Metagenome / Metatranscriptome Family F037234

Basic Information
Family ID	F037234
Family Type	Metagenome / Metatranscriptome
Number of Sequences	168
Average Sequence Length	38 residues
Representative Sequence	MNKYLKLDPKPSDLTTVRIIKVRTGYRCKDIRRTVVS
Number of Associated Samples	158
Number of Associated Scaffolds	168

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	1.82 %
% of genes near scaffold ends (potentially truncated)	85.12 %
% of genes from short scaffolds (< 2000 bps)	86.31 %
Associated GOLD sequencing projects	154
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Most Common Taxonomy
Group	Eukaryota (50.595 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.095 % of family members)
Environment Ontology (ENVO)	Unclassified (23.214 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (37.500 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 35.38% β-sheet: 0.00% Coil/Unstructured: 64.62%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 168 Family Scaffolds
PF00510	COX3	1.79
PF13302	Acetyltransf_3	0.60
PF00499	Oxidored_q3	0.60
PF07453	NUMOD1	0.60
PF00722	Glyco_hydro_16	0.60
PF00940	RNA_pol	0.60

COG ID	Name	Functional Category	% Frequency in 168 Family Scaffolds
COG1845	Heme/copper-type cytochrome/quinol oxidase, subunit 3	Energy production and conversion [C]	1.79
COG0839	NADH:ubiquinone oxidoreductase subunit 6 (chain J)	Energy production and conversion [C]	0.60
COG2273	Beta-glucanase, GH16 family	Carbohydrate transport and metabolism [G]	0.60
COG5108	Mitochondrial DNA-directed RNA polymerase	Transcription [K]	0.60

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	51.79 %
Unclassified	root	N/A	48.21 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	51.19 %
Unclassified	root	N/A	48.21 %
Viruses	superkingdom	All Organisms → Viruses	0.60 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	50.60 %
Unclassified	root	N/A	48.21 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	31.55 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	16.07 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	31.55 %
Fungi	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	10.71 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	31.55 %
Dikarya	subkingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	7.14 %
Fungi incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis	3.57 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	31.55 %
Ascomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota	6.55 %
Mucoromycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota	3.57 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	31.55 %
saccharomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta	6.55 %
Glomeromycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina	3.57 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	31.55 %
Pezizomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	6.55 %
Glomeromycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes	3.57 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	31.55 %
leotiomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta	5.36 %
Diversisporales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales	3.57 %
Pezizomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	31.55 %
sordariomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta	5.36 %
Diversisporaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae	3.57 %
Pezizales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	31.55 %
Sordariomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes	5.36 %
Diversispora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora	3.57 %
Morchellaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	31.55 %
Hypocreomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae	3.57 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	3.57 %
Sordariomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae	1.79 %
Morchella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	31.55 %
Hypocreales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales	3.57 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	3.57 %
Diaporthales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales	1.79 %
Morchella sect. Distantes	section	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	31.55 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	3.57 %
Ophiocordycipitaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae	2.38 %
Cordycipitaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae	1.19 %
Cryphonectriaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae	1.19 %
Morchella brunnea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes → Morchella brunnea	0.60 %
Gnomoniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	31.55 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	3.57 %
Ophiocordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps	2.38 %
Beauveria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria	1.19 %
Cryphonectria-Endothia species complex	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex	1.19 %
Ophiognomonia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia	0.60 %
Morchella brunnea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes → Morchella brunnea	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	31.55 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	3.57 %
Ophiocordyceps sinensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	2.38 %
Chrysoporthe	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe	1.19 %
Beauveria bassiana	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana	1.19 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.60 %
Morchella brunnea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes → Morchella brunnea	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	31.55 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	3.57 %
Ophiocordyceps sinensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	2.38 %
Chrysoporthe deuterocubensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	1.19 %
Beauveria bassiana D1-5	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	1.19 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.60 %
Morchella brunnea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes → Morchella brunnea	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Rhizophoraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae	31.55 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	3.57 %
Ophiocordyceps sinensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	2.38 %
Chrysoporthe deuterocubensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	1.19 %
Beauveria bassiana D1-5	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	1.19 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.60 %
Morchella brunnea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes → Morchella brunnea	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Rhizophora	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora	31.55 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	3.57 %
Ophiocordyceps sinensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	2.38 %
Chrysoporthe deuterocubensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	1.19 %
