGI10216J12902_109121265 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
3300000956|JGI10216J12902_113335114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
3300000956|JGI10216J12902_122826413 | Not Available | 761 | Open in IMG/M |
3300001431|F14TB_101899692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 675 | Open in IMG/M |
3300004114|Ga0062593_101102019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 824 | Open in IMG/M |
3300004157|Ga0062590_100847050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 848 | Open in IMG/M |
3300004479|Ga0062595_100585266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
3300004480|Ga0062592_100405273 | Not Available | 1087 | Open in IMG/M |
3300004480|Ga0062592_100997096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
3300004643|Ga0062591_100316775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1239 | Open in IMG/M |
3300004643|Ga0062591_101932408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
3300005093|Ga0062594_102724963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
3300005166|Ga0066674_10335061 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300005168|Ga0066809_10171135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300005169|Ga0066810_10136052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300005329|Ga0070683_100040267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4295 | Open in IMG/M |
3300005332|Ga0066388_100143435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2956 | Open in IMG/M |
3300005332|Ga0066388_100371720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2076 | Open in IMG/M |
3300005332|Ga0066388_105867088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
3300005334|Ga0068869_100162949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1737 | Open in IMG/M |
3300005338|Ga0068868_100345473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1273 | Open in IMG/M |
3300005354|Ga0070675_101456943 | Not Available | 631 | Open in IMG/M |
3300005355|Ga0070671_100580851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 968 | Open in IMG/M |
3300005356|Ga0070674_100241218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1415 | Open in IMG/M |
3300005548|Ga0070665_100625962 | Not Available | 1089 | Open in IMG/M |
3300005558|Ga0066698_10479924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 846 | Open in IMG/M |
3300005764|Ga0066903_103582304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
3300005840|Ga0068870_10675298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
3300005840|Ga0068870_10752918 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300006196|Ga0075422_10460434 | Not Available | 572 | Open in IMG/M |
3300006358|Ga0068871_100784110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 878 | Open in IMG/M |
3300006580|Ga0074049_12436045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1120 | Open in IMG/M |
3300006581|Ga0074048_12977608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 862 | Open in IMG/M |
3300006844|Ga0075428_100227564 | Not Available | 2013 | Open in IMG/M |
3300006845|Ga0075421_100402582 | Not Available | 1643 | Open in IMG/M |
3300009100|Ga0075418_11483632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
3300009137|Ga0066709_100743616 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1415 | Open in IMG/M |
3300009597|Ga0105259_1127542 | Not Available | 613 | Open in IMG/M |
3300009678|Ga0105252_10600802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300009801|Ga0105056_1070161 | Not Available | 520 | Open in IMG/M |
3300009810|Ga0105088_1071295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
3300009814|Ga0105082_1094687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
3300009823|Ga0105078_1019630 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300010029|Ga0105074_1113062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
