NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037245

Metagenome / Metatranscriptome Family F037245

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037245
Family Type Metagenome / Metatranscriptome
Number of Sequences 168
Average Sequence Length 40 residues
Representative Sequence PLAFARKHGVDPARSILVGTSSAHRTLATTLGARYVAA
Number of Associated Samples 140
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.61 %
% of genes near scaffold ends (potentially truncated) 95.24 %
% of genes from short scaffolds (< 2000 bps) 91.07 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.214 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.691 % of family members)
Environment Ontology (ENVO) Unclassified
(17.857 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.024 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.30%    β-sheet: 12.12%    Coil/Unstructured: 57.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF07883Cupin_2 9.52
PF13602ADH_zinc_N_2 5.36
PF04828GFA 2.98
PF01022HTH_5 2.98
PF13302Acetyltransf_3 2.38
PF12680SnoaL_2 1.79
PF03741TerC 1.79
PF13396PLDc_N 1.79
PF00795CN_hydrolase 1.79
PF00067p450 1.19
PF01425Amidase 1.19
PF00221Lyase_aromatic 1.19
PF04675DNA_ligase_A_N 1.19
PF00903Glyoxalase 1.19
PF00563EAL 1.19
PF02148zf-UBP 1.19
PF00701DHDPS 1.19
PF10604Polyketide_cyc2 1.19
PF12847Methyltransf_18 0.60
PF00582Usp 0.60
PF04101Glyco_tran_28_C 0.60
PF01896DNA_primase_S 0.60
PF00578AhpC-TSA 0.60
PF01938TRAM 0.60
PF01717Meth_synt_2 0.60
PF00144Beta-lactamase 0.60
PF00480ROK 0.60
PF01872RibD_C 0.60
PF02597ThiS 0.60
PF07920DUF1684 0.60
PF13732DUF4162 0.60
PF00571CBS 0.60
PF00353HemolysinCabind 0.60
PF069833-dmu-9_3-mt 0.60
PF03446NAD_binding_2 0.60
PF03372Exo_endo_phos 0.60
PF13671AAA_33 0.60
PF02190LON_substr_bdg 0.60
PF14342DUF4396 0.60
PF00083Sugar_tr 0.60
PF03200Glyco_hydro_63 0.60
PF00072Response_reg 0.60
PF02635DrsE 0.60
PF02909TetR_C_1 0.60
PF08546ApbA_C 0.60
PF00282Pyridoxal_deC 0.60
PF00127Copper-bind 0.60
PF01041DegT_DnrJ_EryC1 0.60
PF00440TetR_N 0.60
PF10057MpsC 0.60
PF10027DUF2269 0.60
PF13466STAS_2 0.60
PF00230MIP 0.60
PF04087DUF389 0.60
PF13280WYL 0.60
PF13424TPR_12 0.60
PF13649Methyltransf_25 0.60
PF06737Transglycosylas 0.60
PF01510Amidase_2 0.60
PF08240ADH_N 0.60
PF14525AraC_binding_2 0.60
PF06262Zincin_1 0.60
PF01810LysE 0.60
PF05853BKACE 0.60
PF12833HTH_18 0.60
PF12802MarR_2 0.60
PF04075F420H2_quin_red 0.60
PF00892EamA 0.60
PF01243Putative_PNPOx 0.60
PF03729DUF308 0.60
PF13177DNA_pol3_delta2 0.60
PF07080DUF1348 0.60
PF00248Aldo_ket_red 0.60
PF13528Glyco_trans_1_3 0.60
PF00296Bac_luciferase 0.60
PF08002DUF1697 0.60
PF01663Phosphodiest 0.60
PF00132Hexapep 0.60
PF00669Flagellin_N 0.60
PF03734YkuD 0.60
PF07885Ion_trans_2 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG3791Uncharacterized conserved proteinFunction unknown [S] 2.98
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 2.38
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 1.79
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.19
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 1.19
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.19
COG2124Cytochrome P450Defense mechanisms [V] 1.19
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 1.19
COG2986Histidine ammonia-lyaseAmino acid transport and metabolism [E] 1.19
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 1.19
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 1.19
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 1.19
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 1.19
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.60
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.60
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.60
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.60
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.60
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.60
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.60
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.60
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.60
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.60
COG1344Flagellin and related hook-associated protein FlgLCell motility [N] 0.60
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.60
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.60
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.60
COG1808Uncharacterized membrane protein AF0785, contains DUF389 domainFunction unknown [S] 0.60
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.60