Beauveria bassiana D1-5	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	1.19 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.60 %
Morchella brunnea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes → Morchella brunnea	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.21 %
Rhizophora mucronata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	31.55 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	3.57 %
Ophiocordyceps sinensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	2.38 %
Chrysoporthe deuterocubensis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	1.19 %
Beauveria bassiana D1-5	strain	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	1.19 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.60 %
Morchella brunnea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes → Morchella brunnea	0.60 %
Bacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	0.60 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000305\|bgg_mtDRAFT_1023051	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1614	Open in IMG/M
3300000305\|bgg_mtDRAFT_1030998	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	2409	Open in IMG/M
3300000305\|bgg_mtDRAFT_1030999	Not Available	862	Open in IMG/M
3300001161\|JGI12135J13285_100153	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4617	Open in IMG/M
3300001169\|JGI12661J13543_100109	Not Available	2278	Open in IMG/M
3300001305\|C688J14111_10111087	Not Available	837	Open in IMG/M
3300001593\|JGI12635J15846_10049290	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	3224	Open in IMG/M
3300001593\|JGI12635J15846_10195911	Not Available	1340	Open in IMG/M
3300001867\|JGI12627J18819_10007466	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4228	Open in IMG/M
3300001989\|JGI24739J22299_10013909	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	2932	Open in IMG/M
3300002018\|BBAY61_100123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1078	Open in IMG/M
3300002245\|JGIcombinedJ26739_101135196	Not Available	669	Open in IMG/M
3300002677\|Ga0005475J37263_104644	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	911	Open in IMG/M
3300003328\|Ga0006576J49610_1004010	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	896	Open in IMG/M
3300003505\|JGIcombinedJ51221_10281052	Not Available	677	Open in IMG/M
3300003571\|Ga0007419J51692_1027136	Not Available	929	Open in IMG/M
3300003735\|Ga0006780_1054622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	544	Open in IMG/M
3300004967\|Ga0072330_1196738	Not Available	506	Open in IMG/M
3300004971\|Ga0072324_1027011	Not Available	923	Open in IMG/M
3300005175\|Ga0066673_10432042	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	772	Open in IMG/M
3300005344\|Ga0070661_100827950	Not Available	761	Open in IMG/M
3300005556\|Ga0066707_11024748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	503	Open in IMG/M
3300005616\|Ga0068852_100824586	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	942	Open in IMG/M
3300005640\|Ga0075035_1111943	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	816	Open in IMG/M
3300005644\|Ga0075036_1041207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	655	Open in IMG/M
3300005646\|Ga0075040_1006287	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	931	Open in IMG/M
3300005718\|Ga0068866_10753755	Not Available	673	Open in IMG/M
3300005944\|Ga0066788_10001399	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4626	Open in IMG/M
3300005994\|Ga0066789_10226183	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	786	Open in IMG/M
3300005995\|Ga0066790_10040443	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	2026	Open in IMG/M
3300006020\|Ga0058704_10188436	Not Available	1147	Open in IMG/M
3300006028\|Ga0070717_10519105	Not Available	1077	Open in IMG/M
3300006403\|Ga0075514_1928493	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	918	Open in IMG/M
3300006423\|Ga0075039_1101837	Not Available	725	Open in IMG/M
3300006423\|Ga0075039_1103668	Not Available	733	Open in IMG/M
3300006426\|Ga0075037_1178873	Not Available	729	Open in IMG/M
3300006696\|Ga0031674_1171128	Not Available	575	Open in IMG/M
3300006703\|Ga0005508_1202264	Not Available	597	Open in IMG/M
3300006893\|Ga0073928_10303997	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	1197	Open in IMG/M
3300006948\|Ga0099826_10503635	All Organisms → cellular organisms → Eukaryota	565	Open in IMG/M
3300009247\|Ga0103861_10069064	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	571	Open in IMG/M
3300009249\|Ga0103862_1043216	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	623	Open in IMG/M
3300009254\|Ga0103867_1027382	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	598	Open in IMG/M
3300009325\|Ga0116603_104711	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae	3798	Open in IMG/M
3300009352\|Ga0103865_1008935	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	585	Open in IMG/M
3300009635\|Ga0116117_1072756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	850	Open in IMG/M
3300010039\|Ga0126309_10955403	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	572	Open in IMG/M
3300010061\|Ga0127462_164764	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	1605	Open in IMG/M
3300010063\|Ga0127431_102272	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	1158	Open in IMG/M
3300010069\|Ga0127467_147767	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	769	Open in IMG/M
3300010106\|Ga0127472_1052062	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	894	Open in IMG/M
3300010110\|Ga0126316_1032205	Not Available	843	Open in IMG/M
3300010139\|Ga0127464_1217502	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	997	Open in IMG/M
3300010146\|Ga0126320_1159835	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1314	Open in IMG/M
3300010337\|Ga0134062_10522672	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	600	Open in IMG/M
3300010854\|Ga0126360_1096855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1007	Open in IMG/M
3300010856\|Ga0126358_1100207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	519	Open in IMG/M
3300010864\|Ga0126357_1309567	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	843	Open in IMG/M
3300010867\|Ga0126347_1205090	Not Available	522	Open in IMG/M
3300010872\|Ga0136897_11085562	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	535	Open in IMG/M
3300011023\|Ga0138548_101815	Not Available	686	Open in IMG/M
3300011120\|Ga0150983_13233306	Not Available	606	Open in IMG/M
3300011332\|Ga0126317_10495731	Not Available	1189	Open in IMG/M
3300011332\|Ga0126317_11019724	Not Available	950	Open in IMG/M
3300012068\|Ga0153989_1017860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	914	Open in IMG/M
3300012099\|Ga0153957_102268	Not Available	1601	Open in IMG/M
3300012212\|Ga0150985_114700225	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1329	Open in IMG/M
3300012359\|Ga0137385_10687231	Not Available	855	Open in IMG/M
3300012364\|Ga0134027_1022262	Not Available	518	Open in IMG/M
3300012372\|Ga0134037_1107207	Not Available	1010	Open in IMG/M
3300012374\|Ga0134039_1241936	Not Available	584	Open in IMG/M