3300010039|Ga0126309_10002452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6838 | Open in IMG/M |
3300010375|Ga0105239_13316308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
3300010391|Ga0136847_13497583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
3300010398|Ga0126383_10508340 | Not Available | 1265 | Open in IMG/M |
3300010398|Ga0126383_10532303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1238 | Open in IMG/M |
3300011119|Ga0105246_10486809 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300011432|Ga0137428_1190624 | Not Available | 608 | Open in IMG/M |
3300011440|Ga0137433_1063966 | Not Available | 1109 | Open in IMG/M |
3300011440|Ga0137433_1151381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
3300012021|Ga0120192_10010533 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300012356|Ga0137371_10012272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6622 | Open in IMG/M |
3300012356|Ga0137371_10890291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
3300012529|Ga0136630_1004796 | All Organisms → cellular organisms → Bacteria | 5532 | Open in IMG/M |
3300012684|Ga0136614_10194471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1529 | Open in IMG/M |
3300012904|Ga0157282_10219232 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300012951|Ga0164300_10614242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300012958|Ga0164299_10327668 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300012958|Ga0164299_10635783 | Not Available | 736 | Open in IMG/M |
3300012961|Ga0164302_11335074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
3300012971|Ga0126369_11715252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
3300012985|Ga0164308_10897327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
3300013096|Ga0157307_1165077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
3300013297|Ga0157378_11775083 | Not Available | 665 | Open in IMG/M |
3300013308|Ga0157375_12958237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
3300014271|Ga0075326_1096572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 829 | Open in IMG/M |
3300014326|Ga0157380_12335307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300015077|Ga0173483_10040084 | Not Available | 1749 | Open in IMG/M |
3300015077|Ga0173483_10755196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
3300015201|Ga0173478_10859632 | Not Available | 504 | Open in IMG/M |
3300015258|Ga0180093_1004097 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
3300015258|Ga0180093_1033040 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300015371|Ga0132258_10139590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5796 | Open in IMG/M |
3300015371|Ga0132258_10220714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4611 | Open in IMG/M |
3300015371|Ga0132258_10295593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3981 | Open in IMG/M |
3300015371|Ga0132258_10449564 | Not Available | 3211 | Open in IMG/M |
3300015371|Ga0132258_13691240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1045 | Open in IMG/M |
3300015372|Ga0132256_100421285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. KY75 | 1439 | Open in IMG/M |
3300015372|Ga0132256_101356855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 823 | Open in IMG/M |
3300015372|Ga0132256_101722217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
3300015373|Ga0132257_100594308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. KY75 | 1367 | Open in IMG/M |
3300015374|Ga0132255_100033096 | All Organisms → cellular organisms → Bacteria | 6571 | Open in IMG/M |
3300015374|Ga0132255_102377787 | Not Available | 809 | Open in IMG/M |
3300017787|Ga0183260_10077280 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
3300017787|Ga0183260_10663703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