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 0.60
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.60
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 0.60
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.60
COG2367Beta-lactamase class ADefense mechanisms [V] 0.60
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.60
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.60
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.60
COG3246Uncharacterized conserved protein, DUF849 familyFunction unknown [S] 0.60
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.60
COG3358Uncharacterized conserved protein, DUF1684 familyFunction unknown [S] 0.60
COG3558Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamilyFunction unknown [S] 0.60
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 0.60
COG3824Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domainPosttranslational modification, protein turnover, chaperones [O] 0.60
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.60

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.81 %
UnclassifiedrootN/A26.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_11519273All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300000956|JGI10216J12902_107466738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae766Open in IMG/M
3300000956|JGI10216J12902_117634601All Organisms → cellular organisms → Bacteria → Terrabacteria group724Open in IMG/M
3300001593|JGI12635J15846_10122983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1830Open in IMG/M
3300001686|C688J18823_10032102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3596Open in IMG/M
3300001686|C688J18823_10069101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2450Open in IMG/M
3300001686|C688J18823_10191452All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300002124|C687J26631_10047350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1503Open in IMG/M
3300002245|JGIcombinedJ26739_101292145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. Hiyo1620Open in IMG/M
3300003861|Ga0031654_10018085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium2052Open in IMG/M
3300004479|Ga0062595_102688380All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300005093|Ga0062594_101545714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria684Open in IMG/M
3300005364|Ga0070673_100075728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2715Open in IMG/M
3300005435|Ga0070714_101926219All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005456|Ga0070678_100951326Not Available787Open in IMG/M
3300005458|Ga0070681_10941820All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300005530|Ga0070679_100269780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1656Open in IMG/M
3300005544|Ga0070686_100556626All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300005544|Ga0070686_101964946All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005576|Ga0066708_10340071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales963Open in IMG/M
3300005617|Ga0068859_100349380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1574Open in IMG/M
3300005713|Ga0066905_101098991Not Available706Open in IMG/M
3300005719|Ga0068861_101017646Not Available792Open in IMG/M
3300005719|Ga0068861_102086383All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005764|Ga0066903_103155753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria892Open in IMG/M
3300005764|Ga0066903_103654471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia828Open in IMG/M
3300005921|Ga0070766_10113851All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300005937|Ga0081455_10062808All Organisms → cellular organisms → Bacteria3120Open in IMG/M
3300005981|Ga0081538_10081750All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300005994|Ga0066789_10397374All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300006046|Ga0066652_100524257Not Available1105Open in IMG/M
3300006058|Ga0075432_10577824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9511Open in IMG/M
3300006358|Ga0068871_100216187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Calidithermus → Calidithermus chliarophilus1659Open in IMG/M
3300006574|Ga0074056_10751961Not Available547Open in IMG/M
3300006576|Ga0074047_11850858Not Available517Open in IMG/M
3300006800|Ga0066660_10019772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3913Open in IMG/M
3300006806|Ga0079220_11699953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9552Open in IMG/M