3300012375\|Ga0134034_1231555	Not Available	1154	Open in IMG/M
3300012406\|Ga0134053_1433193	Not Available	1189	Open in IMG/M
3300012727\|Ga0157531_1030172	Not Available	615	Open in IMG/M
3300012754\|Ga0138278_1053181	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	1965	Open in IMG/M
3300012781\|Ga0138286_1147355	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2481	Open in IMG/M
3300012894\|Ga0160427_10130044	Not Available	1064	Open in IMG/M
3300013295\|Ga0170791_16318122	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1590	Open in IMG/M
3300013312\|Ga0173631_1126740	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	503	Open in IMG/M
3300017417\|Ga0182230_1038627	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	836	Open in IMG/M
3300017440\|Ga0182214_1080350	Not Available	679	Open in IMG/M
3300018432\|Ga0190275_11783740	Not Available	694	Open in IMG/M
3300018504\|Ga0193465_100003	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	3700	Open in IMG/M
3300019212\|Ga0180106_1214792	Not Available	1020	Open in IMG/M
3300019242\|Ga0181502_1271560	Not Available	703	Open in IMG/M
3300019254\|Ga0184641_1102189	Not Available	713	Open in IMG/M
3300019263\|Ga0184647_1257922	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5	683	Open in IMG/M
3300019279\|Ga0184642_1255535	All Organisms → cellular organisms → Eukaryota	3383	Open in IMG/M
3300020068\|Ga0184649_1101668	Not Available	830	Open in IMG/M
3300021088\|Ga0210404_10016919	All Organisms → cellular organisms → Eukaryota	3075	Open in IMG/M
3300021333\|Ga0210324_1106219	Not Available	1303	Open in IMG/M
3300021342\|Ga0206691_1466811	Not Available	626	Open in IMG/M
3300021401\|Ga0210393_10532756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	959	Open in IMG/M
3300021403\|Ga0210397_10405186	All Organisms → cellular organisms → Eukaryota	1020	Open in IMG/M
3300021858\|Ga0213852_1008705	Not Available	724	Open in IMG/M
3300021860\|Ga0213851_1310335	Not Available	641	Open in IMG/M
3300022467\|Ga0224712_10105768	Not Available	1200	Open in IMG/M
3300022530\|Ga0242658_1080216	Not Available	749	Open in IMG/M
3300022530\|Ga0242658_1120008	Not Available	650	Open in IMG/M
3300022533\|Ga0242662_10061119	Not Available	998	Open in IMG/M
3300023259\|Ga0224551_1055177	Not Available	692	Open in IMG/M
3300023708\|Ga0228709_1003885	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	3126	Open in IMG/M
3300025914\|Ga0207671_10365178	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1146	Open in IMG/M
3300026118\|Ga0207675_101385093	Not Available	724	Open in IMG/M
3300026215\|Ga0209849_1001240	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4584	Open in IMG/M
3300026316\|Ga0209155_1179388	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	685	Open in IMG/M
3300026911\|Ga0209620_1001699	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1563	Open in IMG/M
3300027176\|Ga0208992_1001321	Not Available	2469	Open in IMG/M
3300027303\|Ga0208999_1003658	Not Available	1617	Open in IMG/M
3300027766\|Ga0209796_10276426	Not Available	538	Open in IMG/M
3300028019\|Ga0224573_1003584	All Organisms → Viruses → Predicted Viral	1146	Open in IMG/M
3300028181\|Ga0256909_1076871	Not Available	728	Open in IMG/M
3300028452\|Ga0307247_10075108	Not Available	1034	Open in IMG/M
3300029919\|Ga0302141_1107610	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	753	Open in IMG/M
3300029998\|Ga0302271_10378492	Not Available	614	Open in IMG/M
3300030501\|Ga0268244_10084903	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1396	Open in IMG/M
3300030501\|Ga0268244_10523183	Not Available	638	Open in IMG/M
3300030563\|Ga0247653_1007135	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	849	Open in IMG/M
3300030576\|Ga0247644_1076559	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Cryphonectriaceae → Cryphonectria-Endothia species complex → Chrysoporthe → Chrysoporthe deuterocubensis	695	Open in IMG/M
3300030592\|Ga0247612_1204150	Not Available	512	Open in IMG/M
3300030614\|Ga0247657_10037492	Not Available	849	Open in IMG/M
3300030758\|Ga0138305_1558065	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	540	Open in IMG/M
3300030799\|Ga0074010_10175691	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1216	Open in IMG/M
3300030817\|Ga0315864_113527	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	643	Open in IMG/M
3300030860\|Ga0074000_10080843	Not Available	676	Open in IMG/M
3300030875\|Ga0265727_101841	Not Available	653	Open in IMG/M
3300030890\|Ga0315875_126256	Not Available	602	Open in IMG/M
3300030908\|Ga0074005_10180947	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	583	Open in IMG/M
3300030920\|Ga0102762_1045502	Not Available	504	Open in IMG/M
3300030938\|Ga0138299_10996883	Not Available	776	Open in IMG/M
3300030979\|Ga0068589_11777034	Not Available	648	Open in IMG/M
3300030983\|Ga0315886_118079	Not Available	517	Open in IMG/M
3300030993\|Ga0308190_1202518	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	500	Open in IMG/M
3300031009\|Ga0074022_1079493	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	587	Open in IMG/M
3300031009\|Ga0074022_1126476	Not Available	703	Open in IMG/M
3300031048\|Ga0074025_1328185	Not Available	953	Open in IMG/M
3300031057\|Ga0170834_112983294	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes → Morchella brunnea	873	Open in IMG/M
3300031061\|Ga0315844_114004	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	562	Open in IMG/M
3300031065\|Ga0315807_113033	Not Available	582	Open in IMG/M
3300031073\|Ga0315818_122452	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	633	Open in IMG/M
3300031081\|Ga0308185_1007977	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1081	Open in IMG/M
3300031092\|Ga0308204_10005382	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2025	Open in IMG/M
3300031096\|Ga0308193_1007445	Not Available	1196	Open in IMG/M
3300031122\|Ga0170822_10836304	Not Available	604	Open in IMG/M
3300031122\|Ga0170822_14496169	Not Available	620	Open in IMG/M
3300031124\|Ga0308151_1012652	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	799	Open in IMG/M
3300031128\|Ga0170823_15863155	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	808	Open in IMG/M
3300031152\|Ga0307501_10153507	Not Available	627	Open in IMG/M
3300031411\|Ga0102761_10172337	Not Available	912	Open in IMG/M
3300031421\|Ga0308194_10106444	Not Available	814	Open in IMG/M
3300031455\|Ga0307505_10080190	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1455	Open in IMG/M
3300031458\|Ga0315836_111462	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	738	Open in IMG/M
3300031838\|Ga0307518_10072412	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	2495	Open in IMG/M
3300032209\|Ga0334665_111500	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1072	Open in IMG/M
3300032502\|Ga0214490_1100786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	660	Open in IMG/M
3300032515\|Ga0348332_13258622	All Organisms → cellular organisms → Eukaryota	3034	Open in IMG/M
3300032551\|Ga0321339_1121304	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis	587	Open in IMG/M
