NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037142

Metagenome / Metatranscriptome Family F037142

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037142
Family Type Metagenome / Metatranscriptome
Number of Sequences 168
Average Sequence Length 40 residues
Representative Sequence VSESYHYDRIEDRDKAAVDRPKRPWEVAGKEAAVAAKKGRA
Number of Associated Samples 149
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.19 %
% of genes near scaffold ends (potentially truncated) 97.62 %
% of genes from short scaffolds (< 2000 bps) 90.48 %
Associated GOLD sequencing projects 139
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.119 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.286 % of family members)
Environment Ontology (ENVO) Unclassified
(23.214 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.595 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.29%    β-sheet: 0.00%    Coil/Unstructured: 79.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF13474SnoaL_3 15.48
PF13456RVT_3 8.93
PF14559TPR_19 7.14
PF14534DUF4440 6.55
PF13432TPR_16 2.98
PF01544CorA 2.98
PF13414TPR_11 2.38
PF00933Glyco_hydro_3 2.38
PF12850Metallophos_2 1.79
PF07238PilZ 1.19
PF01551Peptidase_M23 1.19
PF01261AP_endonuc_2 1.19
PF00374NiFeSe_Hases 1.19
PF00291PALP 1.19
PF03309Pan_kinase 0.60
PF00155Aminotran_1_2 0.60
PF10978DUF2785 0.60
PF03712Cu2_monoox_C 0.60
PF00596Aldolase_II 0.60
PF13620CarboxypepD_reg 0.60
PF12895ANAPC3 0.60
PF13155Toprim_2 0.60
PF02224Cytidylate_kin 0.60
PF04389Peptidase_M28 0.60
PF13517FG-GAP_3 0.60
PF02782FGGY_C 0.60
PF08338DUF1731 0.60
PF13181TPR_8 0.60
PF02517Rce1-like 0.60
PF07676PD40 0.60
PF00069Pkinase 0.60
PF04366Ysc84 0.60
PF00009GTP_EFTU 0.60
PF13407Peripla_BP_4 0.60
PF03144GTP_EFTU_D2 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 2.98
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.38
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 2.38
COG0374Ni,Fe-hydrogenase I large subunitEnergy production and conversion [C] 1.19
COG3259Coenzyme F420-reducing hydrogenase, alpha subunitEnergy production and conversion [C] 1.19
COG0283Cytidylate kinaseNucleotide transport and metabolism [F] 0.60
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 0.60
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.60
COG1521Pantothenate kinase type IIICoenzyme transport and metabolism [H] 0.60
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.60
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.12 %
UnclassifiedrootN/A14.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M102JR095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
2199352024|deeps_contig44362.27844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae600Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101359031All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1381Open in IMG/M
3300001976|JGI24752J21851_1018673All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae904Open in IMG/M
3300002245|JGIcombinedJ26739_100771808All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter841Open in IMG/M
3300005180|Ga0066685_11144322All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300005337|Ga0070682_100828271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter754Open in IMG/M
3300005434|Ga0070709_10407657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1016Open in IMG/M
3300005536|Ga0070697_100679603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter908Open in IMG/M
3300005537|Ga0070730_10647438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300005541|Ga0070733_10735194All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005841|Ga0068863_101191582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter767Open in IMG/M
3300006028|Ga0070717_10457777All Organisms → cellular organisms → Bacteria → Acidobacteria1150Open in IMG/M
3300006028|Ga0070717_10548725All Organisms → cellular organisms → Bacteria → Acidobacteria1046Open in IMG/M
3300006052|Ga0075029_100069157All Organisms → cellular organisms → Bacteria2073Open in IMG/M
3300006052|Ga0075029_100107175Not Available1683Open in IMG/M
3300006052|Ga0075029_101141185All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300006162|Ga0075030_100002242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui17540Open in IMG/M