3300006844|Ga0075428_101936825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9612Open in IMG/M
3300006854|Ga0075425_101478046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium768Open in IMG/M
3300006871|Ga0075434_101665291Not Available646Open in IMG/M
3300006904|Ga0075424_100039523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4907Open in IMG/M
3300007004|Ga0079218_10767995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium919Open in IMG/M
3300009093|Ga0105240_11680693Not Available663Open in IMG/M
3300009094|Ga0111539_10463666All Organisms → cellular organisms → Bacteria → Proteobacteria1475Open in IMG/M
3300009094|Ga0111539_10615940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1264Open in IMG/M
3300009094|Ga0111539_12847144Not Available560Open in IMG/M
3300009098|Ga0105245_12567120Not Available563Open in IMG/M
3300009100|Ga0075418_10017729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7871Open in IMG/M
3300009137|Ga0066709_101470965All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300009147|Ga0114129_10024837All Organisms → cellular organisms → Bacteria → Terrabacteria group8495Open in IMG/M
3300009147|Ga0114129_11300443All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300009147|Ga0114129_12584889Not Available606Open in IMG/M
3300009553|Ga0105249_10286562Not Available1647Open in IMG/M
3300009816|Ga0105076_1113180Not Available534Open in IMG/M
3300010039|Ga0126309_10842519All Organisms → cellular organisms → Bacteria → Terrabacteria group602Open in IMG/M
3300010041|Ga0126312_10549828Not Available828Open in IMG/M
3300010044|Ga0126310_11495764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082554Open in IMG/M
3300010337|Ga0134062_10414879All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300010358|Ga0126370_11030349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300010359|Ga0126376_11171905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium781Open in IMG/M
3300010362|Ga0126377_11802601Not Available687Open in IMG/M
3300010371|Ga0134125_10169551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2433Open in IMG/M
3300010371|Ga0134125_11386127All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300010371|Ga0134125_13072688Not Available506Open in IMG/M
3300010373|Ga0134128_10932321All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300010373|Ga0134128_12282623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300011107|Ga0151490_1391923Not Available1862Open in IMG/M
3300011107|Ga0151490_1701467Not Available511Open in IMG/M
3300012201|Ga0137365_10545647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria851Open in IMG/M
3300012530|Ga0136635_10232819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300012684|Ga0136614_11168415All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012893|Ga0157284_10187226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300012943|Ga0164241_10226478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1337Open in IMG/M
3300012951|Ga0164300_10986572All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300012955|Ga0164298_10929005Not Available636Open in IMG/M
3300012958|Ga0164299_10392671Not Available888Open in IMG/M
3300012958|Ga0164299_10911544Not Available639Open in IMG/M
3300013296|Ga0157374_12806583Not Available515Open in IMG/M
3300013306|Ga0163162_11791278All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus702Open in IMG/M
3300014325|Ga0163163_11549190All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300015200|Ga0173480_10920909Not Available569Open in IMG/M
3300015371|Ga0132258_12484634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1296Open in IMG/M
3300015371|Ga0132258_12635047All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300015371|Ga0132258_13211281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1127Open in IMG/M
3300015372|Ga0132256_100581234All Organisms → cellular organisms → Bacteria → Terrabacteria group1234Open in IMG/M
3300015372|Ga0132256_102338821Not Available637Open in IMG/M
3300015374|Ga0132255_100982989All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300016294|Ga0182041_10613955All Organisms → cellular organisms → Bacteria → Terrabacteria group957Open in IMG/M
3300016341|Ga0182035_11586060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300016387|Ga0182040_10597408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
3300016445|Ga0182038_10565581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium978Open in IMG/M