3300032739\|Ga0315741_10358093	Not Available	1104	Open in IMG/M
3300032740\|Ga0325411_1106610	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	618	Open in IMG/M
3300032823\|Ga0314723_1032801	Not Available	984	Open in IMG/M
3300032896\|Ga0335075_10136091	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	3107	Open in IMG/M
3300033523\|Ga0314768_1068975	Not Available	1200	Open in IMG/M
3300033525\|Ga0314758_1078507	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	924	Open in IMG/M
3300033526\|Ga0314761_1097121	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	655	Open in IMG/M
3300033528\|Ga0316588_1069752	Not Available	862	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	76.79%
Host-Associated	Host-Associated	20.83%
Engineered	Engineered	2.38%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	59.52%
Aquatic	Environmental → Aquatic	17.26%
Plants	Host-Associated → Plants	16.07%
Human	Host-Associated → Human	2.38%
Fungi	Host-Associated → Fungi	1.19%
Built Environment	Engineered → Built Environment	1.19%
Mammals	Host-Associated → Mammals	0.60%
Algae	Host-Associated → Algae	0.60%
Lab Enrichment	Engineered → Lab Enrichment	0.60%
Food Production	Engineered → Food Production	0.60%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.98%
Freshwater	Environmental → Aquatic → Freshwater	13.10%
Phyllosphere	Host-Associated → Plants → Phyllosphere	6.55%
Plant Litter	Environmental → Terrestrial → Plant Litter	4.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.17%
Marine	Environmental → Aquatic → Marine	3.57%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.98%
Digestive System	Host-Associated → Human → Digestive System	2.38%
Peat	Environmental → Terrestrial → Peat	1.79%
Roots	Host-Associated → Plants → Roots	1.19%
Mycelium	Host-Associated → Fungi → Mycelium	1.19%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.60%
Digestive System	Host-Associated → Mammals → Digestive System	0.60%
Red Algae	Host-Associated → Algae → Red Algae	0.60%
Phylloplane	Host-Associated → Plants → Phylloplane	0.60%
Wood	Host-Associated → Plants → Wood	0.60%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.60%
Unclassified	Engineered → Built Environment → Unclassified	0.60%
Solar Panel	Engineered → Built Environment → Solar Panel	0.60%
Unclassified	Engineered → Food Production → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	36.31%
Loam	Environmental → Terrestrial → Soil → Loam	9.52%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.14%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	4.76%
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	4.76%
Sediment	Environmental → Aquatic → Freshwater → Sediment	4.17%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.98%
Lake	Environmental → Aquatic → Freshwater → Lake	2.38%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	2.38%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	2.38%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	2.38%
Oceanic	Environmental → Aquatic → Marine → Oceanic	1.79%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.79%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	1.79%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.19%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.19%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.19%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.19%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	1.19%
Creek	Environmental → Aquatic → Freshwater → Creek	0.60%
Coastal	Environmental → Aquatic → Marine → Coastal	0.60%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.60%
Unclassified	Environmental → Aquatic → Marine → Unclassified	0.60%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.60%
Large Intestine	Host-Associated → Mammals → Digestive System → Large Intestine	0.60%
Ectosymbionts	Host-Associated → Algae → Red Algae → Ectosymbionts	0.60%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.60%
Unclassified	Host-Associated → Plants → Wood → Unclassified	0.60%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified	0.60%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified	0.60%
Unclassified	Engineered → Built Environment → Solar Panel → Unclassified	0.60%
Unclassified	Engineered → Food Production → Unclassified → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.64%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	16.07%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.14%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	6.55%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	4.76%
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	4.76%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	4.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.98%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	2.38%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	2.38%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	2.38%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	2.38%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	1.79%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.79%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.79%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	1.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.19%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.19%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	1.19%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.60%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.60%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.60%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.60%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.60%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	0.60%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.60%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.60%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.60%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.60%
Fecal	Host-Associated → Mammals → Digestive System → Large Intestine → Fecal	0.60%
Unclassified	Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified	0.60%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.60%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	0.60%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified	0.60%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified → Unclassified	0.60%
Unclassified	Engineered → Built Environment → Solar Panel → Unclassified → Unclassified	0.60%
Unclassified	Engineered → Food Production → Unclassified → Unclassified → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	13.10%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	7.14%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	7.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.95%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	4.17%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	4.17%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	4.17%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	2.98%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.98%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	2.38%