3300017789|Ga0136617_10360490 | Not Available | 1182 | Open in IMG/M |
3300017789|Ga0136617_11497314 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300017965|Ga0190266_10129503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1096 | Open in IMG/M |
3300017997|Ga0184610_1247217 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300018031|Ga0184634_10187848 | Not Available | 938 | Open in IMG/M |
3300018072|Ga0184635_10010039 | All Organisms → cellular organisms → Bacteria | 3274 | Open in IMG/M |
3300018073|Ga0184624_10103583 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300018076|Ga0184609_10133864 | Not Available | 1134 | Open in IMG/M |
3300018469|Ga0190270_10093107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2280 | Open in IMG/M |
3300018469|Ga0190270_11323915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
3300018476|Ga0190274_11750220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708 | 716 | Open in IMG/M |
3300018481|Ga0190271_10278927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1721 | Open in IMG/M |
3300018481|Ga0190271_10603752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1217 | Open in IMG/M |
3300018481|Ga0190271_10765152 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300019356|Ga0173481_10116189 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300019487|Ga0187893_10364758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 994 | Open in IMG/M |
3300019887|Ga0193729_1212366 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300020005|Ga0193697_1121647 | Not Available | 606 | Open in IMG/M |
3300022213|Ga0224500_10087072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1201 | Open in IMG/M |
3300022756|Ga0222622_11040776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
3300025313|Ga0209431_10080771 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
3300025315|Ga0207697_10138598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1054 | Open in IMG/M |
3300025325|Ga0209341_11186753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300025901|Ga0207688_10537462 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 734 | Open in IMG/M |
3300025925|Ga0207650_10341300 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300025926|Ga0207659_11182438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
3300025926|Ga0207659_11238782 | Not Available | 641 | Open in IMG/M |
3300025938|Ga0207704_11379307 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300025942|Ga0207689_10427868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1105 | Open in IMG/M |
3300025944|Ga0207661_10882972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 823 | Open in IMG/M |
3300026075|Ga0207708_11839155 | Not Available | 531 | Open in IMG/M |
3300026121|Ga0207683_11062582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 751 | Open in IMG/M |
3300026535|Ga0256867_10150495 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300027513|Ga0208685_1094768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
3300027523|Ga0208890_1004896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1589 | Open in IMG/M |
3300027523|Ga0208890_1051698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
3300027561|Ga0209887_1107129 | Not Available | 561 | Open in IMG/M |
(restricted) 3300027799|Ga0233416_10002138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 6232 | Open in IMG/M |
3300027870|Ga0209023_10130728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1739 | Open in IMG/M |
(restricted) 3300028043|Ga0233417_10580967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
3300028592|Ga0247822_11781801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
3300028608|Ga0247819_10809467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
3300028784|Ga0307282_10350987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