3300017966|Ga0187776_10241947All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300018034|Ga0187863_10247165Not Available991Open in IMG/M
3300018056|Ga0184623_10082602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1480Open in IMG/M
3300018062|Ga0187784_10424191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 2047081074Open in IMG/M
3300018063|Ga0184637_10335567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium911Open in IMG/M
3300018422|Ga0190265_10350549All Organisms → cellular organisms → Bacteria1562Open in IMG/M
3300018422|Ga0190265_11764586All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300018432|Ga0190275_13266322All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300018433|Ga0066667_11015813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora coriariae716Open in IMG/M
3300018465|Ga0190269_11023398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300018468|Ga0066662_12215004Not Available577Open in IMG/M
3300018469|Ga0190270_10325731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1383Open in IMG/M
3300018469|Ga0190270_11686798Not Available687Open in IMG/M
3300018481|Ga0190271_12019324All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300019377|Ga0190264_10946954All Organisms → cellular organisms → Bacteria → Terrabacteria group680Open in IMG/M
3300021403|Ga0210397_10882719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300021405|Ga0210387_10371320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces carpinensis1266Open in IMG/M
3300021420|Ga0210394_11468368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300021560|Ga0126371_12288975Not Available653Open in IMG/M
3300021560|Ga0126371_13328068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300022309|Ga0224510_10674953All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300023064|Ga0247801_1056276Not Available609Open in IMG/M
3300023266|Ga0247789_1063002All Organisms → cellular organisms → Bacteria → Terrabacteria group699Open in IMG/M
3300025899|Ga0207642_10212633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1075Open in IMG/M
3300025899|Ga0207642_10950761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300025906|Ga0207699_10209989Not Available1323Open in IMG/M
3300025915|Ga0207693_11455049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Trueperales → Trueperaceae → unclassified Trueperaceae → Trueperaceae bacterium507Open in IMG/M
3300025918|Ga0207662_10334606All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300025921|Ga0207652_10507692Not Available1085Open in IMG/M
3300025922|Ga0207646_11306537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300025928|Ga0207700_10272734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1452Open in IMG/M
3300025929|Ga0207664_11889563All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300025938|Ga0207704_10426377Not Available1053Open in IMG/M
3300025998|Ga0208651_1010773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium730Open in IMG/M
3300026095|Ga0207676_11152956All Organisms → cellular organisms → Bacteria → Terrabacteria group767Open in IMG/M
3300026326|Ga0209801_1238925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria700Open in IMG/M
3300027505|Ga0209218_1107295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Trueperales → Trueperaceae → unclassified Trueperaceae → Trueperaceae bacterium585Open in IMG/M
3300027821|Ga0209811_10350091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300027907|Ga0207428_10388683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_91023Open in IMG/M
3300027908|Ga0209006_11164886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia604Open in IMG/M
3300028589|Ga0247818_10563276All Organisms → cellular organisms → Bacteria → Proteobacteria781Open in IMG/M
3300028592|Ga0247822_11676701Not Available540Open in IMG/M
3300028597|Ga0247820_11262558All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300028717|Ga0307298_10140064All Organisms → cellular organisms → Bacteria → Terrabacteria group700Open in IMG/M
3300028812|Ga0247825_10508156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium858Open in IMG/M
3300028828|Ga0307312_10712081Not Available665Open in IMG/M
3300028872|Ga0307314_10250223All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300028889|Ga0247827_10731144All Organisms → cellular organisms → Bacteria → Terrabacteria group648Open in IMG/M