River Water	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water	2.38%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	2.38%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	2.38%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	2.38%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.79%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.79%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	1.79%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	1.19%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.19%
Deep Ocean	Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean	1.19%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	1.19%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.19%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.19%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	1.19%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.60%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.60%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.60%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.60%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.60%
Seawater	Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater	0.60%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.60%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.60%
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	0.60%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.60%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.60%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.60%
Enriched Soil Aggregate	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate	0.60%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.60%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.60%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.60%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.60%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.60%
Feces	Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Feces	0.60%
Delisea Pulchra	Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra	0.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.60%
Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots	0.60%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	0.60%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.60%
Root Nodules	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules	0.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.60%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.60%
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	0.60%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.60%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	0.60%
Ionic Liquid And High Solid Enriched	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched	0.60%
Solar Panel Surfaces	Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Solar Panel Surfaces	0.60%
Solar Cell Surface	Engineered → Built Environment → Solar Panel → Unclassified → Unclassified → Solar Cell Surface	0.60%
Processed Fermented Consumer Product	Engineered → Food Production → Unclassified → Unclassified → Unclassified → Processed Fermented Consumer Product	0.60%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000305	Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly	Host-Associated	Open in IMG/M
3300001161	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2	Environmental	Open in IMG/M
3300001169	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2	Environmental	Open in IMG/M
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Host-Associated	Open in IMG/M
3300002018	Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - BBAY61	Host-Associated	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300002677	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF124 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300003328	Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-6-R (Metagenome Metatranscriptome, Counting Only)	Engineered	Open in IMG/M
3300003505	Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)	Environmental	Open in IMG/M
3300003571	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_35 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300003735	Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300004967	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 68 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004971	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005640	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005644	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005646	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005944	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048	Environmental	Open in IMG/M
3300005994	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049	Environmental	Open in IMG/M
3300005995	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050	Environmental	Open in IMG/M
3300006020	Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006403	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006423	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006426	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006696	Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2498 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006703	Marine microbial communities from the Deep Indian Ocean - MP1200 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Host-Associated	Open in IMG/M
3300009247	Microbial communities of water from Amazon river, Brazil - RCM14	Environmental	Open in IMG/M
3300009249	Microbial communities of water from Amazon river, Brazil - RCM15	Environmental	Open in IMG/M
3300009254	Microbial communities of water from Amazon river, Brazil - RCM20	Environmental	Open in IMG/M
3300009325	Processed tobacco microbial communities from USA domestic dry snuff from retail store in Atlanta, GA, USA - Dry Snuff D1 2x mi-seq runs combined	Engineered	Open in IMG/M
3300009352	Microbial communities of water from Amazon river, Brazil - RCM18	Environmental	Open in IMG/M
3300009635	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010061	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010063	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010069	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010106	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010110	Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010139	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010146	Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010854	Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010856	Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010864	Boreal forest soil eukaryotic communities from Alaska, USA - W3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010867	Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010872	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 5)	Environmental	Open in IMG/M
3300010905	Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300011023	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 29 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011332	Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012068	Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC073 MetaG	Host-Associated	Open in IMG/M