3300028876|Ga0307286_10103368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
3300030006|Ga0299907_10786610 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300031226|Ga0307497_10030770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1748 | Open in IMG/M |
3300031226|Ga0307497_10134590 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300031229|Ga0299913_10557351 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
3300031545|Ga0318541_10538863 | Not Available | 653 | Open in IMG/M |
3300031997|Ga0315278_10063274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3656 | Open in IMG/M |
3300032000|Ga0310903_10838193 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300032013|Ga0310906_10034663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2341 | Open in IMG/M |
3300032013|Ga0310906_11036946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
3300032075|Ga0310890_10601096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
3300032275|Ga0315270_10390035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 887 | Open in IMG/M |
3300032397|Ga0315287_12923668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
3300032516|Ga0315273_10259141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2368 | Open in IMG/M |
3300032516|Ga0315273_11377804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 875 | Open in IMG/M |
3300033550|Ga0247829_11085867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
3300033811|Ga0364924_020638 | Not Available | 1297 | Open in IMG/M |
3300033812|Ga0364926_010594 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
3300033814|Ga0364930_0239012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
3300034114|Ga0364938_017125 | Not Available | 1074 | Open in IMG/M |
3300034147|Ga0364925_0243934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
3300034164|Ga0364940_0012909 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
3300034176|Ga0364931_0034555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1492 | Open in IMG/M |
3300034178|Ga0364934_0113886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1019 | Open in IMG/M |
3300034354|Ga0364943_0025980 | Not Available | 1840 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.48% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 6.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.36% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.36% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.76% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.17% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.17% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.57% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.38% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.38% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.38% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.19% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.19% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.19% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.19% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.60% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.60% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.60% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.60% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.60% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.60% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
4PV_03591390 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | VFIRCEDAERFIEEVGGDEPEIAAKLRIEERELEASGLN |
ICChiseqgaiiFebDRAFT_108073401 | 3300000363 | Soil | PLGDAVETFIRLEDAERFIAEVRGDEPEMAEKLRIEERELEVGGLN* |
F24TB_117750521 | 3300000550 | Soil | VLEVSIRREDAERVIEEIRSDDPELAKPLRIEEREL |
JGI10216J12902_1070666982 | 3300000956 | Soil | VDLEVFIRREDAERFIEEVRGDDPELAAKLRIEERELEAGGLN* |
JGI10216J12902_1091212651 | 3300000956 | Soil | TRREDADRFVEEIRGDEPELAASLRVGERELEASEPN* |
JGI10216J12902_1133351142 | 3300000956 | Soil | IRREDAERFIEEVRGDEPGLATNLRIEERELEAGSSN* |
JGI10216J12902_1228264133 | 3300000956 | Soil | DSIDVFVRREDAERFIQEVRGDDRELARPLRIEERELEAGRLN* |
F14TB_1018996922 | 3300001431 | Soil | MDRREDAERFIVDVRGDDPELASYLRIEERELEAG |
Ga0062593_1011020192 | 3300004114 | Soil | MPSRLTSPLGDAIDVRIRREDAERFIEEVRGDDPEMAAKLRIEERELEA |
Ga0062590_1008470501 | 3300004157 | Soil | ELALFTRHEDAERFIEEVRGADPDVASKLGIEERELGAGPRD* |
Ga0062595_1005852662 | 3300004479 | Soil | VFIRREDAERFIEEVRRDDAELASSLRIEERELEAGQLN* |
Ga0062592_1004052731 | 3300004480 | Soil | VSQSLQRNTFVRREDAERFIEEVCTDEPDLAAKLRIEARELDTGGLS* |
Ga0062592_1009970963 | 3300004480 | Soil | SRLGDAVEVCIRREDAERFIEEVRGDDPEIAAKLRIEERELEAGGLH* |
Ga0062591_1003167754 | 3300004643 | Soil | VVEVFVRREDSERFIEEVLGDDPEATAKLRVEERELEAGGRNQRVRV* |
Ga0062591_1019324082 | 3300004643 | Soil | VFLRREDAERIVAEVRGDDPEVAASLLIEERELEAGGLS* |
Ga0062594_1027249631 | 3300005093 | Soil | DSLEVFVRREDAERFIEQVRGDDPEVAEKLRIEERELKAA* |
Ga0066674_103350612 | 3300005166 | Soil | VFVRCEDAERFIEEIRGDEPELAKPFRIEERELEAGGRN* |
Ga0066809_101711352 | 3300005168 | Soil | VFIRRDDAERFIEEVRGDDPKLASDLRIEERELEAEGLN* |
Ga0066810_101360522 | 3300005169 | Soil | SARCAIETFVRREDAERFIEEVRGDDPGIAAHLRIEERELEGVGGLN* |
Ga0070683_1000402674 | 3300005329 | Corn Rhizosphere | VFVRREDAERFIEEVRGDDLDPSAKLRVEERRLEAGAVQDSGA* |
Ga0066388_1001434351 | 3300005332 | Tropical Forest Soil | VYVRREDAEPFIEQVRGDDPELAKELRIEERELGAGELK* |
Ga0066388_1003717202 | 3300005332 | Tropical Forest Soil | MKPGHEDAERFIEEVRGDEAELAKHLRIEERELEVGGQN* |
Ga0066388_1058670882 | 3300005332 | Tropical Forest Soil | MKTAVAPRREYAERFIEEVRGDEPELAKALRIEEREFEAGGRN* |
Ga0068869_1001629493 | 3300005334 | Miscanthus Rhizosphere | VFVRREDAERFIEEVRGDDLDPSAKLRVEERRLEAGAVQDS |
Ga0068868_1003454734 | 3300005338 | Miscanthus Rhizosphere | VSIRPEDAERFIEEVRGDDPEVAASLRIEERELDAGGLN* |
Ga0070675_1014569431 | 3300005354 | Miscanthus Rhizosphere | GGSVETFVRREDAERFIEEVRGDEPELVPKLRIKERELALGGLS* |
Ga0070671_1005808511 | 3300005355 | Switchgrass Rhizosphere | VRREDAERFIEEVRGDDLDPSAKLRVEERRLEAGAVQDSGA* |
Ga0070674_1002412182 | 3300005356 | Miscanthus Rhizosphere | VSIRREDAERFIEEVRGDDPEVAASLRIEERELDADGLN* |
Ga0070665_1006259621 | 3300005548 | Switchgrass Rhizosphere | REDAERFIEEVRGDDLDPSAKLRVEERRLEAGAVQDSGA* |
Ga0066698_104799241 | 3300005558 | Soil | MERTTLRPEVYVRREDAERFIGEIRGDDPELAGPLRFEERELEAGGVS* |
Ga0066903_1035823041 | 3300005764 | Tropical Forest Soil | VYVRREDAERFIEQVRGDDPELAKELRIEERELGAGELK |
Ga0068870_106752982 | 3300005840 | Miscanthus Rhizosphere | DFPLGVELEVFVRREDAERFIEEVRGDDLDPSAKLRVEERRLEAGAVQDSGA* |
Ga0068870_107529181 | 3300005840 | Miscanthus Rhizosphere | ETFVRREDAERFIEEVRGDDPDLAAKLRIELRELEAGGLN* |
Ga0075422_104604341 | 3300006196 | Populus Rhizosphere | MLEVCIRRKDAERFIEEGEGDDPEIAAKLRIEERELEAGGLH* |
Ga0068871_1007841102 | 3300006358 | Miscanthus Rhizosphere | REDAERIADVRGDDPELAAKLRIEERELEAGGLN* |
Ga0074051_117789661 | 3300006572 | Soil | MTSSRAKERFVEEVEPTIPELASYLRIEQRELEAGVLN* |
Ga0074047_115681361 | 3300006576 | Soil | MTSSREKERFVEEVEPTIPELASYLRIEERELEAGVLN* |
Ga0074054_117119732 | 3300006579 | Soil | MTSSRAKERFVEEVEPTIPELASYLRIEERELEAGVLN* |
Ga0074049_124360452 | 3300006580 | Soil | VFIRREDAERFIEEVRGDDPELASYLRIEERELEAGGRN* |
Ga0074048_129776082 | 3300006581 | Soil | VFIRREDAERFIEEVRGDDPELASYLRIEERELEAGGLN* |
Ga0075428_1002275644 | 3300006844 | Populus Rhizosphere | PLEVFIRREDAERLVKEVRGDEPEVAAKLRIEERELEAGGVN* |
Ga0075421_1004025821 | 3300006845 | Populus Rhizosphere | VFIRREDAERLVKEVRGDEPEVAAKLRIEERELEAGGVN* |
Ga0075418_114836322 | 3300009100 | Populus Rhizosphere | VFVHRDDAERFIAEVCGDEPEVAAKLRIEERELEGDHPN* |
Ga0066709_1007436163 | 3300009137 | Grasslands Soil | MCLCREDAERFVEEIRRDDPELAEPLRIEERELKTGGRN* |
Ga0105259_11275421 | 3300009597 | Soil | MNRIQFVETFIRREDAGRFIEEVRGDDPEMAANLRIDERELEA |
Ga0105252_106008022 | 3300009678 | Soil | MNRIQFVETFVRREDAERFVEEVRGDDPELASYLRIEERELEAGGRN* |