3300006794|Ga0066658_10820055All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300006880|Ga0075429_100747174All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300009029|Ga0066793_10542887Not Available663Open in IMG/M
3300009089|Ga0099828_11615247All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300009137|Ga0066709_102814493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium645Open in IMG/M
3300009518|Ga0116128_1214462All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300009519|Ga0116108_1218842Not Available557Open in IMG/M
3300009520|Ga0116214_1289668All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300009521|Ga0116222_1164550All Organisms → cellular organisms → Bacteria → Acidobacteria955Open in IMG/M
3300009522|Ga0116218_1036616All Organisms → cellular organisms → Bacteria → Acidobacteria2212Open in IMG/M
3300009524|Ga0116225_1083023All Organisms → cellular organisms → Bacteria → Acidobacteria1499Open in IMG/M
3300009545|Ga0105237_10864194Not Available911Open in IMG/M
3300009551|Ga0105238_12889771All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300009784|Ga0123357_10957194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300010048|Ga0126373_11461949All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium749Open in IMG/M
3300010048|Ga0126373_13084166All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300010361|Ga0126378_12184432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300010362|Ga0126377_11814473All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300010376|Ga0126381_101970326All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M
3300010397|Ga0134124_11066439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium823Open in IMG/M
3300011120|Ga0150983_10181612All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300011269|Ga0137392_10959467All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300012201|Ga0137365_11235457All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300012208|Ga0137376_10188148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1784Open in IMG/M
3300012211|Ga0137377_11803925All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300012351|Ga0137386_10749198All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300012353|Ga0137367_10869807All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300012356|Ga0137371_11115573All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300012363|Ga0137390_10031755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5038Open in IMG/M
3300012469|Ga0150984_111638596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1996Open in IMG/M
3300012469|Ga0150984_120146702Not Available609Open in IMG/M
3300012924|Ga0137413_11479679All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300012925|Ga0137419_10868064All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300012927|Ga0137416_11724317All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300012948|Ga0126375_10306393All Organisms → cellular organisms → Bacteria → Acidobacteria1105Open in IMG/M
3300012971|Ga0126369_10891648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium974Open in IMG/M
3300012975|Ga0134110_10542146All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300013297|Ga0157378_11596478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300013306|Ga0163162_10004993All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis12784Open in IMG/M
3300014169|Ga0181531_10363751Not Available888Open in IMG/M
3300014501|Ga0182024_10400233All Organisms → cellular organisms → Bacteria1776Open in IMG/M
3300015051|Ga0137414_1153236Not Available4327Open in IMG/M
3300015241|Ga0137418_10586988All Organisms → cellular organisms → Bacteria → Acidobacteria876Open in IMG/M
3300016445|Ga0182038_12134947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300017659|Ga0134083_10366034All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300017924|Ga0187820_1208909All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300017924|Ga0187820_1337340Not Available501Open in IMG/M
3300017933|Ga0187801_10478645Not Available525Open in IMG/M
3300017943|Ga0187819_10306941Not Available922Open in IMG/M