3300012099	Attine ant fungus gardens microbial communities from Florida, USA - TSFL041 MetaG	Host-Associated	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012372	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012374	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012375	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012406	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012727	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012754	Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012781	Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012894	Solar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - L	Engineered	Open in IMG/M
3300013295	northern Canada Lakes metatranscriptome co-assembly	Environmental	Open in IMG/M
3300013312	Solar panel surface microbial communities from Valencia, Spain - panel 3	Engineered	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018504	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002418 (ERX1782261-ERR1712132)	Environmental	Open in IMG/M
3300019212	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019242	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019254	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019263	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019279	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020068	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental	Open in IMG/M
3300021333	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021342	Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021858	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021860	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022530	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022533	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300023259	Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24	Environmental	Open in IMG/M
3300023708	Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026215	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)	Environmental	Open in IMG/M
3300026316	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)	Environmental	Open in IMG/M
3300026911	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300027176	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O1 (SPAdes)	Environmental	Open in IMG/M
3300027303	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1 (SPAdes)	Environmental	Open in IMG/M
3300027766	Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)	Host-Associated	Open in IMG/M
3300028019	Spruce roots microbial communities from Bohemian Forest, Czech Republic ? CRU1	Host-Associated	Open in IMG/M
3300028181	Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0762-MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028452	Goat Fecal Pellet Co-assembly of all samples treated with chloramphenicol from Gen5 and Gen10	Host-Associated	Open in IMG/M
3300029919	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2	Environmental	Open in IMG/M
3300029998	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1	Environmental	Open in IMG/M
3300030501	Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e (v2)	Host-Associated	Open in IMG/M
3300030563	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030576	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb9 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030592	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030614	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb10 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030758	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300030799	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-3A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030817	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T25 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030860	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030875	Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLU4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030890	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T29 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030908	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFA (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030920	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030938	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300030979	Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030983	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T33 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030993	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031009	Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 10 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031048	Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 13 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031061	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T19 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031065	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T6 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031073	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T10 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031081	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031092	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031096	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031122	Oak Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031124	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_140 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031411	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031455	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S	Environmental	Open in IMG/M
3300031458	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T16 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032209	Metatranscriptome of plant-associated microbial communities from Arabidopsis thaliana in University of Tennessee, Knoxville, TN, United States - Col_370_1 (Metagenome Metatranscriptome) (v2)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental	Open in IMG/M
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032739	Forest Soil Metatranscriptomics Site 2 LB Combined Assembly	Environmental	Open in IMG/M
3300032740	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4	Host-Associated	Open in IMG/M
3300032823	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032896	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4	Environmental	Open in IMG/M
3300033523	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033525	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F037234

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
bgg_mtDRAFT_10230511	3300000305	Host-Associated	MNEYLILDPKPSDLTMIRVIKARMGYRCKDIQRIVVS*
bgg_mtDRAFT_10309981	3300000305	Host-Associated	DIPDKPIILMIKYLILDPKPSDLTMIRVIKARTGYRCKDTEELW*
bgg_mtDRAFT_10309991	3300000305	Host-Associated	MIKYLILDPKPSDLTMIRVIKARTGYRCKDTEELW*
JGI12135J13285_1001533	3300001161	Forest Soil	MKKYLKLDPKPSDLTTVRIIKVRTGYRCKDIRRTVVS*
JGI12661J13543_1001092	3300001169	Forest Soil	MNKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS*