Ga0105056_10701612 | 3300009801 | Groundwater Sand | MNRIHFVETFVRREEAERFIEEVRGDDPELASYLRIEERGV* |
Ga0105088_10712952 | 3300009810 | Groundwater Sand | VRREDAERFVEEVRTDDPELASYLRIQERELEAGGLN* |
Ga0105082_10946872 | 3300009814 | Groundwater Sand | MNRIHFVETFVRREEAERFIEEVRGDEPELAAKLRIEERELEAGGPN* |
Ga0105078_10196303 | 3300009823 | Groundwater Sand | REHAERFIQEIRHDEPELAGPLRIEERVLEAGGPN* |
Ga0105074_11130621 | 3300010029 | Groundwater Sand | VFIRREDAERFIEEVRGDDPELAGSLRIEERELEA |
Ga0126309_1000245210 | 3300010039 | Serpentine Soil | LRAAGGEDAERFIEEVRGDDPEVAAKVRIEERELEAGALN* |
Ga0105239_133163082 | 3300010375 | Corn Rhizosphere | LGVELEVFVRREDAERFIEEVRGDDLDPSAKLRVEERRLEAGAVQDSGA* |
Ga0136847_134975832 | 3300010391 | Freshwater Sediment | MNRIQFVETLIRREDAGRFIEEVQGDDPELARYLRIEERELEAGGLN* |
Ga0126383_105083401 | 3300010398 | Tropical Forest Soil | VELEVYVSREDAARFIEEVRGDEPELANDLRIEERE |
Ga0126383_105323032 | 3300010398 | Tropical Forest Soil | VYVRREDAERFIEQVRGDDPELAKELRIEERELGAGGLK* |
Ga0105246_104868093 | 3300011119 | Miscanthus Rhizosphere | VFIRREDAERIADVRGDDPELAAKLRIEERELEAGGLN* |
Ga0137428_11906242 | 3300011432 | Soil | MNRIQFVETFIRREDAGRFVEEVRGDDPELAASLRVEERELE |
Ga0137433_10639661 | 3300011440 | Soil | MNRIQFVETFIRREDAGRFIEEVRGDDPEMAANLRIEERELEAGGRN* |
Ga0137433_11513811 | 3300011440 | Soil | GVELEGFIRRKDTERFVEEVRGDEPEIAAKLRIEEGELEAGGLD* |
Ga0120192_100105332 | 3300012021 | Terrestrial | VFVRREDAERFVVEIRGDEPELARHLRIEEREPEAGG* |
Ga0136631_103419161 | 3300012043 | Polar Desert Sand | LHAFAPNFRTRREDAERFIEEVRGDDPDLASYLRIEERDLEAGGMN* |
Ga0137371_100122723 | 3300012356 | Vadose Zone Soil | VFVRREDAQRFIEEIRGDEPELAKPFRIEERELEAGGRN* |
Ga0137371_108902911 | 3300012356 | Vadose Zone Soil | FVRREDAERFIEEVRSDDPELAKPLRIEERELETGGAN* |
Ga0137371_111048532 | 3300012356 | Vadose Zone Soil | LDDSLDVFVRREDAERFIEDIRGDDLELAKPLRIEEREFEDR* |
Ga0136630_10047965 | 3300012529 | Polar Desert Sand | LHAFAPNFRTRREDAERFIEEVRGDDPDLASYLRIEKRDLEAGGMN* |
Ga0136614_101944713 | 3300012684 | Polar Desert Sand | FIHREDAERFVEEVRGDDPELASYLRIEERGLEAGGPN* |
Ga0157282_102192322 | 3300012904 | Soil | LSVSFIRREEAERFIEEVRGDDPEMAAKLRIEKRELEAGGLN* |
Ga0164300_106142422 | 3300012951 | Soil | VELEVLVRREDAEGFVEEVRGDDPELAPKLRIEEQELEAGGRN* |
Ga0164299_103276682 | 3300012958 | Soil | VFVPREYAERFIADVRGDDPEVAAKLRIEERELEAGGLN* |
Ga0164299_106357831 | 3300012958 | Soil | REDAERFIAEVRSDAPKLAEKLRVEERELEAGGLN* |
Ga0164302_113350742 | 3300012961 | Soil | RVMLEVLVRREDAERFVEEVRADDPELAAKLRTEERELAAGELN* |
Ga0126369_117152522 | 3300012971 | Tropical Forest Soil | VYVRREDAERFIEQVRGDDPELAKELRIEERELGAGELK* |
Ga0164308_108973272 | 3300012985 | Soil | VLVRREDAERFIEDVRGDEPELAAKLRIERRELKGVGE* |
Ga0157307_11650772 | 3300013096 | Soil | MNRPREDERFIEEVRGDDPEIAAKLRIEERELEAGGLN* |
Ga0157378_117750831 | 3300013297 | Miscanthus Rhizosphere | VTFVRREDAQRFIEEVGGNDPELEERELEAGGAELDSA |
Ga0157375_129582371 | 3300013308 | Miscanthus Rhizosphere | EDAERFIEEVRGDEPEMAAKLRIEERELEAGGLN* |
Ga0075326_10965722 | 3300014271 | Natural And Restored Wetlands | VFIRREDAERFIEEVRGDEPEVARSLRVEERELEAGALRPRTG* |
Ga0157380_123353071 | 3300014326 | Switchgrass Rhizosphere | VEVFVRREDAERFIEEVRGDDPEAAAKLRIVERELDAGGLN* |
Ga0173483_100400842 | 3300015077 | Soil | VSVCREDPERFIEEVRGHDADVPAKLRIEERELEAGGLK* |
Ga0173483_107551961 | 3300015077 | Soil | RGCRRRVGHLKTFIRREDAERLIEEVRGDEPELAAKLRIEERELEAGGLD* |
Ga0173478_108596322 | 3300015201 | Soil | FARREDAERFIEELRRDEPELASALWIEEHELEAGGDN* |
Ga0180093_10040972 | 3300015258 | Soil | MNRIQFVETFVRREDAGRFIEEVRGDDPEMAANLRIKERELEAGGRN* |
Ga0180093_10330401 | 3300015258 | Soil | MLGDAVETFIRREEAERFVDEARGDDPDLASYLRIEERELEGGG |
Ga0132258_101395901 | 3300015371 | Arabidopsis Rhizosphere | VFVRREDAERFTAEMSDHDPELAAKLRVEERELEAGGVN* |
Ga0132258_102207148 | 3300015371 | Arabidopsis Rhizosphere | VGLEVLVRREDAEGFVGEVRGDDPELAPKLRIEERELEAGGW |
Ga0132258_102955933 | 3300015371 | Arabidopsis Rhizosphere | VFIRREDAERFIEEVRGDDPEVAASLRIEERELDAGGLN* |
Ga0132258_104495645 | 3300015371 | Arabidopsis Rhizosphere | VFVRREDAARFFEEVRRDGPTLANQLRIEERELEAGGLN* |
Ga0132258_136912404 | 3300015371 | Arabidopsis Rhizosphere | EDAERFVEEVRGDEPELAEKLGIEERELEAGGGN* |
Ga0132256_1004212852 | 3300015372 | Arabidopsis Rhizosphere | VFVRREDAARFFEEVRRDGPTLANQVRIEERELEAGGLN* |
Ga0132256_1013568552 | 3300015372 | Arabidopsis Rhizosphere | FLLGVELETFIRREDAERFAEEVRGDEPEMAAKLRIEERELETGGLN* |
Ga0132256_1017222172 | 3300015372 | Arabidopsis Rhizosphere | VFIRREDAERFIEEVRSDDPEVAASLRIEERELDAAG* |
Ga0132257_1005943082 | 3300015373 | Arabidopsis Rhizosphere | VFVRREDAARFFEEVRRDGPTLANQLRMEERELEAGGLN* |
Ga0132255_1000330968 | 3300015374 | Arabidopsis Rhizosphere | MFLRREDVEEVRSDEPELAEKLGIEERELEAGGVN* |
Ga0132255_1023777871 | 3300015374 | Arabidopsis Rhizosphere | REDAERFIEEVRKRQPDLAGTLHIEELVLETGGLN* |
Ga0132255_1032294661 | 3300015374 | Arabidopsis Rhizosphere | SLEVFVRREDAERFIELASDMQIEERELEAGGLN* |
Ga0183260_100772803 | 3300017787 | Polar Desert Sand | VGAWAERFVEEVRGDDPDLASYLRIEERELEAGGPN |
Ga0183260_106637032 | 3300017787 | Polar Desert Sand | PLGDSLETFVRREDAERFIEEVRGDDPELAGYLRIEERELEAGGLN |
Ga0136617_103604902 | 3300017789 | Polar Desert Sand | VWEFVVREDAGRFIEEVRGDDPEPASRLRIEERELEAGGLN |
Ga0136617_114973142 | 3300017789 | Polar Desert Sand | MSQAREDAERFVEEVRGDDPELALHLRIEERELEAGGLN |
Ga0190266_101295032 | 3300017965 | Soil | VRSACDAQRLLEEVRGDDPELASYLRIEERELETGGPN |
Ga0184610_12472172 | 3300017997 | Groundwater Sediment | AIETFVRREDAERFIEEVRGDDLEHASNLRIEELELEAGGRN |
Ga0184634_101878482 | 3300018031 | Groundwater Sediment | VRREDAERFVEEGTDDPELASYLRTEERELEAGGLN |
Ga0184635_100100395 | 3300018072 | Groundwater Sediment | VFIRREDAERFIEEVRGDDPELAGSLRIEERELEAGGLN |
Ga0184624_101035832 | 3300018073 | Groundwater Sediment | VGYSVHTERFIEEVAQRERDRASSLRIEERELEAGGLN |
Ga0184609_101338642 | 3300018076 | Groundwater Sediment | LLPFIRREDAEWFVEDVRGDDPALASYLRIEERELGAAA |
Ga0190270_100931072 | 3300018469 | Soil | VFLRREEAARFIEEVRGDEPEIAAKLRIEERELEASGLN |
Ga0190270_113239152 | 3300018469 | Soil | EDAERFIEEIRGDEPEIASKLRVAERELEGVGGLNQVRW |
Ga0190274_117502202 | 3300018476 | Soil | GVELEVFIRREDAERFIEEVRGDEPEVASYLRIEERELEAGGLN |
Ga0190271_102789271 | 3300018481 | Soil | VFIRREDAERFVEEVRGDDPEVAAKLRIEERELEGGGLN |
Ga0190271_106037523 | 3300018481 | Soil | VFIRREDAERFVEQVRGDEPEMAAKLRIEEREPEAGHRN |
Ga0190271_107651522 | 3300018481 | Soil | VFIGREDAERFIEEVRGDDPEVAAKLRIEERQPEAGGLN |
Ga0173481_101161891 | 3300019356 | Soil | SDDDVETFIRREEAERFIEEVRGDDPEMAAKLRIEKRELEAGGLN |
Ga0187893_103647582 | 3300019487 | Microbial Mat On Rocks | VFVRREDAERFVEEVRSDEPEVAAKLRIEEHELEAGGLN |
Ga0193729_12123661 | 3300019887 | Soil | FPLATCANAERFIEEVRGDDPELASYLRIEERELEAGGLN |
Ga0193697_11216471 | 3300020005 | Soil | MLAIENPCRREDAERFIEEERGDDPETAAKLRTEERELKAGGPN |
Ga0224500_100870722 | 3300022213 | Sediment | REDAECFIEEVRGGDCDLASYLRIEERELEGGGLN |
Ga0222622_110407761 | 3300022756 | Groundwater Sediment | QADAERFIEEVPGDEPKLGAKLRIEERELEAGGLN |
Ga0209431_100807711 | 3300025313 | Soil | LEVFIRREDAERFIEEVRGDDPEVAAKLRIEERELDAGDLN |
Ga0207697_101385983 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VRREDAERFIEEVRGDDLDPSAKLRVEERRLEAGAVQ |
Ga0209341_111867531 | 3300025325 | Soil | VRDAERFIEDVRRDDPDLASYLRIEERELEAGGRN |
Ga0207688_105374621 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | EVFVRREDAERFIEQVRGDDPEVAEKLRIEERELKAA |
Ga0207650_103413003 | 3300025925 | Switchgrass Rhizosphere | RREDAERFIEEVRGDDPDLAAKLRIELRELEAGGLN |
Ga0207659_111824381 | 3300025926 | Miscanthus Rhizosphere | VFVRREDAERFIEEVRGDDLDPSAKLRVEERRLEAGAVQDSGA |
Ga0207659_112387821 | 3300025926 | Miscanthus Rhizosphere | GGSVETFVRREDAERFIEEVRGDEPELVPKLRIKERELALGGLS |
Ga0207704_113793072 | 3300025938 | Miscanthus Rhizosphere | DAVETFIRRKDAERFIEKVRGDEPDLAATSRIEERELEASGLN |
Ga0207689_104278683 | 3300025942 | Miscanthus Rhizosphere | VRREDAERFIEEVRGDDLDPSAKLRVEERRLEAGAVQDS |
Ga0207661_108829722 | 3300025944 | Corn Rhizosphere | VRREDAERFIEEVRGDDLDPSAKLRVEERRLEAGAVQDSGA |
Ga0207708_118391552 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VFVRREDAEQFVEEVLGDDPEAAARLRVEERELEAGGLN |
Ga0207683_110625822 | 3300026121 | Miscanthus Rhizosphere | REDAERFIDVVRGDKPELAASLRIEERQLQAGSRT |
Ga0256867_101504952 | 3300026535 | Soil | DAIETFVRLEDAERFIEEIRDDEPELASHLRIEERELEAGGLK |
Ga0208685_10947681 | 3300027513 | Soil | PLGVDLETFIRREDAERFIEEVRGDEPEVAASLRIEERELEAGGVN |
Ga0208890_10048963 | 3300027523 | Soil | SARCAIETFVRREDAERFIEEVRGDDPGIAAHLRIEERELEGVGGLN |
Ga0208890_10516981 | 3300027523 | Soil | RVFIRRDDAERFIEEVRGDDPKLASDLRIEERELEAEGLN |
Ga0209887_11071292 | 3300027561 | Groundwater Sand | MNRIQFVETFIRREDAARFIKEVRGDEPELASHVQIVERELETASGERCLS |
(restricted) Ga0233416_100021383 | 3300027799 | Sediment | VTRVVRREDAERFSAEVRGDDPEVAAKLRIEEREFEAGGTN |
Ga0209023_101307281 | 3300027870 | Freshwater And Sediment | MRREDTERFIEEVRGDDPELASYLRIVERELETVRLRCTSEEHDA |
(restricted) Ga0233417_105809672 | 3300028043 | Sediment | FIRREDAERFIEEVRGDDAEVAAKLRIEERELDAGGRPRHA |
Ga0247822_117818011 | 3300028592 | Soil | VSLTPRELIRREDPELFIAEVRGDEPEMAVKLRIEERELEAGGLN |
Ga0247819_108094671 | 3300028608 | Soil | VRDAERFIAEVRGDDPELASYLRIEERELKAGGVK |
Ga0307282_103509872 | 3300028784 | Soil | VFVRREDAERFIEEVRGDEPAIAAKLRIEERELEAGGLNSRVARRQ |
Ga0307286_101033682 | 3300028876 | Soil | VETFIRREDAKPFIEEVRGDKSDLASYLQFEERELDAGGPN |
Ga0299907_107866102 | 3300030006 | Soil | VCIRREDAERFVEEVRRDAPEEARSLRIVKRELEAGGRN |
Ga0307497_100307702 | 3300031226 | Soil | VFIRREDGERLIEEVRGDEREPAARLRIEREPEAGELN |
Ga0307497_101345902 | 3300031226 | Soil | VCVRREDAESFVEEVRRDARELATFLRIEELEGDGRN |
Ga0299913_105573512 | 3300031229 | Soil | VRREDAERFIEEVRGDEPELAKSLRIEERELRAGELN |
Ga0318541_105388631 | 3300031545 | Soil | HASCTLPRRCVETFIRRGGAERFFKDVRSDEPELARWLRIEERELEAVGRN |
Ga0315278_100632743 | 3300031997 | Sediment | MNRIQFVETFIRHEDAERFIEEVQGDDPELASYLRIEERELEAGGRN |
Ga0310903_108381932 | 3300032000 | Soil | VSFIRREEAERFIEEVRGDDPEMAARLQIEEPELEAGGLN |
Ga0310906_100346633 | 3300032013 | Soil | VEVFVRREDAERFIEEVRGDDPEIAAKLRIEERELETGGSN |
Ga0310906_110369461 | 3300032013 | Soil | DAIEVFLRREDAERFVAEVRGDDPEVAASLRIEERELEPGGLS |
Ga0310890_106010962 | 3300032075 | Soil | VFVRREDAERFIEGVRGDDPGIAAKLRIEEREPEAGG |
Ga0315270_103900352 | 3300032275 | Sediment | RREHAERFIEEVRGDDPELAGYLRIEERELEAGGLN |
Ga0315287_129236681 | 3300032397 | Sediment | FGDAVETFVRREDAERFIEEVRGDDPEMASYLRIEEREREAGGVN |
Ga0315273_102591411 | 3300032516 | Sediment | GSLDHPLGDAVETFLRREDAERFTAEVRSDDPDLASYLRIEERELEAGGLN |
Ga0315273_113778042 | 3300032516 | Sediment | VFARREDAERVVEEVRADDPDLASYLRIDERKLEVGELN |
Ga0247829_110858672 | 3300033550 | Soil | RGEREVGCASEDAERFIEEVRGDDPELASDLRIEKRELEAGARN |
Ga0364924_020638_1178_1297 | 3300033811 | Sediment | TFLRREDAERFVAEVRGDDPELASYLRIEERELEAGGLN |
Ga0364926_010594_413_556 | 3300033812 | Sediment | MNRIQFVETFIRREDAGRFIEEVRGDDPEMAANLRIEERELEAGGRN |
Ga0364930_0239012_136_255 | 3300033814 | Sediment | VGAGREDAERFIEEVRGDDPDIASYLRIEERELEAGGRN |
Ga0364937_145801_390_509 | 3300034113 | Sediment | ARTGRADAERFVEEVRGDDPELASYLRIEERELETCGLN |
Ga0364938_017125_97_231 | 3300034114 | Sediment | MNRIQFVETFIRREDAGRCIEGVRGDDPEMAAKIRIEERENGQG |
Ga0364925_0243934_1_126 | 3300034147 | Sediment | VELEVFIRREDAERFIEEVRGDEPEVAAQLRIEELGVGGPN |
Ga0364940_0012909_1524_1667 | 3300034164 | Sediment | MNRIQFVETFIRREDAGRFIEEVRGDDPEMAANLRIKERELEAGGRN |
Ga0364931_0034555_1364_1492 | 3300034176 | Sediment | RAEVFVRREDVERFFEEVRGDDPELASYLRIEERKLEGGGLN |
Ga0364931_0313614_3_137 | 3300034176 | Sediment | SAPDRARTGRADAERFVEEVRGDDPELASYLRIEERELETCGLN |
Ga0364934_0113886_530_649 | 3300034178 | Sediment | VFIRLEHAERFVEEVQGDDPELAACLRIEDRELEAGGLS |
Ga0364943_0025980_3_143 | 3300034354 | Sediment | PLDVELEGFHRREDAERFIEEVQSDDPDRASCLRIEERELEAGGLN |
⦗Top⦘ |