3300017955|Ga0187817_10306847All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1012Open in IMG/M
3300017955|Ga0187817_10911254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300017961|Ga0187778_10432398All Organisms → cellular organisms → Bacteria → Acidobacteria867Open in IMG/M
3300017961|Ga0187778_11078288All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300017966|Ga0187776_10634137All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300017973|Ga0187780_10149501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1620Open in IMG/M
3300017975|Ga0187782_10259615Not Available1307Open in IMG/M
3300017975|Ga0187782_10743320Not Available757Open in IMG/M
3300017999|Ga0187767_10126116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis741Open in IMG/M
3300018012|Ga0187810_10397916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300018035|Ga0187875_10231271Not Available1013Open in IMG/M
3300018037|Ga0187883_10242370All Organisms → cellular organisms → Bacteria → Acidobacteria923Open in IMG/M
3300018038|Ga0187855_10577688All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300018047|Ga0187859_10263525Not Available927Open in IMG/M
3300018061|Ga0184619_10024730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2493Open in IMG/M
3300018090|Ga0187770_10162561Not Available1706Open in IMG/M
3300018431|Ga0066655_10605113All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300018468|Ga0066662_11877035Not Available627Open in IMG/M
3300018468|Ga0066662_12483924All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300018482|Ga0066669_10919752All Organisms → cellular organisms → Bacteria → Acidobacteria784Open in IMG/M
3300019275|Ga0187798_1502873Not Available556Open in IMG/M
3300020021|Ga0193726_1058033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1828Open in IMG/M
3300020581|Ga0210399_10365088Not Available1205Open in IMG/M
3300020582|Ga0210395_10766920Not Available720Open in IMG/M
3300020583|Ga0210401_10223768All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300021168|Ga0210406_10189774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1709Open in IMG/M
3300021170|Ga0210400_11230045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae602Open in IMG/M
3300021171|Ga0210405_10083259All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2522Open in IMG/M
3300021171|Ga0210405_11251550All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300021178|Ga0210408_10433879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1046Open in IMG/M
3300021180|Ga0210396_10015676All Organisms → cellular organisms → Bacteria7044Open in IMG/M
3300021180|Ga0210396_10578168All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium978Open in IMG/M
3300021403|Ga0210397_10208118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1401Open in IMG/M
3300021404|Ga0210389_11169505All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300021405|Ga0210387_10474349All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1111Open in IMG/M
3300021420|Ga0210394_11348150All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300021433|Ga0210391_10780157All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300021433|Ga0210391_11370731All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300021474|Ga0210390_10538619All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola982Open in IMG/M
3300021478|Ga0210402_10928474All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300021478|Ga0210402_11784206All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300021479|Ga0210410_10257829All Organisms → cellular organisms → Bacteria1564Open in IMG/M
3300021559|Ga0210409_10662640All Organisms → cellular organisms → Bacteria → Acidobacteria914Open in IMG/M
3300021559|Ga0210409_10888067All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300022557|Ga0212123_10095628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2444Open in IMG/M
3300024330|Ga0137417_1066165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2322Open in IMG/M
3300025454|Ga0208039_1041131All Organisms → cellular organisms → Bacteria → Acidobacteria877Open in IMG/M
3300025459|Ga0208689_1088560All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300025899|Ga0207642_10390858All Organisms → cellular organisms → Bacteria → Acidobacteria830Open in IMG/M
3300025914|Ga0207671_10602050All Organisms → cellular organisms → Bacteria → Acidobacteria876Open in IMG/M
3300025922|Ga0207646_10128619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2279Open in IMG/M
3300025924|Ga0207694_11786087All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300025932|Ga0207690_11353235Not Available595Open in IMG/M
3300025939|Ga0207665_11672836Not Available504Open in IMG/M
3300025944|Ga0207661_11593474All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300026075|Ga0207708_11318896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300026305|Ga0209688_1020869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1267Open in IMG/M
3300026469|Ga0257169_1067613All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300026557|Ga0179587_10562732All Organisms → cellular organisms → Bacteria → Acidobacteria750Open in IMG/M
3300027065|Ga0208489_1013223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300027609|Ga0209221_1024050All Organisms → cellular organisms → Bacteria → Acidobacteria1618Open in IMG/M
3300027619|Ga0209330_1048759Not Available967Open in IMG/M
3300027826|Ga0209060_10392099All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300027867|Ga0209167_10263202Not Available928Open in IMG/M
3300027867|Ga0209167_10787671All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300027875|Ga0209283_10680525All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300027905|Ga0209415_11142094All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300027911|Ga0209698_10300043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1272Open in IMG/M
3300027915|Ga0209069_10571290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300028036|Ga0265355_1004910All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1019Open in IMG/M
3300028808|Ga0302228_10137444All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300028879|Ga0302229_10221081All Organisms → cellular organisms → Bacteria → Acidobacteria862Open in IMG/M
3300028882|Ga0302154_10373783All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300028884|Ga0307308_10546165All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300029636|Ga0222749_10183414All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1038Open in IMG/M
3300029982|Ga0302277_1341988All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii535Open in IMG/M
3300030503|Ga0311370_10425259All Organisms → cellular organisms → Bacteria1659Open in IMG/M
3300030506|Ga0302194_10101675All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1277Open in IMG/M
3300030687|Ga0302309_10224580All Organisms → cellular organisms → Bacteria → Acidobacteria955Open in IMG/M
3300030706|Ga0310039_10292631All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300031010|Ga0265771_1028681All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300031446|Ga0170820_12966970All Organisms → cellular organisms → Bacteria → Acidobacteria1075Open in IMG/M
3300031708|Ga0310686_101765617All Organisms → cellular organisms → Bacteria1915Open in IMG/M
3300031708|Ga0310686_112412593All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300031708|Ga0310686_115142883Not Available1046Open in IMG/M
3300031720|Ga0307469_10937604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae804Open in IMG/M
3300031753|Ga0307477_10175792All Organisms → cellular organisms → Bacteria → Acidobacteria1492Open in IMG/M
3300031910|Ga0306923_10168938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2498Open in IMG/M
3300032160|Ga0311301_10291772All Organisms → cellular organisms → Bacteria → Acidobacteria2625Open in IMG/M
3300032180|Ga0307471_100281486All Organisms → cellular organisms → Bacteria1738Open in IMG/M
3300032261|Ga0306920_103263023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300032515|Ga0348332_13904643All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300032805|Ga0335078_10060346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5572Open in IMG/M
3300032805|Ga0335078_10449256All Organisms → cellular organisms → Bacteria → Acidobacteria1674Open in IMG/M
3300032828|Ga0335080_12059293Not Available551Open in IMG/M
3300032829|Ga0335070_11005565All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300032892|Ga0335081_11180894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium874Open in IMG/M
3300032893|Ga0335069_12359251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300032955|Ga0335076_10032834All Organisms → cellular organisms → Bacteria → Acidobacteria5207Open in IMG/M
3300033134|Ga0335073_10441818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1507Open in IMG/M
3300033402|Ga0326728_10604016All Organisms → cellular organisms → Bacteria854Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.29%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.12%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.76%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.17%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.17%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.57%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.98%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.38%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.38%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.79%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.19%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.19%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.19%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.60%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.60%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.60%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.60%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.60%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.60%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.60%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.60%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.60%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.60%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.60%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.60%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.60%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009784Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019275Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025459Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026469Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-BEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027065Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF006 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028036Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2Host-AssociatedOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030687Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031010Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_055378402189573001Grass SoilSYHYDRIEDRDKAAIDRPKRPWEVAGKAAAVAAKKGRA
deeps_000844102199352024SoilLGTVSESYQYDRVVGRDKPAVDRPKRPWERARAAVATKKSARK
INPhiseqgaiiFebDRAFT_10135903113300000364SoilSLGTVSESYHYDRIENRDKPVLDRPKRPWEVAGKPAAAAAKKGRA*
JGI24752J21851_101867313300001976Corn, Switchgrass And Miscanthus RhizosphereLGTVSESYHYDRVKDRDXAQADRPKRPWQAAAAGAPAKKNPA*
JGIcombinedJ26739_10077180833300002245Forest SoilGTVSDSYQYDRVKDRDEAVVDRPKRPWETAGKQAAVAAKKGRA*
Ga0066685_1114432213300005180SoilTVSESYQYDRIEDRDKPKAERRKRPWEVAGVVATTAATKKGRA*
Ga0070682_10082827123300005337Corn RhizosphereESLGTVSESYQYDRIKDRDKAAADRPKRPWEKAGKLNAAAAKKGRA*
Ga0070709_1040765733300005434Corn, Switchgrass And Miscanthus RhizosphereSLGTVSESYQYDRIKDRDKAAADRPKRPWEKAGKLNAAAAKKGRA*
Ga0070697_10067960333300005536Corn, Switchgrass And Miscanthus RhizosphereTVSESYHYDRIQDRDKPWAERPKRPWEVARVVTTKSKKTRA*
Ga0070730_1064743823300005537Surface SoilSLGTVSESYHYDRIENRDKASVDRPKRPWEVAGKPAAIAAKKGRA*
Ga0070733_1073519413300005541Surface SoilDRIENRDKPVAARPKRPWEKAGVMAAAAAKKGRA*
Ga0068863_10119158213300005841Switchgrass RhizosphereSESYHYDRIKDRDKPAAERPKRPWEKAGATAAAKKGRA*
Ga0070717_1045777713300006028Corn, Switchgrass And Miscanthus RhizosphereGTVSESYQYDRIEDRDKPKAERRKRPWEVAGVVATTAATKKGRA*
Ga0070717_1054872533300006028Corn, Switchgrass And Miscanthus RhizosphereYDRVEDRDKKATDRPKRPWEVAGAAAVLAAKKGRA*
Ga0075029_10006915733300006052WatershedsTVSESYHYDRIENRDKPAVERPKRPWEVAGKQAAVAAKKGRA*
Ga0075029_10010717523300006052WatershedsYDRIENRDKAAVDRPKRPWEVAGKEAAVAAKKGRA*
Ga0075029_10114118533300006052WatershedsSEAYQYDRIVDRDKPAVDRPKRPWEVAGKTAAVAAKKGRA*
Ga0075030_10000224213300006162WatershedsYHYDRIENRDKPAVERPKRPWEVAGKQAAAATKKGRA*
Ga0066658_1082005513300006794SoilTVSESYQYDRIVDRDKPKASRKKRPWEVAGAAVAKTVKKTRG*
Ga0075429_10074717423300006880Populus RhizosphereTVSESYHYDRVKDRDKAQPDRPKRPWQTAAAAAAPAKKNPA*
Ga0066793_1054288733300009029Prmafrost SoilSLGTVSESYHYDRIENRDKAAVDRPKRPWEVAGRQAAVAAKKGRA*
Ga0099828_1161524713300009089Vadose Zone SoilTVSDSYQYDRIENRDKPAEERPKRPWEKADAMAAAAKKSKA*
Ga0066709_10281449313300009137Grasslands SoilQYDRIVDRDKPAAERPKRPWEKIRAAAAGKKSRA*
Ga0116128_121446213300009518PeatlandLGTVSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAVASKAAAAKKGRA*
Ga0116108_121884213300009519PeatlandGTVSESYHYDRIENRDKAAVDRPKRPWEVAGKEAAVAAKKGRA*
Ga0116214_128966823300009520Peatlands SoilSLGTVSESYQYDSIENRDKPVTERPKRPWEKAGVMAVAAAKKSRA*
Ga0116222_116455033300009521Peatlands SoilYHYDRIEDRDKPAVDRPKRPWEVAGKAGAAVAKKGRA*
Ga0116218_103661613300009522Peatlands SoilSLGTVSESYHYDRIEDRDKPAVDRPKRPWEVAGKQAAVAAKKGRA*
Ga0116225_108302343300009524Peatlands SoilDRIEDRDKPAVDRPKRPWEVAGKAGAAVAKKGRA*
Ga0105237_1086419413300009545Corn RhizosphereYDRVEDRDKPVVERPKRPWEVSGKKAVAAKKGRA*
Ga0105238_1288977123300009551Corn RhizosphereGTVSESYHYDRVKDRDRAQADRPKRPWQAAAAGAPAKKNPA*
Ga0123357_1095719413300009784Termite GutTVSESYHYDRLEDRDKPAVDRPKRPWEVAGKAVVVAAKKGRA*
Ga0126373_1146194913300010048Tropical Forest SoilSESYHYDRIENRDQPAVDRPKRPWEVAGKEAAAAAKKGRA*
Ga0126373_1308416623300010048Tropical Forest SoilVSESYHYDRIVDRDKPAVDRPKRPWAVAGKEAAAAAKKGRA*
Ga0126378_1218443223300010361Tropical Forest SoilHYDRIENRDKPAVDRPKRPWEVAGKENAVAAKKGRA*
Ga0126377_1181447333300010362Tropical Forest SoilYDRVVDRDKPSPERPKRPWEVAGSKAKAAKKSRA*
Ga0126381_10197032623300010376Tropical Forest SoilEAYHYDRIQDRDKPQTDRPKRPWDMAGKAIAAKKGRA*
Ga0134124_1106643913300010397Terrestrial SoilQYDRVKDRDKPATEKPKRPWEVAGKGTAKAAKKGRA*
Ga0150983_1018161213300011120Forest SoilALGTVSESYHYDRIEDRDKATVDRPKRPWETAGKAAAAGKKGRA*
Ga0137392_1095946713300011269Vadose Zone SoilHYDRIKDRDKAPVDRPKRPWEVAGKAVSAKAVAAKKGRG*
Ga0137365_1123545723300012201Vadose Zone SoilYQYDRIVDRDKPAAERPKRPWEKIRAAAAGKKSRA*
Ga0137376_1018814843300012208Vadose Zone SoilVSESYQYDRVEDRDKKPTDRPKRPWEVAGAAAALAAKKGRA*
Ga0137377_1180392523300012211Vadose Zone SoilRIEDRDKPKAERRKRPWEVAGVVATTTAATKKGRA*
Ga0137386_1074919823300012351Vadose Zone SoilESYHYDRIQDRDKPWAERPKRPWEVARVVTTKSKKSRA*
Ga0137367_1086980723300012353Vadose Zone SoilGTVSESYQYDRIENRDKPPVERPKRPWEVAGKAAAAAKKGRA*
Ga0137371_1111557313300012356Vadose Zone SoilLGTVSESYQYDRIEDRDKPKGERRKRPWEVAGVVATTAATKKGRA*
Ga0137390_1003175573300012363Vadose Zone SoilQYDRVEDRDKKATDRPKRPWEVAGAAAVLAAKKGRA*
Ga0150984_11163859613300012469Avena Fatua RhizosphereQYDRVEDRDKPGIERPKRPWEVSGKRAAAAKKGRA*
Ga0150984_12014670223300012469Avena Fatua RhizosphereVSEAYQYDRVEDRDKPGIERPKRPWEVSGKRAAAAKKGRA*
Ga0137413_1147967923300012924Vadose Zone SoilSESYEYDRIKDRDKAPVDRPKRPWEVAGNAVTAKAAAAKKGRA*
Ga0137419_1086806423300012925Vadose Zone SoilESYQYDRVENRDKPAVDRPKRPWEVAGKAAAAKKGRA*
Ga0137416_1172431723300012927Vadose Zone SoilYQYDRVEDRDKKATDRPKRPWEVAGAAAVLAAKKGRA*
Ga0126375_1030639323300012948Tropical Forest SoilGTVSESYHYDRIEDRDKFVVERPKRPWEVAGKQAVAAKKGRA*
Ga0126369_1089164823300012971Tropical Forest SoilYDRIENRDKPAVDRPKRPWEVAGKEAAVAAKKGRA*
Ga0134110_1054214613300012975Grasslands SoilVSEAYQYDRIADRDKPAAERPKRPWEKAQAAAASKKSRA*
Ga0157378_1159647813300013297Miscanthus RhizosphereYDRIKDRDKPKAERPKRPWEKAGLTAATAKKGRA*
Ga0163162_10004993133300013306Switchgrass RhizosphereSEAYQYDRVKDRDKPTTEKPKRPWEVAGKDSAKAAKKGRA*
Ga0181531_1036375123300014169BogSESYHYDRIEDRDKAAVDRPKRPWEVAGKGAAVAAKKGRA*
Ga0182024_1040023313300014501PermafrostYDRVKDRDTPEAARPKRPWEVAGAKTATVAKKGRA*
Ga0137414_115323643300015051Vadose Zone SoilLVPVSESYQYDRIKDRDKPTADRPKRPWEKVGKLNAAAAKKGRA*
Ga0137418_1058698823300015241Vadose Zone SoilSYEYDRVVDRDKAQPERPKRPWEVAGKAAAAKKGRA*
Ga0182038_1213494723300016445SoilYHYDRIENRDKPAVERPKRPWEVAGKQAVAAKKGRA
Ga0134083_1036603423300017659Grasslands SoilSYHYDRIQDRDKPWAERPKRPWEIARVVTTKSKKSRA
Ga0187820_120890923300017924Freshwater SedimentSLGTVSESYHYDRIKDRDKAPVDRPKRPWEVAGKAVAAKKGRA
Ga0187820_133734023300017924Freshwater SedimentGTVSESYQYDRVEDRDKPAVERPKRPWEVSGKKAVAAKKGRA
Ga0187801_1047864513300017933Freshwater SedimentLGTVSESYHYDRVENRDKPTVDRPKRPWEVAGKRAVAAKKGRA
Ga0187819_1030694123300017943Freshwater SedimentYDRIENRDKPAVDRPKRPWEVAGKEAAVAAKKGRA
Ga0187817_1030684713300017955Freshwater SedimentTVSDSYHYDRLKDDDKAPVDRPKRPWEVVGKAVAVKKGRA
Ga0187817_1091125423300017955Freshwater SedimentVSEAYQYDRIENRDKPVAERPKRPWERAGAMAAAAAKKSPA
Ga0187778_1043239813300017961Tropical PeatlandTVSEVYHYDRILDRDKPQAERPKRPWERAEQLTAAAAKKNPA
Ga0187778_1107828813300017961Tropical PeatlandSLGTVSESYHYDRIVDRDKPAVERPKRPWEVAGKEAAVAVKKGRA
Ga0187776_1063413713300017966Tropical PeatlandEVYHYDRIEDRDKPQAERRKRPWERAEGVSAAAAKKSPA
Ga0187780_1014950133300017973Tropical PeatlandSYHYDRIENRDKPAVERPKRPWEVAGKEAAAAAKKGRA
Ga0187782_1025961513300017975Tropical PeatlandESYHYDRIENRDQAEAERPKRPWEKAGAMAAAAMKKSRA
Ga0187782_1074332013300017975Tropical PeatlandTVSESYHYDRVENRDTPAVDRPKRPWEVAGKRAVAAKKGRA
Ga0187767_1012611613300017999Tropical PeatlandSLGTVSESYHYDRIENRDKPEAQRPKRPWEVAGAKSMAAAKKSRA
Ga0187810_1039791613300018012Freshwater SedimentLGTVSESYHYDRIENRDKPAADRPKRPWEKAGAMAAAVAKKSPA
Ga0187875_1023127123300018035PeatlandYDRIENRDKAAVDRPKRPWEVAGKEAAVAAKKGRA
Ga0187883_1024237013300018037PeatlandESLGTVSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAVAVKKGRA
Ga0187855_1057768823300018038PeatlandSLGTVSESYHYDRIENRDEAAVDRPKRPWEVAGKQAAAAGKKGRA
Ga0187859_1026352513300018047PeatlandTVSESYHYDRIENRDKPAADRPKRPWEKAGVIAAAAKKGRA
Ga0184619_1002473013300018061Groundwater SedimentDRIEDRDKPKAERRKRPWEVAGVVTTTASTKKGRA
Ga0187770_1016256113300018090Tropical PeatlandTVSESYHYDRIENRDKAEAERPKRPWEKAGAMAAAAMKKSRA
Ga0066655_1060511323300018431Grasslands SoilDSYQYDRVENRDSPVADRPKRPWEKAEAAATAKSGSGKKRA
Ga0066662_1187703513300018468Grasslands SoilVSESYQYDRVEDRDKPTADRPKRPWEVSGKKAVAAKKGRA
Ga0066662_1248392423300018468Grasslands SoilDAYQYDRIEDRDKPKGERPKRPWEVEGARAAAAAKKSRV
Ga0066669_1091975233300018482Grasslands SoilQYDRIEDRDKPKAERRKRQWEVAGVVTTPAATKKGRA
Ga0187798_150287313300019275PeatlandTVSESYHYDRIADRDKAAVDRPKRPWEVAGKEVAAAAKKGRA
Ga0193726_105803343300020021SoilESYDYDRVLNRDKAPAEKPKRPWEKAGKLAAAVAKKGRA
Ga0210399_1036508813300020581SoilGTVSESYQYDRIENRDKAPVDRPKRPWEVAGKAAAAGAKKSRA
Ga0210395_1076692013300020582SoilYHYDRIKDADKAMVDRPKRPWEVAGKAVAGRAVAAKKGRA
Ga0210401_1022376833300020583SoilLGTVSESYHYDRIENRDKPTADRPKRPWEKAGVLAAAAKKGRA
Ga0210406_1018977423300021168SoilTVSESYHYDRIENRDKPTVDRPKRPWEVAGKPTAVAAKKGRA
Ga0210400_1123004513300021170SoilSLYNEPLGTVSESYQYDRIKDRDQPEVERPKRPWETVKAKVAAATKKGRA
Ga0210405_1008325953300021171SoilSESDHYDRIKDNDKAPVDRPKRPWEVAGRAVAAKKGRA
Ga0210405_1125155013300021171SoilESYHYDRIENRDRPVVDRPKRPWEVAGKQAAVAAKKGRA
Ga0210408_1043387933300021178SoilVSESYHYDRIKDRDKPAAERPKRPWEKAGAVAAAAKKGRA
Ga0210396_1001567613300021180SoilLGTVSESYHYDRIENRDKPVLDRPKRPWEVGGKQAAVAAKKGRA
Ga0210396_1057816823300021180SoilSYHYDRIENRDKPAADRPKRPWEKAGVIAAAAKKGRA
Ga0210397_1020811833300021403SoilLGTVSEAYHYDRVKDNDKAPVDRPKRPWEVAVKPVAAKAVAAKKGRA
Ga0210389_1116950513300021404SoilTVSESYQYDRVVDRDKPAAEKPKRPWEVAGAKAAVAKKGRP
Ga0210387_1047434933300021405SoilSESYHYDRVENRDKPTADRPKRPWEKAGVLAAAAKKGRA
Ga0210394_1134815023300021420SoilYHYDRIKDRDKAPVDRPKRPWEVAGKAVVAKAVAAKKGRA
Ga0210391_1078015713300021433SoilGTVSDSYHYDRLKDDDKPPVDRPKRPWEVAGKAVAVKKGRA
Ga0210391_1137073123300021433SoilTVSESYHYDRIEDRDKAAVDRPKRPWEVAGKQAAVAAKKGRA
Ga0210390_1053861913300021474SoilVKDNDKPVVDRPKRPWEKVGSAVSTKAVAVKKGRA
Ga0210402_1092847413300021478SoilSESYQYDRIEDRDKAEVDRPKRPWEVAGKQAAIAAKKGRA
Ga0210402_1178420623300021478SoilESYHYDRVENRDKPAAARPKRPWEKAGVIAAAVKKGRA
Ga0210410_1025782943300021479SoilGTVSESYHYDRIKDRDKAPLDRPKRPWEVAGKSVAAKKGRA
Ga0210409_1066264013300021559SoilESYHYDRIKDRDKPAAERPKRPWEKAGAVAAAAKKGRA
Ga0210409_1088806713300021559SoilGTVSESYHYDRIENRDKPVAARPKRPWEKAGVMAAAAAKKGRA
Ga0212123_1009562813300022557Iron-Sulfur Acid SpringSESYQYDRIEDRDKAPVDRPKRPWEVAGKQAAIAAKKGRA
Ga0137417_106616513300024330Vadose Zone SoilYQYDRVEDRDKKATDRPKRPWEVAGAAAVLAAKKGRA
Ga0208039_104113133300025454PeatlandLGTVSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAVASKAAAAKKGRA
Ga0208689_108856013300025459PeatlandSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAVASKAAAAKKGRA
Ga0207642_1039085813300025899Miscanthus RhizosphereSESYHYDRVKDRDKAQADRPKRPWQAAAAAAPAKKNPA
Ga0207671_1060205023300025914Corn RhizosphereESYQYDRIVDRDKPKASRKKRPWEVAGAAVAKTVKKTRG
Ga0207646_1012861933300025922Corn, Switchgrass And Miscanthus RhizosphereSEAYQYDRIVDRDKPVPERPKRPWEKVQAAVAAKKSRI
Ga0207694_1178608713300025924Corn RhizosphereLGTVSESYHYDRVKDRDRAQADRPKRPWQAAAAGAPAKKNPA
Ga0207690_1135323523300025932Corn RhizosphereSESYQYDRIVDRDKPKASRKKRPWEVAGAAVAKTVKKTRG
Ga0207665_1167283613300025939Corn, Switchgrass And Miscanthus RhizosphereSYHYDRIQDRDKPWAERPKRPWEVARVVTTKSKKSRA
Ga0207661_1159347413300025944Corn RhizosphereSLGTVSESYQYDRIKDRDKAAADRPKRPWEKAGKLNAAAAKKGRA
Ga0207708_1131889613300026075Corn, Switchgrass And Miscanthus RhizosphereYDRVKDRDKPTTEKPKRPWEVAGKDSAKAAKKGRA
Ga0209688_102086913300026305SoilTVSESYQYDRIEDRDKPKAERPKRPWEKAGTLAAAANKKGRA
Ga0257169_106761323300026469SoilYQYDRIKDRDKPKAERPKRPWEKAGTLAAAAAKKGRA
Ga0179587_1056273213300026557Vadose Zone SoilSLGTVSESYQYDRIEDRDKAPVDRPKRPWEVVGKAVAAKAAAGKKGRA
Ga0208489_101322323300027065Forest SoilLGTVSESYQYDRVENRDKPAAERPKRPWEKAGVMAAAAKKGRA
Ga0209221_102405043300027609Forest SoilGTVSESYHYDRVKDHDKAPVDRPKRPWEVAGKAVAGKAVAAKKGRA
Ga0209330_104875913300027619Forest SoilHYDRIENRDKPPVDRPKRPWEVAGKAAAVAAKKGRA
Ga0209060_1039209913300027826Surface SoilSESYQYDRIENRDKSVEARPKRPWEKAGVIAAAAKKGRA
Ga0209167_1026320223300027867Surface SoilLVTVSESYHYDRIENRDKPAPERPKRPWEKAGIPLAAVAKKSPA
Ga0209167_1078767133300027867Surface SoilSEAYQYDRIVGRDKPETERAKRPWEKAQAAAAPKKSRA
Ga0209283_1068052523300027875Vadose Zone SoilDSYQYDRIENRDKPAEERPKRPWEKADAMAAAAKKSKA
Ga0209415_1114209413300027905Peatlands SoilESYHYDRIQDRDKAPVDRPKRPWEVAGKAVGAKAVAAKKGRA
Ga0209698_1030004323300027911WatershedsSLGTVSESYHYDRIENRDKPVVDRPKRPWEVAGKQAAVAAKKGRA
Ga0209069_1057129023300027915WatershedsVSESYHYDRIEDRDKPKAERPKRPWEKAGTLAAAAAKKGRA
Ga0265355_100491013300028036RhizosphereLGTVSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAATVKAVAAQKGRA
Ga0302228_1013744413300028808PalsaYHYDRIEDRDKAVVDRPKRPWEVAGKGAAVAAKKGRA
Ga0302229_1022108133300028879PalsaSYHYDRVKDNDKAPVDRPKRPWEVAGKPVAAKAVAAKKGRA
Ga0302154_1037378313300028882BogDSYHYDRLKDDDKAPVDRPKRPWEVAGKAVAAKKGRA
Ga0307308_1054616523300028884SoilHYDRIQDRDKPKAERPKRPWEKAGTLSAAAAKKGRA
Ga0222749_1018341433300029636SoilVSEAYQYDRIEDRDKPAVQRPKRPWEVAGKPAVAAAKKGRA
Ga0302277_134198823300029982BogRIADRDKAPVDRPKRPWESAGKAVAAKAVAVKKGRA
Ga0311370_1042525923300030503PalsaLGTVSESYHYDRIEDRDKPVAGRPKRPWEVAGKPAAAAAKKGRA
Ga0302194_1010167513300030506BogYHYDRLKDDDKAPVDRPKRPWEVAGKAATVKAVAAKKGRA
Ga0302309_1022458023300030687PalsaYDRLKDDDKAPVDRPKRPWEVAGKAVASKAVAAKKGRA
Ga0310039_1029263113300030706Peatlands SoilYDRIENRDKPATERPKRPWERAGAMAAAAAKKSPA
Ga0265771_102868123300031010SoilGTVSDSYHYDRLKDDDKPPVDRPKRPWEVAGKTAAVKAAAAKKGRA
Ga0170820_1296697013300031446Forest SoilYQYDRIKDRDKPAADRPKRPWEKAGKLNAAAAKKGRA
Ga0310686_10176561713300031708SoilVSESYHYDRVKDNDKAPVDRPKRPWEVAGKAAVVKAVAAKKGRA
Ga0310686_11241259313300031708SoilESLCTVSDSYHYDRLKDDDKAPVDRPKRPWEVAGKAAAAKKGRA
Ga0310686_11514288313300031708SoilNEALGTVSESYHYDRIEDRDKAVVDRPKRPWEVAGKAAVAAKKGRA
Ga0307469_1093760433300031720Hardwood Forest SoilDSYHYDRLKDDDKAPVDRPKRPWEVAGRAVAAKKGRA
Ga0307477_1017579213300031753Hardwood Forest SoilQYDRIEDRDKPATERPKRPWEKLGVAAVTVVKKKTRA
Ga0306923_1016893853300031910SoilYHYDRIEDRDKPQAERRKRPWERAEQLTAAAAKKNPA
Ga0311301_1029177223300032160Peatlands SoilVSESYHYDRIEDRDKAAVDRPKRPWEVAGKEAAVAAKKGRA
Ga0307471_10028148643300032180Hardwood Forest SoilSYQYDRIENRDKPEADRPKRPWEKAGTLAAAAKKGRA
Ga0306920_10326302313300032261SoilYHYDRIENRDQAALDRPKRPWEVAGKQAAIAAKKGRA
Ga0348332_1390464313300032515Plant LitterVSESYHYDRIEDRDKPAVDRPKRPWEVAGKQAVVAAKKGRA
Ga0335078_1006034613300032805SoilYQYDRVKDRDKPTVERPKRPWEVAGKQAIAAKKGRA
Ga0335078_1044925613300032805SoilGSVSESYHYDRIENRDKPAVDRPKRPWEVAGKETAVAAKKGRA
Ga0335080_1205929313300032828SoilYHYDRIENRDKPAAERPKRPWEKAGAIAAALAKKSPA
Ga0335070_1100556513300032829SoilSLGTVSESYQYDRIENRDKPATERPKRPWERAGVMAAAVAKKSPA
Ga0335081_1118089423300032892SoilSLGTVAEAYQYDRIENRDKPAVERPKRPWEVAGQQAAAAKKGRA
Ga0335069_1235925113300032893SoilDRIQERDKPVAERRKRPWEKAGAAVAAAIAKKSPA
Ga0335076_1003283443300032955SoilGTVAEAYQYDRIENRDKPAVERPKRPWEVAGRQAVAAKKGRA
Ga0335073_1044181833300033134SoilIKDRDKPTVERPKRPWEIAGSGAGGRAVAVKKGRG
Ga0326728_1060401623300033402Peat SoilYDRIENRDKAVVDRPKRPWEVAGKEAAVAAKKGRA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.