C688J14111_101110871	3300001305	Soil	KMRKYLELDPEASDLTIIRIIKVRTGCRCIDIRRMVVSK*
JGI12635J15846_100492901	3300001593	Forest Soil	MKKYLKLDPKPGDLTTVRVIKA*TGYRCKDIRRTVVS
JGI12635J15846_101959115	3300001593	Forest Soil	MSKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVV
JGI12627J18819_100074661	3300001867	Forest Soil	MIKYLSRDPKGSDLTMVRLIKGRMGYRCKDIQRTV
JGI24739J22299_100139091	3300001989	Corn Rhizosphere	MNKYLELDPKASDLTMIRVIKARTGYRCKDIRRIVVSK*
BBAY61_1001231	3300002018	Delisea Pulchra	KTSLDKPYEKMNKYLELDPKASDLTMVRVIKARTGYRCIDIRRIVVS*
JGIcombinedJ26739_1011351961	3300002245	Forest Soil	MNKYLELDPKASDLTMIRVIKARTGYRCIDIRGIVVS*
Ga0005475J37263_1046441	3300002677	Forest Soil	MNKYLKLDPKPGDLTMIRVIKARTGYRCKDIRRIVVSSERQN*
Ga0006576J49610_10040101	3300003328	Ionic Liquid And High Solid Enriched	TNYGKMNKYLELDPKASDLTMIRVIKARTGYRCIDIRRIVVSW*
JGIcombinedJ51221_102810521	3300003505	Forest Soil	EIDYEKMKKYLKLDPKTSDLTVIRIIKVRTGYRCKDIRRIMVS*
Ga0007419J51692_10271361	3300003571	Avena Fatua Rhizosphere	DYEKMIKYLELDPEASDLTIIRIIKVRTGCRCIDIRRMVVSK*
Ga0006780_10546221	3300003735	Avena Fatua Rhizosphere	DYEKMNKYLILDPETSDLTIIRIIKVRTGYRCIDIRRMMVS*
Ga0072330_11967382	3300004967	Peatlands Soil	DHKQNEKYLILDPKTSDLTIVRIIKVRTGYRCKDIRRTVVSK*
Ga0072324_10270111	3300004971	Peatlands Soil	MIKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVEVSERQ
Ga0066673_104320421	3300005175	Soil	IMNKYLKLDPKTSDLTIIRIIKVRTGYRCIDIRRIIVSK*
Ga0070661_1008279501	3300005344	Corn Rhizosphere	KENDKYLKLDPKLNDLTIIRIIKVRTGYRCKDIRRIMVSK*
Ga0066707_110247481	3300005556	Soil	FVNEKYLKLDPKASDLTLIRVIKARTGYRCIDIR*
Ga0068852_1008245861	3300005616	Corn Rhizosphere	YLIRDPKSSDLTMVRLIKGRMGYRCKDIQRTVVS*
Ga0075035_11119431	3300005640	Permafrost Soil	NKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS*
Ga0075035_11193252	3300005640	Permafrost Soil	FWVASKFLILDPKRSDLTMIRLLKDRTVWRCIAIRRIVVSW*
Ga0075036_10412071	3300005644	Permafrost Soil	KYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS*
Ga0075040_10062871	3300005646	Permafrost Soil	NKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRIMVS*
Ga0068866_107537551	3300005718	Miscanthus Rhizosphere	KYLKLDPKLNDLTIIRIIKVRTGYRCIDIRRIMVSK*
Ga0068862_1020294201	3300005844	Switchgrass Rhizosphere	LREIDYEKMRKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRMVVSK*
Ga0066788_100013991	3300005944	Soil	MNKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVEVSERQH
Ga0066789_102261832	3300005994	Soil	MIKYLTLDPKPGDLTTVRIIKVRTGYRCKDIRRTVVS*
Ga0066790_100404435	3300005995	Soil	MKKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS*
Ga0058704_101884361	3300006020	Agave	YLKLDPKPSDLTMVRVIKARTGYRCIDIRRTVVSW*
Ga0070717_105191051	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MIKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTV
Ga0075514_19284932	3300006403	Aqueous	MKKYLKLDPKASDLTMVRVVKARTGYRCIDIRRTVVSW*
Ga0075039_11018371	3300006423	Permafrost Soil	MKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVISERQH
Ga0075039_11036681	3300006423	Permafrost Soil	MKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVEVSERQ
Ga0075037_11788731	3300006426	Permafrost Soil	MKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVEVSERQH
Ga0031674_11711281	3300006696	Deep Ocean	IDRQCLELDPKPSDLTIIRKNQKVRTDYRSKDIR*
Ga0005508_12022641	3300006703	Deep Ocean	DYEKMMEYLKLDPETSDLTVIRIIKVRTGYRCKDIRGIMVS*
Ga0073928_103039972	3300006893	Iron-Sulfur Acid Spring	NYEIMNKYLKLDPKPSDLTIIRVIKARTGYRCKDIR*
Ga0099826_105036351	3300006948	Root Nodules	MIKYLILDPKPSDLTMIRNKVRTVYRCIDIRKIMVSIVKDKSD*
Ga0103861_100690641	3300009247	River Water	KYLILDPKPSDLTMIRVIKARMAYRCKDIQRIVVS*
Ga0103862_10432161	3300009249	River Water	KKMSKYLGLDPKASDLTMVRVIKARTGYRCIDIRRTVVSW*
Ga0103867_10273821	3300009254	River Water	IMNEYLILDPKPSDLTMIRVIKARMAYRCKDIQRIVVS*
Ga0116603_1047112	3300009325	Processed Fermented Consumer Product	MNKYLELDPKASDLTMIRVIKARTGYRCKDIRRIVVS*
Ga0103865_10089351	3300009352	River Water	NEYLILDPKPSDLTMIRVIKARMAYRCKDIQRIVVS*
Ga0116117_10727561	3300009635	Peatland	YLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS*
Ga0126309_109554031	3300010039	Serpentine Soil	MNKCLNRDPKGSDLTMVRLIKGRMGYRCKDIQRTVVS
Ga0127462_1647641	3300010061	Grasslands Soil	YEIMNKYLKLDPKPGDLTMIRVIKARTGYRCKDIR*
Ga0127431_1022721	3300010063	Grasslands Soil	DHPSNEQCLNLDPKPGDLTLIRIIKVRTGYRSIDIRRIMVS*
Ga0127467_1477671	3300010069	Grasslands Soil	DYEKMNKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRIMVS*
Ga0127472_10520621	3300010106	Grasslands Soil	MNKYLKLDPKTSDLTIIRIIKVRTGYRCIDIRRIIVSK*
Ga0126316_10322051	3300010110	Soil	IDYEKMRKYLKLDPKTSDLTVIRIIKVRTGYRCKDIRRIMVS*
Ga0127464_12175021	3300010139	Grasslands Soil	DYEKMNKYLKLDPETSDLTIIRIIKVRTGCRCIDIRGIMVS*
Ga0126320_11598351	3300010146	Soil	SDYEKMNKYLKLDPETSDLTIIRIIKVRTGCRCIDIRGIMVS*
Ga0134062_105226721	3300010337	Grasslands Soil	EIMNKYLKLDPKPGDLTMIRVIKARTGYRCKDIR*
Ga0126360_10968551	3300010854	Boreal Forest Soil	DYEKMNKYLKLDPETSDLTIIRIIKVRTGYRCIDIRRIMVSK*
Ga0126358_11002071	3300010856	Boreal Forest Soil	EKMNKYLKLDPETSDLTIIRIIKVRTGYRCIDIRGIMVS*
Ga0126357_13095671	3300010864	Boreal Forest Soil	YLNLDPKTSDLTMIRVIKARTGYRCKDIRRIVVS*
Ga0126347_12050901	3300010867	Boreal Forest Soil	MRAAMPRETNYEIMKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTV
Ga0136897_110855621	3300010872	Soil	YLILDPKPSDLTMIRVIKARMVYRCKDIQRIVVS*
Ga0138112_10441841	3300010905	Grasslands Soil	QLFVNEKYLKLDPKASDLTLIRVIKARTGYRCIDIR*
Ga0138548_1018151	3300011023	Peatlands Soil	NYETMMKYLRLDPKPSDLTMIRIIKVRTAYRCKDIRRIMVS*
Ga0150983_132333061	3300011120	Forest Soil	MILREIDYEKMIKYLKLDPKTSDLTVIRIIKVRTGYRCKDIRRI
Ga0126317_104957311	3300011332	Soil	DYEKMRKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRMVVSK*
Ga0126317_110197241	3300011332	Soil	LKLDPRPSDLTIIRIIKVRTVYRSIDIRRIMVSIVKDNTD*
Ga0153989_10178601	3300012068	Attine Ant Fungus Gardens	YLKLDPKPGDLTMIRVIKARTGYRCKDIRRIVVS*
Ga0153957_1022681	3300012099	Attine Ant Fungus Gardens	YLKLDPLTSDLTFIRIIKVRTGYRCKDIRRINVS*
Ga0150985_1147002251	3300012212	Avena Fatua Rhizosphere	SIKIKIIKYIVLDPKPSDLTMIRSKVRTDYRCKDIRRIVVS*
Ga0137385_106872311	3300012359	Vadose Zone Soil	MKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVV
Ga0134027_10222621	3300012364	Grasslands Soil	MNKYLKLDPKTSDLTIIRIIKVRTGYRCIDIRRIIVS
Ga0134037_11072071	3300012372	Grasslands Soil	LILDPKPSDFTIIRVIKARTGYRCKDIRGIMVGK*
Ga0134039_12419361	3300012374	Grasslands Soil	MNKYLKLDPKTSDLTIIRIIKVRTGYRCIDIRRIIV
Ga0134034_12315551	3300012375	Grasslands Soil	KYLKLDPKPSDLTMIRIIKVRTGYRCIDIRRIVVSW*
Ga0134053_14331931	3300012406	Grasslands Soil	NEQCLNLDPKPGDLTLIRIIKVRTGYRSIDIRRIMVS*
Ga0157531_10301721	3300012727	Freshwater	LKLDPKPGDLTTVRIIKVRTGYRCKDIRRTVVSK*
Ga0138278_10531811	3300012754	Freshwater Lake	DHNVTENDKCLKLDPKPSDLTIVRAIKARTGYCCKNIR*
Ga0138286_11473551	3300012781	Freshwater Lake	MNKYLKLDPKASDLTMVRVVKARTGYRCIDIRGTVVS*
Ga0160427_101300445	3300012894	Solar Cell Surface	MNKYLILDPKPSDLTMIRVIKARMVYRCKDIQRIVV
Ga0170791_163181221	3300013295	Freshwater	RKYLKLDPETSDLTVIRIIKVRTGYRCKDIRGIMVS*
Ga0173631_11267401	3300013312	Solar Panel Surfaces	MNEYLILDPKPSDLTMIRVIKARMVYRCKDIQRIVVS*
Ga0182230_10386271	3300017417	Miscanthus Phyllosphere	MNKYLIRDPKSSDLTMVRLIKGRMGYRCKDIQRTVVS
Ga0182214_10803501	3300017440	Switchgrass Phyllosphere	MIKYLMLDPKPSDLTMIRVIKARMGYRCKDIQRIV