3300028906|Ga0308309_11915345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Trueperales → Trueperaceae → unclassified Trueperaceae → Trueperaceae bacterium500Open in IMG/M
3300030006|Ga0299907_10238135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1496Open in IMG/M
3300030006|Ga0299907_10724240All Organisms → cellular organisms → Bacteria → Terrabacteria group759Open in IMG/M
3300030336|Ga0247826_10418844All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300030336|Ga0247826_10472836Not Available941Open in IMG/M
3300030336|Ga0247826_10974364Not Available672Open in IMG/M
3300030619|Ga0268386_10031070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales4224Open in IMG/M
3300031170|Ga0307498_10055675All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300031226|Ga0307497_10100513Not Available1126Open in IMG/M
3300031572|Ga0318515_10149342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1245Open in IMG/M
3300031680|Ga0318574_10151132All Organisms → cellular organisms → Bacteria → Terrabacteria group1318Open in IMG/M
3300031724|Ga0318500_10702206All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300031748|Ga0318492_10495170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300031782|Ga0318552_10120642All Organisms → cellular organisms → Bacteria → Terrabacteria group1306Open in IMG/M
3300031782|Ga0318552_10315939All Organisms → cellular organisms → Bacteria → Terrabacteria group795Open in IMG/M
3300031893|Ga0318536_10307498Not Available804Open in IMG/M
3300031910|Ga0306923_10744511Not Available1087Open in IMG/M
3300031939|Ga0308174_10413662All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300031939|Ga0308174_11317911Not Available617Open in IMG/M
3300032060|Ga0318505_10436142Not Available619Open in IMG/M
3300032180|Ga0307471_100926208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1039Open in IMG/M
3300032180|Ga0307471_102351756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae673Open in IMG/M
3300032211|Ga0310896_10569413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300033134|Ga0335073_10015937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10506Open in IMG/M
3300033551|Ga0247830_10936214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300033807|Ga0314866_054136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales663Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.57%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.38%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.38%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.38%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.79%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.79%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.19%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.19%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.19%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.19%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.19%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.19%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.19%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.19%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.19%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.60%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.60%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.60%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.60%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.60%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.60%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.60%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.60%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.60%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.60%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022309Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025998Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1151927323300000891SoilPLPGLPLAFARAHRLDPTHSILVGTSTAHRTLAATLVARYESID*
JGI10216J12902_10746673813300000956SoilPLPGLPLAFARAQAVDPSRSILIGTGPAHRTLATTLGARYVPVDLDTGSKR*
JGI10216J12902_11763460113300000956SoilPGLALAFARRHGVDPARSMLVGTSAAHRRMGATLGAELRP*
JGI12635J15846_1012298313300001593Forest SoilGLPLAFGRAKGVDPARSTLAGTGPAHRTLATTLGCRYVAV*
C688J18823_1003210243300001686SoilPGLPLAFARAHSVDPARSVVVGASTAHRTLAAALGARFVPV*
C688J18823_1006910163300001686SoilPGLPLAFARAHDVDPARSLLIGTSPAHRTLATTLGALYVSL*
C688J18823_1019145213300001686SoilFARTHQIDPSRSILIGTGPAHKTLATTLGARYVEA*
C687J26631_1004735013300002124SoilAFARAHGVDPSGSTIVGSGPSQRTLANALGARYVHVVP*
JGIcombinedJ26739_10129214523300002245Forest SoilLPLAFARAHGVDPAXSILIGTGPAHRTLAMTLGAQYVPV*
Ga0031654_1001808513300003861Freshwater Lake SedimentRLPLAFARAHDVDPSRSILVGAAAAHRTLAAALGARYVPAAAXXP*
Ga0062595_10268838013300004479SoilPLPGLVLAFAREHGVDPARSVLAGTGPAHRSLAAALGARYLEP*
Ga0062594_10154571433300005093SoilGLPLAFARVHGVDPARSVVVGASPAHRTLATALGARFVAV*
Ga0070670_10145152923300005331Switchgrass RhizosphereLPGLVLAFCHDRGVDPGRSVLVGTTARHGALATTLGARFDKVG*
Ga0070673_10007572853300005364Switchgrass RhizosphereAFARAHGVDPARSVLIGTSSAHRTLATTLGARFVGVGSKS*
Ga0070714_10192621923300005435Agricultural SoilGLPLAFARAHGLNPARCTLAGTSPAHRTLAAALGTRYVGV*
Ga0070678_10095132613300005456Miscanthus RhizospherePLAFARAHGVDPARSVLIGTSSAHRTLATTLGARFVGVGSKS*
Ga0070681_1094182013300005458Corn RhizospherePLPGLPLAFARAHGVDPARAVLVGTSSAHRTLATTLGARFVGVGSES*
Ga0070679_10026978013300005530Corn RhizospherePPLPGLALAFCRAHGLDPARSTVIGVAPAHRTLAAALGARHLDVR*
Ga0070686_10055662613300005544Switchgrass RhizospherePLPRLILEFARRRDVDPARSTLIGTSAAHRTLATTLGARFVEVS*
Ga0070686_10196494623300005544Switchgrass RhizosphereLPGLPLAFAREHGVDPARSVVIGSGTAHKTLAVTLGARYVSAAPPTP*
Ga0066708_1034007113300005576SoilPGLPLAYARARKLDPARSVVIGSGPAHRTLASALGARYLGEG*
Ga0068859_10034938043300005617Switchgrass RhizospherePLPGLPLEFARRHGVDPARAVLVGTSAAHRTLASALGSSYIHVG*
Ga0066905_10109899123300005713Tropical Forest SoilFARRHGVDPARAVVVGTSTAHRTLANALGAEFVRPA*
Ga0068861_10101764613300005719Switchgrass RhizosphereFARTHGVDPARAALVGTSSAHRTLATTLGARFVAVGSQV*
Ga0068861_10208638313300005719Switchgrass RhizosphereAFARAHGLDRSRSILIGARPAHRQLAEALGARCVNV*
Ga0066903_10315575313300005764Tropical Forest SoilGLALAFARRHDVDPARSLLIGTSTAHRTLAATLGAHYAEPLPEQPA*
Ga0066903_10365447113300005764Tropical Forest SoilAFARRHGVDPSRSKLIGAGPAHRTLAATLGCTYVEA*
Ga0070766_1011385113300005921SoilLAFARRHGVDPARSVVMGTGPSHRTLAATLGARYVPV*
Ga0081455_1006280813300005937Tabebuia Heterophylla RhizosphereYGVDPARSIVVGSSPAHRTLATTLGARFVGTDLR*
Ga0081538_1008175063300005981Tabebuia Heterophylla RhizosphereLALAFARSHGVDPARSTLVGSTPAQRTFAATLGARYLAV*
Ga0066789_1039737423300005994SoilPLPGLPLAFARAHGLDPSRSILVGATVAHRTMAAALGARYVPAAPPVA*
Ga0066652_10052425713300006046SoilLAFARRHGVDPARSLVVGTGPAHRTLAAALGARFAGVQTLE*
Ga0075432_1057782413300006058Populus RhizosphereIDTARSILVGAGPAHRTLATALGARYVPVGTASSP*
Ga0068871_10021618733300006358Miscanthus RhizosphereGVDPARSVVIGSGTAHKTLAVTLGARYVSAAPPTP*
Ga0074056_1075196113300006574SoilGVDPARAVLIGTSSAHRTLATTLGARFVGVGSES*
Ga0074047_1185085823300006576SoilLAFAREHGVDPARSVVIGSGTAHKTLAATLGARYVSPDPPTP*
Ga0066660_1001977213300006800SoilLPLAFARTHGIAPSRSILVGTSPAHRTLATTLGAQYIPV*
Ga0079220_1169995313300006806Agricultural SoilAFARERRIDTARSILVGAGPAHRTLATALGARYVAVGTASSP*
Ga0075428_10193682513300006844Populus RhizosphereLPGLPLAFARERRIDTARSILVGAGPAHRTLATALGARYVAVGTASSP*
Ga0075425_10147804623300006854Populus RhizosphereAFARAAGVDPARSVVIGAGPAHRTLANALGARYVAVA*
Ga0075434_10166529123300006871Populus RhizosphereLVFARRRDVDPARSTLIGTSAAHRTLATTLGARFVEVS*
Ga0075424_10003952313300006904Populus RhizospherePGLPLAFGRAHDVDLGRSLLVGAGAAHRTLATALGARYVEVGTT*
Ga0079218_1076799513300007004Agricultural SoilFARTHGVDPSRSILVGTGPAHRTLATTLGARYVAV*
Ga0105240_1168069313300009093Corn RhizosphereAFSRAVGVDPARSTLVGTSMAHRTLATTLGAHFLGA*
Ga0111539_1046366633300009094Populus RhizosphereGLVLAFAREYGVDPARSVLAGTGPAHRSLAAALGARYLEP*
Ga0111539_1061594033300009094Populus RhizosphereGLPLAFGRAHDVDLGRSLLVGAGAAHRTLATALGARYVEVGTT*
Ga0111539_1284714423300009094Populus RhizosphereGLDPARAVLVGTSAAHRTLATTLGARFVGVGSDS*
Ga0105245_1256712023300009098Miscanthus RhizosphereLIAGLVLAFARARHVDVGRSILVGTSPAHRALAEALGTSYVAA*
Ga0075418_1001772913300009100Populus RhizosphereLPLEFARAHQIDPSSSILIGAGPAHRTLAATLGARYVKV*
Ga0066709_10147096513300009137Grasslands SoilLAFTRRHDLDPPRSLLVGTSPVHRTLATTLGCRYLAASTAAGT*
Ga0114129_10024837143300009147Populus RhizosphereVLEFARRHSVDPARSVVVGASPAHRSLANALGARYVDVGG*
Ga0114129_1130044333300009147Populus RhizosphereVLEFARRHSVDPARSVVVGTSPAHRTLANALGARYVDTG*
Ga0114129_1258488913300009147Populus RhizosphereLPGLPLAFARAHDVDLSRSTLVGTSPAHKTLATTLGARYEAR*
Ga0105249_1028656213300009553Switchgrass RhizosphereARAHGVDPARAVLIGTSSAHRTLATTLGARFVGVGSKS*
Ga0105076_111318013300009816Groundwater SandLPLAFARAHGVDPSSSIVIGTGAAHRTLASALGAQYVQV*
Ga0126309_1084251913300010039Serpentine SoilGLPLAFARAHGIDTTRSVLIGAGPAHRTLATSLGARYVQV*
Ga0126312_1054982813300010041Serpentine SoilGLPLAFARAHNVDPSRSLVIGTGPAHRTLANALSARYLGVVLADA*
Ga0126310_1149576423300010044Serpentine SoilMTFARAHGVEPSRSSLVGVSAAHRTLAATLGARYVDLG*
Ga0134062_1041487933300010337Grasslands SoilGLPLAFARTHQIDPSRSILIGTGPAHKTLATTLGARYIEA*
Ga0126370_1103034933300010358Tropical Forest SoilAKAHAVDPGRSLLVGSSPAHKTLAATLGARYRAID*
Ga0126376_1117190523300010359Tropical Forest SoilHKIDPSRSTLIGTSAAHRTLAATLGAAFVEVARD*
Ga0126377_1180260113300010362Tropical Forest SoilPLAFARKHGVDPARSILVGTSSAHRTLATTLGARYVAA*
Ga0134125_1016955143300010371Terrestrial SoilLALAFARAHDVDPSRSILIGCAPAHRTLATTLDARYIAVE*
Ga0134125_1138612723300010371Terrestrial SoilGLALAFARSHGVDLSRSLVVGTSPAHRTLANTLGAEYRDG*
Ga0134125_1307268823300010371Terrestrial SoilVLAFARARHVDVGRSILVGTSPAHRALAEALGASYVAA*
Ga0134128_1093232113300010373Terrestrial SoilLAFAREHGVDPARSVLAGTGPAHRSLAAALGARYLEP*
Ga0134128_1228262313300010373Terrestrial SoilRATGVDPARSLLVGVGPAHRTLANALGARFAQVA*
Ga0126383_1251623623300010398Tropical Forest SoilDVDPARSLLIGTSTAHRTLAATLGARYAEPLPEQPA*
Ga0151490_139192313300011107SoilFARAHGVDPARAVLIGTSSAHRTLATTLGARFVGVGSES*
Ga0151490_170146713300011107SoilLALAFARAHGVDPARSVVVGTGAAHRSMASALGARLLQPA*
Ga0137365_1054564743300012201Vadose Zone SoilLAFARAHGVDPSRSILVGTGPAHRTLATTLGARYVPVSG*
Ga0157315_104467523300012508Arabidopsis RhizosphereAREREVDPARSLLIGAGPAHRTLADALGARYVQPG*
Ga0136635_1023281923300012530Polar Desert SandFAHAHGADPARSVLVGTSAAHRTLAAALGARLVAP*
Ga0136614_1116841523300012684Polar Desert SandAFAHAHGVDPARSLLIETSLAHRTLATTLDARYVAL*
Ga0157284_1018722613300012893SoilEFARRHGVDPARAVLVGTSAAHRTLASALGSSYIHVG*
Ga0164241_1022647813300012943SoilFARAHGVDPAGSALVGTSPAHRTLAETLGARFVAP*
Ga0164300_1098657213300012951SoilPLPGLVLAFARRHGVDPARSALVGTSSAHRTMAKTLGCAFDAR*
Ga0164298_1092900523300012955SoilLALAFARRHGLDLGSSTVVGASPAHRTLANALGSRFVSA*
Ga0164299_1039267113300012958SoilLPLAFARAHGVDLSRSVVVGTGAAHGTLASALGARYVDA*
Ga0164299_1091154413300012958SoilPGLPLAFALEHSLDPGRSTLVGTSPAHRTLATTLAARYVENGVKAR*
Ga0157374_1280658323300013296Miscanthus RhizosphereRPPLPRLILEFARRRDVDPARSTLIGTSAAHRTLATTLGARFVEVS*
Ga0163162_1179127813300013306Switchgrass RhizosphereVRAVGVDPARSTLVGTSTAHRTLATTLGARFLGA*
Ga0163163_1154919023300014325Switchgrass RhizosphereLPLAFARIHDVDPASSTLLGTSAAHRTLATTLGARYISV*
Ga0173480_1092090913300015200SoilPLPGLALAFARSHEIDLPQSLLVGTGPAHRTLATALGARYASV*
Ga0132258_1248463433300015371Arabidopsis RhizospherePLPGLPLAFARAHGVGPSRSTLVGTSPAHRALANALGARYVEPA*
Ga0132258_1263504713300015371Arabidopsis RhizosphereLAFARAHGVDPARSTLVGNGPAHRTLATTLGARYVAVSA*
Ga0132258_1321128133300015371Arabidopsis RhizospherePLAFARTHGVDPSRSLLVGTGPAHRTMANTLGATLVG*
Ga0132256_10058123423300015372Arabidopsis RhizosphereGLPLAFARRHGVDPARSLVVGSSPAHRTLATTLGARFVGTDARGNG*
Ga0132256_10233882123300015372Arabidopsis RhizosphereLAFSRANDVDPARSLLIGNAPSHRTLATTLGARFVEAANG*
Ga0132255_10098298913300015374Arabidopsis RhizosphereLPGLPLAFARTHGVDPARSALVGTSPAHRTLAATLDARFVDAV*
Ga0182041_1061395513300016294SoilPAARPAGLPLAFARTHEIALAGSIVIGAGPAHRTLATTLGAMYVSA
Ga0182035_1158606023300016341SoilLAFARAHSIDTASSILIGCSRAHRALATTLGARYLPL
Ga0182040_1059740833300016387SoilLPGLLLAFARAHSVDTASSILIGCSRAHRTLATTLGARYVPL
Ga0182038_1056558113300016445SoilAFARAHSIDTASSILIGCSRAHRTLATTLGARYLPL
Ga0187776_1024194713300017966Tropical PeatlandLAFARTHAVDLLRSVVVGVSPTHRTLASALGARHIPV
Ga0187863_1024716513300018034PeatlandLPGLIQAFARANNVDVSRSTLVGAGPAHRTLARTLGAAYVAV
Ga0184623_1008260223300018056Groundwater SedimentMPFASAHGIDPARSVVVGASPAHRTLATTLGAGYVAIGAPESL
Ga0187784_1042419143300018062Tropical PeatlandLAFARTHNVDPARSIVIGTSRAHRTLATALGARYVPCG
Ga0184637_1033556723300018063Groundwater SedimentLAFARAHGIDPSRSVLVGSGPAHKTLATTLDARYVPVRP
Ga0190265_1035054913300018422SoilLPGLPLAFARAHGVDPARSLLVGTVPAHKTLAAALGARYLAA
Ga0190265_1176458633300018422SoilPTLPGLPLAFAREHDVDPSRSTLVGTGPAHKTLATTLGARYVPVETTEPA
Ga0190275_1326632213300018432SoilHGVEPSRSVLVGVSTAHRTLATTLGARFVNAAGRV
Ga0066667_1101581323300018433Grasslands SoilPPLPGLSLAFARAHGVDPARSILVGTSTAHRTLATTLGARYLAV
Ga0190269_1102339813300018465SoilLPGLVLAFAFAHGVDPAQSALVGDGPAHRAIAAAVRARLELLGA
Ga0066662_1221500413300018468Grasslands SoilAFARSQGVDPSRSILVGTGAAHRTLATALGARYVAL
Ga0190270_1032573113300018469SoilAFARRHGVDPAQSLLVGSSPAHRTLATTLGARYVSA
Ga0190270_1168679823300018469SoilFAQANDVDWSRSTLVGTSTAHRTLATTLGARFIAA
Ga0190271_1201932413300018481SoilPLPGLPLAFARRHGVDPAQSVVIGGSAAHRTLANALGAGYVEAS
Ga0190264_1094695413300019377SoilIAFARVHAIDLSRSLLIGSAPAHRTLATALGVRYVPVTP
Ga0210397_1088271913300021403SoilARAHDINPSRSIVIGCSPAHRTIATTLDARYVAVE
Ga0210387_1037132013300021405SoilFCRRHGVDPARSLLVGTSPAHRALAAAVGARFTSHG
Ga0210394_1146836813300021420SoilFARIHDVDPSRSTLIGAGPAHRTLATTLGAGYIAV
Ga0126371_1228897523300021560Tropical Forest SoilLALAFAHAHGVDPARSILIGTSAAHRTLAATLGARYLEA
Ga0126371_1332806823300021560Tropical Forest SoilPGLPLAFAKAHAVDPGRSLLVGSSPAHKTLAATLGARYRAID
Ga0224510_1067495313300022309SedimentPLPGLLLAFARRHGVDPARSVVVGTSAAHRALAVALGASIVST
Ga0247801_105627613300023064SoilPLAFARTHGVDPARAALVGTSSAHRTLATTLGARFVAVGSQV
Ga0247789_106300223300023266SoilVFAREHGIDLSRSAVIGGGPAHRTLATTLGSRYVGSP
Ga0207642_1021263333300025899Miscanthus RhizosphereLPGLPLEFARRHGVDPARAVLVGTSAAHRTLASALGSSYIHVG
Ga0207642_1095076123300025899Miscanthus RhizosphereGLPLAFARRHGVDPARSLLVGSSTTHRALATALGSTYVDISG
Ga0207699_1020998923300025906Corn, Switchgrass And Miscanthus RhizosphereLAFTTAHGLDPARCVVVGSGPAHRTLANALGARHIPVVP
Ga0207693_1145504923300025915Corn, Switchgrass And Miscanthus RhizosphereGARGVDLSRSLVIGSGPAHRTLANALGARHVGVVA
Ga0207662_1033460633300025918Switchgrass RhizosphereGLPLAFARTHGVDPARSLLVGTGHAHRQLAEALGARYLQP
Ga0207652_1050769213300025921Corn RhizospherePLPGLPLAFARAHGVDPARSVLIGTSSAHRTLATTLGARFVGVGSES
Ga0207646_1130653723300025922Corn, Switchgrass And Miscanthus RhizosphereLAFSRVHGVDPSRSILVGTGPAHRTLATTLGARYVPV
Ga0207700_1027273433300025928Corn, Switchgrass And Miscanthus RhizosphereALAFARSHGVEPVRCALIGCSPAHRTLSTTLDARYLAVE
Ga0207664_1188956313300025929Agricultural SoilGLPLAFARAHGLNPARCTLAGTSPAHRTLAAALGTRYVGV
Ga0207704_1042637723300025938Miscanthus RhizosphereGLPLAFAREHGVDPARSVVIGSGTAHKTLAVTLGARYVSAAPPTP
Ga0208651_101077313300025998Rice Paddy SoilPLPGLPLAFAHVHSLDPALCTLIGTSAAHRTLAATLGARYLDA
Ga0207676_1115295643300026095Switchgrass RhizosphereLPGLVLEFARRHSVDPARSVVVGASPAHRSLANALGARYVDVGG
Ga0209801_123892533300026326SoilPGLPLAFARAHRIDPSRSILVGSASAHRTLANTLGAQYVAV
Ga0209218_110729513300027505Forest SoilFARTHGLDLASSVVVGCRPTDRTLATALGARYVAV
Ga0209811_1035009123300027821Surface SoilFARTHGVEPSVSTVIGTGPAHKTLAAALGARYVAV
Ga0207428_1038868313300027907Populus RhizosphereIDTARSILVGAGPAHRTLATALGARYVPVGTASSP
Ga0209006_1116488613300027908Forest SoilLAFARTRGIDPSQSLLVGAAPAHRTLATTLGAMYRAVNAEPR
Ga0247818_1056327613300028589SoilARVPGLPLAFARARGVDPSCSVLIGTGPAHRSLAAALGARYVQAA
Ga0247822_1167670113300028592SoilHGVDPARAVLVGTSSAHRTLATTLGARFVGVGSES
Ga0247820_1126255813300028597SoilSMPGLPLAFAREHGVDPSRSLLVGTGPAHKNLAAALGSRYVQA
Ga0307298_1014006413300028717SoilPLPGLALVFARARDVDLSRSTVVGASPAHATLARTLGCRSVMV
Ga0247825_1050815623300028812SoilHCRPLPGLVLAFARARGVDPARSAFVGTSAAHRTLATTLGASFVEP
Ga0307312_1071208113300028828SoilPPLPGFALAFCRAHSLDPARSTLIGAAPAHRTLAAALGARYLEP
Ga0307314_1025022313300028872SoilMAFARAHGVEPARSVLVGVSAAHRTLATTLGARYVDLG
Ga0247827_1073114423300028889SoilGLVLAFARARGVDPARSAFVGTSAAHRTLATTLGASFVEP
Ga0308309_1191534513300028906SoilALAFARTHGLDLASSVVVGCRPTDRTLATALGARYVAV
Ga0299907_1023813533300030006SoilLPLAFARAHGVDPARSVVVGTGPAHRTLAATLGARYAQPG
Ga0299907_1072424013300030006SoilGLPLAFARTHAVDPARSTLVGTSSAHKTLALTLGARYVAL
Ga0247826_1041884433300030336SoilGLPLAFARAHGVDPSGSVLVGTGPAHRSLAAALGAGYIQAS
Ga0247826_1047283623300030336SoilPLPGLPLAFARAHGVDPARSTVLGTSPAHRTLAAALGADVVLLPRPG
Ga0247826_1097436413300030336SoilAHGVDPARSVLIGTSSAHRTLATTLGARFVGVGSES
Ga0268386_1003107013300030619SoilPGLPLAFARAHDVDPARSTLIGTSAAHRTLATTLCARYLDLTKVG
Ga0307498_1005567513300031170SoilAFARLHGIDPSRSVLVGTGAAHRSMASALGARPLQPA
Ga0307497_1010051313300031226SoilFAREHGIDPARSVVIGSGTAHKTLAATLGARYVSAEPPTP
Ga0318515_1014934213300031572SoilPGLCLAFAHRHGLDPPGSILVGTSSAHRTLAAALGARYVTL
Ga0318574_1015113233300031680SoilLPGLPLAFARHHGVDPARSTLIGVSAAHRTLATTLGATFVTVSVS
Ga0318500_1070220633300031724SoilPGLPLAFARANGVASDRSALVGTSTAHRSLADALGARYVSVSLR
Ga0318492_1049517013300031748SoilFAHRHRLDPARCTLVGTSSAHRTLAATLGARYVPVS
Ga0318552_1012064233300031782SoilLPLAFARASAVDPARSLLVGSSSAHKTLAATLGARYRGVV
Ga0318552_1031593913300031782SoilLAFARTHEIALAGSIVIGAGPAHRTLATTLGAMYVSA
Ga0318536_1030749813300031893SoilPLPGLPLAFSRANAVDPADSILIGCSPAHRTLATTLGARYIPV
Ga0306923_1074451123300031910SoilARHHGVDPARSTLIGVSAAHRTLATTLGATFVTVSVS
Ga0308174_1041366213300031939SoilGLALAFARSHDVDPARSTLIGAGPAHRTLAAALGARHVPV
Ga0308174_1131791123300031939SoilLAFCRAHGLDPARSTVIGRAPAHRTLAAALGARLLDLR
Ga0318505_1043614213300032060SoilGLPLAFSHANAVDPADSILIGCSPAHRTLATTLGARYIPV
Ga0307471_10092620833300032180Hardwood Forest SoilLPGLPLAFARARTLDPARSVVIGSGPAHRTLASALGARYVDAS
Ga0307471_10235175633300032180Hardwood Forest SoilRSAGVDPARSTLVGTSTAHRTLAATLGARYVDVQNERT
Ga0310896_1056941323300032211SoilPLAFAKRHGVDPARSLLVGTSTTHRTLATVLGSTYVDVSG
Ga0335073_10015937133300033134SoilPLPGLALAFARAHGLDPARSVLIGTGPAHRNLAAALGARYLPV
Ga0247830_1093621433300033551SoilPGLLLVFARQHSVDLPRSTLIGSGPAHKTLASTLGARYVGV
Ga0314866_054136_74_1873300033807PeatlandVFARAHDLDPARSLLIGTGPAHRNLAVALGARYVEVA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.