Ga0190275_117837401	3300018432	Soil	MKEYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS
Ga0193465_1000033	3300018504	Marine	MNEYLILDPKPSDLTMIRVIKARMAYRCKDIQRIVVS
Ga0180106_12147921	3300019212	Groundwater Sediment	TGYEIMNKYLKLDPKPSDLTMIRIIKVRTGYRFKDIRRIMVS
Ga0181502_12715601	3300019242	Peatland	MKKYLKLDPKPGDLTTVRVIKARTGYRCRDIRRTVV
Ga0184641_11021891	3300019254	Groundwater Sediment	REIDYEKMRKYLKLDPKTSDLTVIRIIKVRTGYRCKDIRRIMVS
Ga0184647_12579221	3300019263	Groundwater Sediment	LDPKPGDLTIIRIIKVRTGYRCKDIRRIMVSIVKDKTD
Ga0184642_12555351	3300019279	Groundwater Sediment	MSEYLKLDPKPSDLTTIRIIKVRTGYRCKDIRRIVVSK
Ga0184649_11016681	3300020068	Groundwater Sediment	DYIYMTKYLKLDPKPSDLTIIRIIKVRTGYRCKDIRRIMAS
Ga0210404_100169191	3300021088	Soil	MNKYLELDPKASDLTMIRVIKARTGYRCIDIRGIVVS
Ga0210324_11062191	3300021333	Estuarine	PIIKENDKYLKLDPKLNDLTIVRAIKVRTGYRCKDIRRTMVSE
Ga0206691_14668111	3300021342	Seawater	DYEKMMEYLKLDPETSDLTVIRIIKVRTGYRCKDIRGIMVS
Ga0210393_105327561	3300021401	Soil	MNKYLKLDPKPGDLTTVRVIKARTGYRCRDIRRTVVS
Ga0210397_104051861	3300021403	Soil	ERMNKYLKLDPKPGDLTTVRIIKVRTGYRCKDIRRTVVS
Ga0213852_10087051	3300021858	Watersheds	MIKYLTLDPKPGDLTTVRIIKVRTGYRCKDIRRTVVS
Ga0213851_13103352	3300021860	Watersheds	MIKYLTLDPKPGDLTTVRIIKVRTGYRCKDIRRTV
Ga0224712_101057681	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	FRREIDYEKMIKYLKLDPKTSDLTVIRIIKVRTGYRCKDIRRIMVS
Ga0242658_10802161	3300022530	Soil	MKKYLKLDPKPSDLTMVRIIKVRTGYRCKDIRRTVV
Ga0242658_11200081	3300022530	Soil	MIKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS
Ga0242662_100611191	3300022533	Soil	KNIKYLKLDPKSSDLTIVRIIKVRTGYRCIDIRRTMVSIVKDNS
Ga0224551_10551771	3300023259	Soil	MPREINYEIMNKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS
Ga0228709_10038851	3300023708	Freshwater	MNKYLNRDPKDSDLTVIRLIKGRMGYRCKDIQRIMVS
Ga0207671_103651781	3300025914	Corn Rhizosphere	MNKYLNRDPKSSDLTMVRLIKGRMGYRCKDIQRTVVS
Ga0207675_1013850931	3300026118	Switchgrass Rhizosphere	TSNEQCLNLDPKPGDLTLIRIIKVRTGYRSIDIRRIMVS
Ga0209849_10012407	3300026215	Soil	MNKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTV
Ga0209155_11793881	3300026316	Soil	IKYLKLDPKPSDLTMIRIIKVRMGYRCKDIQRIMVS
Ga0209620_10016991	3300026911	Forest Soil	IDYEKMNKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRIMVS
Ga0208992_10013211	3300027176	Forest Soil	MKKYLKLDPKPSDLTTVRIIKVRTGYRCKDIRRTV
Ga0208999_10036585	3300027303	Forest Soil	MKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTV
Ga0209796_102764261	3300027766	Agave	EIDYEKMKKYLKLDPETSDLTVIRIIKVRTGYRCKDIR
Ga0224573_10035842	3300028019	Roots	MNKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS
Ga0256909_10768711	3300028181	Enriched Soil Aggregate	REIDYEKMIKYLELDPEASDLTIIRIIKVRTGCRCIDIRRMVVSK
Ga0307247_100751081	3300028452	Feces	MSKYLGLDPKASDLTMVRVIKARTGYRCIDIRRTV
Ga0302141_11076101	3300029919	Bog	IMKKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS
Ga0302271_103784921	3300029998	Bog	NLNEKYLILDPKPSDLTMIRIIKVRTNYCSINIRRIMVSSERQNLLG
Ga0268244_100849031	3300030501	Agave	NKYLILDPKPSDLTMIRIIKVRMVYRCKDIQRIVVS
Ga0268244_105231831	3300030501	Agave	MNEYLILDPKPSDLTMIRVIKARMVYRCKDIQRIV
Ga0247653_10071351	3300030563	Soil	VEKSIMKKKMIKYLRLDPKTSDLTVIRIIKVRTGYRCKDIRRMVVSK
Ga0247644_10765591	3300030576	Soil	LKLDPKPSDLTIVRTIKVRTGYCCKNIRRTMVSIVKDNSD
Ga0247612_12041501	3300030592	Soil	PKPGDFTIIRVIKARTGYRSKDIRRIMVSLVKDKS
Ga0247657_100374921	3300030614	Soil	SDKTIIIYMKKYLKLDPKPSDLTIIRIIKVRTGYRCKDIR
Ga0138305_15580651	3300030758	Soil	IKYLTLDPKPGDLTTVRIIKVRTGYRCKDIRRTVVS
Ga0074010_101756911	3300030799	Soil	NKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS
Ga0315864_1135271	3300030817	Plant Litter	MNKYLIRDPKSSDLTMVRLIKGRMGYRCKDIQRTVV
Ga0074000_100808431	3300030860	Soil	MKKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTV
Ga0265727_1018411	3300030875	Soil	MNKYLKLDPKPSDLTTVRIIKVRTGYRCKDIRRTVVS
Ga0315875_1262561	3300030890	Plant Litter	IKYLMLDPKAGDLTMIRVIKARTGYRCTDIRRIVVSW
Ga0074005_101809471	3300030908	Soil	KKYLKLDPKPGDLTTVRVIKARTGYRCKDIRRTVVS
Ga0102762_10455021	3300030920	Soil	MLREIDYEKMRKYLKLDPETSDLTVIRIIKVRTGYRCKDIRRIMVS
Ga0138299_109968831	3300030938	Soil	DKYLKLDPKPSDLTMIRIIKVRTGYRCIDIRRIVVSW
Ga0068589_117770341	3300030979	Soil	LILDPKPSDLTMIRIIKVRTVYRSKDIRRIVVSLVKDNTD
Ga0315886_1180791	3300030983	Plant Litter	YLMLDPKTGDLTMIRVIKARTGYRCTDIRRIVVSW
Ga0308190_12025182	3300030993	Soil	RSLKKNGKYLKLDPKPGDLTIVTTIKVGTGYCSKNIRRTMVG
Ga0074022_10794931	3300031009	Soil	NYEIMSKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS
Ga0074022_11264761	3300031009	Soil	MSKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVV
Ga0074025_13281851	3300031048	Soil	MLREIDYEKMRKYLELDPETSDLTIIRIIKVRTGYRCKDIRRIMVS
Ga0170834_1129832941	3300031057	Forest Soil	KKYLKLDPKPSDLTMVRIIKVRTGYRCKDIRRIVVSLVKDNF
Ga0315844_1140041	3300031061	Plant Litter	MNEYLILDPKPSDLTMIRVIKARMVYRCKDIQRIVVS
Ga0315807_1130332	3300031065	Plant Litter	YLMLDPKAGDLTMIRVIKARTGYRCTDIRRIVVSW
Ga0315818_1224521	3300031073	Plant Litter	SYEIMIKYLRLDPKPSDLTMIRVIKARTGYRCKDIRRIVVS
Ga0308185_10079771	3300031081	Soil	DYDLINKYLKLDPKPGDLTMIRVIKARTGYRCKDIR
Ga0308204_100053821	3300031092	Soil	EIMNKYLKLDPKPSDLTMVRVIKARTGYRYIDIRRTVVSW
Ga0308193_10074451	3300031096	Soil	MNKYLKLDPETSDLTIIRIIKVRTGYRCIDIRRIMVSK
Ga0170822_108363041	3300031122	Forest Soil	EKYLKLDPKPSDHAIIRVIKVRTGYRCIDIRRIMASS
Ga0170822_144961691	3300031122	Forest Soil	KYLKLDPKPSDLTMIRIIKVRTGYRCIDIRRIVVSW
Ga0308151_10126521	3300031124	Soil	EKYLKLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS
Ga0170823_158631551	3300031128	Forest Soil	TNYEIMKKYLKLDPKPGDLTTVRVIKARTAYRCKDIRRTVVS
Ga0307501_101535071	3300031152	Soil	TIIIYMKKYLKLDPKPSDLTIIRIIKVRTGYRCKDIR
Ga0102761_101723371	3300031411	Soil	MLREIDYEKMRKYLKLDPETSDLTVIRIIKVRTGYRCKDIRRITVS
Ga0308194_101064441	3300031421	Soil	NKYLKLDPKSSDFTIIRIIKVRTGYRCKDIRRIMVSK
Ga0307505_100801901	3300031455	Soil	DYEKMRKYLKLDPETSDLTIIRIIKVRTGCRCIDIRRMVVSK
Ga0315836_1114621	3300031458	Plant Litter	YLKLDPKPGDLTMIRVIKARTGYRCKDIRRIVVSK
Ga0307518_100724121	3300031838	Ectomycorrhiza	MNKYLELDPKASDLTMIRVIKARTGYRCKDIRRIVVS
Ga0334665_1115001	3300032209	Host-Associated	NYEKMNKYLGLDPKASDLTMIRVVKARTGYRCKDIR
Ga0214490_11007861	3300032502	Switchgrass Phyllosphere	NYEKMKKYLNLDPKPSDLTTVRVIKARTGYRCKDIRRTVVS
Ga0348332_132586221	3300032515	Plant Litter	MLDPKSGDLTIIRIIKVRTGYRCRDIRRIMVSLVKDNA
Ga0321339_11213041	3300032551	Switchgrass Phyllosphere	KYLTLDPKPGDLTTVRIIKVRTGYRCKDIRRIVVGSERQH
Ga0315741_103580932	3300032739	Forest Soil	LREIDYEKMRKYLKLDPETSDLTVIRIIKVRTGYRYKDIRRITVS
Ga0325411_11066101	3300032740	Xylem	KKMIKFLTLDPKASDLTIVRIIKVRTGYRCIDIRRMVVSK
Ga0314723_10328011	3300032823	Switchgrass Phyllosphere	NRLCVNEKYLKLDPKTSDLTIIRILMVRTAYRCIDIRGVVVSR
Ga0335075_101360911	3300032896	Soil	MNKYLGLDLKASDLTMIRVIKARTGYRCIDIRRIVVS
Ga0314768_10689751	3300033523	Switchgrass Phyllosphere	LELDPKPSDLTIIRKNKKVRTDYRSKDIRRIMVSK
Ga0314758_10785071	3300033525	Switchgrass Phyllosphere	MNEYLIRDPKSSDLTMVRLIKGRMGYRCKDIQRTVV
Ga0314761_10971211	3300033526	Switchgrass Phyllosphere	KNDKYLELDPKPSDLTTVRAIKARTGYRCKDIRGTVVS
Ga0316588_10697521	3300033528	Rhizosphere	DPKPGDLTIIRVIKARTAYRSIDIRRIMVRIVKDNTD

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign