NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037118

Metagenome / Metatranscriptome Family F037118

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037118
Family Type Metagenome / Metatranscriptome
Number of Sequences 168
Average Sequence Length 47 residues
Representative Sequence MSDHGNEAVTRARKQAAAQGRAQGLEIGWTVFSYLLAGMAAYGII
Number of Associated Samples 153
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.62 %
% of genes from short scaffolds (< 2000 bps) 98.21 %
Associated GOLD sequencing projects 147
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.357 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(27.976 % of family members)
Environment Ontology (ENVO) Unclassified
(23.810 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.762 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.79%    β-sheet: 0.00%    Coil/Unstructured: 45.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF00953Glycos_transf_4 1.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 1.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.36 %
UnclassifiedrootN/A44.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003218|JGI26339J46600_10036447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1367Open in IMG/M
3300003505|JGIcombinedJ51221_10146356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia953Open in IMG/M
3300003505|JGIcombinedJ51221_10222861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii765Open in IMG/M
3300003505|JGIcombinedJ51221_10224987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia762Open in IMG/M
3300003505|JGIcombinedJ51221_10418919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300004080|Ga0062385_10267220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii963Open in IMG/M
3300004082|Ga0062384_100685102Not Available704Open in IMG/M
3300004092|Ga0062389_100223167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1879Open in IMG/M
3300004295|Ga0068932_1353825Not Available523Open in IMG/M
3300004470|Ga0068967_1327210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300004476|Ga0068966_1475515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300004635|Ga0062388_101601596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii662Open in IMG/M
3300005366|Ga0070659_100467635Not Available1072Open in IMG/M
3300005436|Ga0070713_100713414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii958Open in IMG/M
3300005537|Ga0070730_10492336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii787Open in IMG/M
3300005543|Ga0070672_101343012Not Available639Open in IMG/M
3300005591|Ga0070761_10211789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1151Open in IMG/M
3300005610|Ga0070763_10136278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1271Open in IMG/M
3300005618|Ga0068864_100132930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2237Open in IMG/M
3300005842|Ga0068858_100628743Not Available1042Open in IMG/M
3300005921|Ga0070766_10331971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii983Open in IMG/M
3300006028|Ga0070717_10799521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria858Open in IMG/M
3300006041|Ga0075023_100484021Not Available554Open in IMG/M
3300006102|Ga0075015_100664023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300006804|Ga0079221_10480535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii799Open in IMG/M
3300006806|Ga0079220_10381358Not Available911Open in IMG/M
3300006893|Ga0073928_11033109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300006954|Ga0079219_11628031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300007265|Ga0099794_10309343Not Available819Open in IMG/M
3300009088|Ga0099830_11360106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii590Open in IMG/M
3300009098|Ga0105245_11822533Not Available661Open in IMG/M
3300009662|Ga0105856_1148043Not Available713Open in IMG/M
3300009698|Ga0116216_10650527Not Available634Open in IMG/M
3300009698|Ga0116216_10663799Not Available627Open in IMG/M
3300010152|Ga0126318_10571326Not Available754Open in IMG/M
3300010154|Ga0127503_11022697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii583Open in IMG/M
3300010860|Ga0126351_1171739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii744Open in IMG/M
3300010866|Ga0126344_1003481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii650Open in IMG/M
3300010869|Ga0126359_1304150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii512Open in IMG/M
3300010876|Ga0126361_10194090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii858Open in IMG/M
3300010876|Ga0126361_10623349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2165Open in IMG/M
3300010880|Ga0126350_11342616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii531Open in IMG/M
3300010896|Ga0138111_1030106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300011027|Ga0138580_122968Not Available526Open in IMG/M
3300011035|Ga0138542_106949Not Available556Open in IMG/M
3300011074|Ga0138559_1043513Not Available617Open in IMG/M
3300011086|Ga0138564_1049364Not Available715Open in IMG/M
3300011110|Ga0138578_1041278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii599Open in IMG/M
3300011120|Ga0150983_12217853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii740Open in IMG/M
3300011120|Ga0150983_12753272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii725Open in IMG/M
3300011120|Ga0150983_14094078Not Available684Open in IMG/M
3300012357|Ga0137384_10420786Not Available1102Open in IMG/M
3300012374|Ga0134039_1227008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii642Open in IMG/M
3300012917|Ga0137395_10354907Not Available1045Open in IMG/M
3300015374|Ga0132255_102083288Not Available864Open in IMG/M
3300016387|Ga0182040_10380237Not Available1103Open in IMG/M
3300016422|Ga0182039_10607975Not Available956Open in IMG/M
3300017924|Ga0187820_1239781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii579Open in IMG/M
3300017937|Ga0187809_10124690Not Available877Open in IMG/M
3300017937|Ga0187809_10375076Not Available538Open in IMG/M
3300017942|Ga0187808_10063107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1582Open in IMG/M
3300017961|Ga0187778_10961208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii590Open in IMG/M
3300017970|Ga0187783_10417791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii974Open in IMG/M
3300017972|Ga0187781_11414032Not Available515Open in IMG/M
3300018001|Ga0187815_10093756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1264Open in IMG/M
3300018006|Ga0187804_10363837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii637Open in IMG/M
3300018007|Ga0187805_10384377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii651Open in IMG/M
3300018058|Ga0187766_11323757Not Available526Open in IMG/M
3300018090|Ga0187770_11760426Not Available507Open in IMG/M
3300020078|Ga0206352_10540388Not Available684Open in IMG/M
3300020140|Ga0179590_1156183Not Available624Open in IMG/M
3300020579|Ga0210407_10554960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii897Open in IMG/M
3300020580|Ga0210403_11472325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii513Open in IMG/M
3300020581|Ga0210399_10243257Not Available1499Open in IMG/M
3300020581|Ga0210399_11433933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii538Open in IMG/M
3300020582|Ga0210395_10347838Not Available1115Open in IMG/M
3300021180|Ga0210396_11189396Not Available638Open in IMG/M
3300021181|Ga0210388_10896739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii764Open in IMG/M
3300021286|Ga0179583_1115811Not Available704Open in IMG/M
3300021315|Ga0179958_1189841Not Available645Open in IMG/M
3300021407|Ga0210383_10662698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii898Open in IMG/M
3300021479|Ga0210410_10607900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii970Open in IMG/M
3300021559|Ga0210409_11481535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii554Open in IMG/M
3300021860|Ga0213851_1052190Not Available717Open in IMG/M
3300022500|Ga0242643_110581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii667Open in IMG/M
3300022522|Ga0242659_1062826Not Available679Open in IMG/M
3300022531|Ga0242660_1104498Not Available697Open in IMG/M
3300022557|Ga0212123_10442937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii858Open in IMG/M
3300022711|Ga0242674_1072662Not Available506Open in IMG/M
3300022712|Ga0242653_1043244Not Available713Open in IMG/M
3300022716|Ga0242673_1055438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii678Open in IMG/M
3300022721|Ga0242666_1173405Not Available539Open in IMG/M
3300022722|Ga0242657_1226063Not Available527Open in IMG/M
3300022724|Ga0242665_10353833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii526Open in IMG/M
3300025134|Ga0207416_1203945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii617Open in IMG/M
3300025903|Ga0207680_11261482Not Available526Open in IMG/M
3300025908|Ga0207643_10202490Not Available1209Open in IMG/M
3300025910|Ga0207684_10126193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2196Open in IMG/M
3300025913|Ga0207695_10249657All Organisms → cellular organisms → Bacteria1674Open in IMG/M
3300025921|Ga0207652_10770890Not Available855Open in IMG/M
3300026075|Ga0207708_10553558Not Available970Open in IMG/M
3300026481|Ga0257155_1064570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii583Open in IMG/M
3300026843|Ga0208126_1005406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii570Open in IMG/M
3300027560|Ga0207981_1029971Not Available987Open in IMG/M
3300027676|Ga0209333_1102421Not Available779Open in IMG/M
3300027696|Ga0208696_1261542Not Available535Open in IMG/M
3300027817|Ga0209112_10079121Not Available1039Open in IMG/M
3300027853|Ga0209274_10081949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1572Open in IMG/M
3300027853|Ga0209274_10249382Not Available908Open in IMG/M
3300027857|Ga0209166_10151024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1268Open in IMG/M
3300027857|Ga0209166_10192960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1098Open in IMG/M
3300027889|Ga0209380_10471140Not Available734Open in IMG/M
3300027905|Ga0209415_11093310Not Available520Open in IMG/M
3300027986|Ga0209168_10337988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii737Open in IMG/M
3300028716|Ga0307311_10102728Not Available799Open in IMG/M
3300028768|Ga0307280_10278524Not Available606Open in IMG/M
3300028828|Ga0307312_10253829Not Available1138Open in IMG/M
3300028906|Ga0308309_10404301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1171Open in IMG/M
3300028906|Ga0308309_10862677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii786Open in IMG/M
3300029701|Ga0222748_1072222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii629Open in IMG/M
3300030490|Ga0302184_10223197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia781Open in IMG/M
3300030524|Ga0311357_11802380Not Available509Open in IMG/M
3300030525|Ga0210273_1205120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii556Open in IMG/M
3300030528|Ga0210277_10715180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii725Open in IMG/M
3300030549|Ga0210257_10308824Not Available722Open in IMG/M
3300030624|Ga0210251_11087765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii597Open in IMG/M
3300030625|Ga0210259_10079301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii614Open in IMG/M
3300030626|Ga0210291_11094497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii725Open in IMG/M
3300030626|Ga0210291_11359530Not Available547Open in IMG/M
3300030677|Ga0302317_10216460Not Available875Open in IMG/M
3300030706|Ga0310039_10158104Not Available912Open in IMG/M
3300030730|Ga0307482_1303046Not Available515Open in IMG/M
3300030741|Ga0265459_11837851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii716Open in IMG/M
3300030743|Ga0265461_11214957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii779Open in IMG/M
3300030863|Ga0265766_1009005Not Available693Open in IMG/M
3300031057|Ga0170834_112238934Not Available631Open in IMG/M
3300031122|Ga0170822_16018864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii625Open in IMG/M
3300031525|Ga0302326_11170017Not Available1061Open in IMG/M
3300031546|Ga0318538_10660123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii567Open in IMG/M
3300031564|Ga0318573_10262429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii922Open in IMG/M
3300031679|Ga0318561_10488168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii678Open in IMG/M
3300031682|Ga0318560_10491134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii665Open in IMG/M
3300031713|Ga0318496_10521009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii657Open in IMG/M
3300031716|Ga0310813_11306686Not Available671Open in IMG/M
3300031719|Ga0306917_11089647Not Available622Open in IMG/M
3300031754|Ga0307475_10409344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1090Open in IMG/M
3300031765|Ga0318554_10358721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii828Open in IMG/M
3300031765|Ga0318554_10650772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii592Open in IMG/M
3300031770|Ga0318521_10395036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii824Open in IMG/M
3300031770|Ga0318521_10894726Not Available542Open in IMG/M
3300031778|Ga0318498_10523217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii521Open in IMG/M
3300031795|Ga0318557_10520434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii546Open in IMG/M
3300031797|Ga0318550_10296104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii785Open in IMG/M
3300031819|Ga0318568_10191023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1261Open in IMG/M
3300031820|Ga0307473_10565887Not Available779Open in IMG/M
3300031879|Ga0306919_10904296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii677Open in IMG/M
3300031912|Ga0306921_10944511Not Available976Open in IMG/M
3300031939|Ga0308174_10452180Not Available1043Open in IMG/M
3300031954|Ga0306926_10709942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1219Open in IMG/M
3300031959|Ga0318530_10470933Not Available521Open in IMG/M
3300031962|Ga0307479_11573038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia613Open in IMG/M
3300032044|Ga0318558_10513301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii598Open in IMG/M
3300032091|Ga0318577_10448592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii616Open in IMG/M
3300032160|Ga0311301_12801825Not Available532Open in IMG/M
3300032898|Ga0335072_10715603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii976Open in IMG/M
3300033134|Ga0335073_11024521Not Available851Open in IMG/M
3300033290|Ga0318519_10464462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii759Open in IMG/M
3300033829|Ga0334854_106150Not Available674Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil27.98%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.33%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.17%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.57%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil3.57%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.38%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.38%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.79%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.19%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.19%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.19%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.19%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.19%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.19%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.60%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.60%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.60%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004295Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004470Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004476Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010896Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011027Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 70 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011035Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 23 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011074Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011086Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011110Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012374Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021286Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021315Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022500Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026843Soil and rhizosphere microbial communities from Laval, Canada - mgHAA (SPAdes)EnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030525Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO037SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030863Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26339J46600_1003644733300003218Bog Forest SoilMSDHGNEAVTRAQKQAAAQGRARGLETGWTVFSYLLAGMA
JGIcombinedJ51221_1014635623300003505Forest SoilMSSHGNEAVTRAQQAQQQAAAQGRALGLETGWVVFSYLLAGMAAYGIIGWLIGRAVHVALLFPLGM
JGIcombinedJ51221_1022286123300003505Forest SoilMKDRGNEAVTSAQQEAAAVGRAQGLETGWTVFSYLLAGMAAYGI
JGIcombinedJ51221_1022498723300003505Forest SoilMSDHGNEAVTRARKQAAAQGRAQGLEIGWTVFSYLLAGMAAYGIIGWLIGRAVHVALLFPLGM
JGIcombinedJ51221_1041891923300003505Forest SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRAVHV
Ga0062385_1026722013300004080Bog Forest SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVFSYLLAGMAAY
Ga0062384_10068510213300004082Bog Forest SoilMSVHGNEASTRTRQDEAAAQGRAQGLEVGWTVFSYLLAGMAAYG
Ga0062389_10022316713300004092Bog Forest SoilMSNHGNEAVTRAQEQAAAEGRAQGLEIGWTVFSYLLAGMAAYGIIG
Ga0068932_135382523300004295Peatlands SoilMSSTGKEAVTRVDRRAAAAQGRAQGLDIGWTVFSYLIAGMLA
Ga0068967_132721013300004470Peatlands SoilMNDHGNEAVTRARKQAAAQGRAHGLETGWTVFSYLLAGMAAYGGIGWLIGRAVHV
Ga0068966_147551523300004476Peatlands SoilMSSTGKEAVTRVDRRAAAAQGRAQGLDIGWTVFSYLIAGMLAYGAIGW
Ga0062388_10160159613300004635Bog Forest SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVFSYLLAGM
Ga0070659_10046763513300005366Corn RhizosphereMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGMAAYG
Ga0070713_10071341423300005436Corn, Switchgrass And Miscanthus RhizosphereMSDRGNEAVTRAQKQAAAEGRAVGLETGWTVFSYLLAGMA
Ga0070730_1049233623300005537Surface SoilMTDYGNEAVTRARKQAAAEGRAKGLETGWTVFSYLLA
Ga0070672_10134301223300005543Miscanthus RhizosphereMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGMAA
Ga0070761_1021178923300005591SoilMNDHGDEAVTPAARAQQEAAAQGRAQGLETGWTVFSYLLAGMAAYG
Ga0070763_1013627833300005610SoilMNDHGDEAVTPAARAQQEAAAQGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRAVHVPL
Ga0068864_10013293013300005618Switchgrass RhizosphereMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGMAAYGAIGW
Ga0068858_10062874313300005842Switchgrass RhizosphereMSGGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGMA
Ga0070766_1033197133300005921SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVFSYLLAGMAAYG
Ga0070717_1079952133300006028Corn, Switchgrass And Miscanthus RhizosphereMSDRGNEAVTRAQKQAAAEGRAVGLETGWTVFSYLLAGMAAYGIIGWLIGRAVH
Ga0075023_10048402123300006041WatershedsMSDHGNGAAARTAQDQAAAQGRAQGLETGWTVFSYLLA
Ga0075015_10066402313300006102WatershedsMSDHGDEALTRARKQAAAQGRAQGLELGWTVFSYLLAGMAAYGGIGWLI
Ga0079221_1048053513300006804Agricultural SoilMNSGNDASTQARKRAAAQGRAQGLDIGWTVFSYLLAGM
Ga0079220_1038135833300006806Agricultural SoilMSSGNDASTRAQKRAAAEGRAQGLDIGWTVFSYLLAGM
Ga0073928_1103310913300006893Iron-Sulfur Acid SpringMSSGDDARRRAAGKSAEGRARAQGLDVGWTVFGYLISGMLAYGGIGW
Ga0079219_1162803123300006954Agricultural SoilMSSGNDASTQARKRAAAEGRAQGLDIGWTVFSYLLAGMAAYGAIGWLIGRAV
Ga0099794_1030934313300007265Vadose Zone SoilMRYGEAGEMSSGNDASTRAQKGTAAQGRAQGLDIGWTVFGYLISGMLAYGGIGWLIGR
Ga0099830_1136010623300009088Vadose Zone SoilMSSGSNPGTQAPKGTAAQGRTRGLDIGWTVFGYLISGMIAYGGIGWQIGQAVHVQPY*
Ga0105245_1182253313300009098Miscanthus RhizosphereMSSGDDASTRAQKRAAAEGRAQGLDIGWTVFSYLLAGM
Ga0105856_114804313300009662Permafrost SoilMSGHGNETVTRAQQEAAGQGRAHGLETGWTVVSYLLAGMAAYGGIGW
Ga0116216_1065052723300009698Peatlands SoilMSSTGKEAVTRVDRRAAAAQGRAQGLDIGWTVFSYLIAGMLAYGAIGWLIGRAV
Ga0116216_1066379923300009698Peatlands SoilMSDHGNEAATRAQEQAAAQGRAQGLETGWTVFSYLLAGMAAYGG
Ga0126318_1057132613300010152SoilMWSPSSQRRGEAGEMSSGNNASTQAQKRAAAEGRAQGLDIGWTVFSYLLAGMAAYGAIGWLIGRAVH
Ga0127503_1102269723300010154SoilMSSGNDASTQAQKRAAAEGRAQGLDIGWTVFSYLLAGMAAYGAIGWLIGRAVHV
Ga0126351_117173913300010860Boreal Forest SoilMSDHGKAALTPAARAQEQAAAQGRAEGLETGWTVFSYLLAGMAAYGAVGWLIGR
Ga0126344_100348123300010866Boreal Forest SoilMSDHGDEAVTPAARAQQEAAAQGRAQGLETGWTVF
Ga0126359_130415023300010869Boreal Forest SoilMSDHGDEAVTPAARAQQEAAAQGRAQGLETGWIVFSYLLA
Ga0126361_1019409013300010876Boreal Forest SoilMSDHGDEAVTPAARAQQEAAAQGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRAVHVPL
Ga0126361_1062334933300010876Boreal Forest SoilMSDHGDEAVSPAARAQQQAAAEGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRAVHV
Ga0126350_1134261613300010880Boreal Forest SoilMSDHGDEAVTPAARAQQEAAAQGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRA
Ga0138111_103010623300010896Grasslands SoilMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGMAAYGAIGWLIGRAVHVSLLFP
Ga0138580_12296813300011027Peatlands SoilMSSTGKEAVTRVDRRAAAAQGRAQGLDIGWTVFSYLIAGMLAYGAIGWLIGR
Ga0138542_10694923300011035Peatlands SoilMSSTGKEAVTRFDRRAAAAQGRAQGLDIGWTVFSYLIAGMLAYGAIGWLI
Ga0138559_104351313300011074Peatlands SoilMSSTGKEAVTRVDRRAAAAQGRAQGLDIGWTVFSYL
Ga0138564_104936423300011086Peatlands SoilMTDHGTGADTPAARAQKQAAAQGRAAGLETGWTVFSYLLAGMAA
Ga0138578_104127813300011110Peatlands SoilMNDHGNEAVTRARKQAAAQGRAHGLETGWTVFSYLLAGMAAYGGIGWLIGRTVH
Ga0150983_1221785313300011120Forest SoilMSSHGKEAVSRAHEQAQKQAAAQGRAQGLEVGWTVFSYLLAGMAAYGIIGWL
Ga0150983_1275327213300011120Forest SoilMSNHGNEAVTNEAVTRAQEQAAAEGRAQGLEIGWTVFSYLLAGMAAYG
Ga0150983_1409407823300011120Forest SoilMNDHGNEAVTRVRKQAAAQGRAQGLETGWTVFSYL
Ga0137384_1042078613300012357Vadose Zone SoilMSSGNDTSTRAQKGAAAQGRARGLDIGWTVFGYLISGMLAYGGIGW
Ga0134039_122700813300012374Grasslands SoilMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGMA
Ga0137395_1035490723300012917Vadose Zone SoilMSSGNDASTRAQKGAAAQGRARGLDIGWTVFGYLI
Ga0132255_10208328813300015374Arabidopsis RhizosphereMSSGDDARAQAQKRAAAQGRAQGLDIGWTVFIYQLAGMAAYGAIGWL
Ga0182040_1038023713300016387SoilMTNYGDEAVARAQKQAAARGRAQGLEVGWTVFSYL
Ga0182039_1060797513300016422SoilMTNYGDEAVARAQGAQKQAAARGRAQGLEVGWTVFSYLLAGMAAYGGIGWL
Ga0187820_123978113300017924Freshwater SedimentMSEHGDDAVTRARKQAAAQGRAQGLEVGWTVFSYLLAGMAAYGGIGWLI
Ga0187809_1012469023300017937Freshwater SedimentMTDHGTGADTPAARARKQAAAQGRAQGLETGWTVFSYLLAGM
Ga0187809_1037507623300017937Freshwater SedimentMTDHGSGADTPAARAQKQAAAQGRAAGLETGWTVFSYLLAGMAAYG
Ga0187808_1006310733300017942Freshwater SedimentMTDHGNEAVARARKQAAAQGRAQGLETGWTVFSYLLAGM
Ga0187778_1096120813300017961Tropical PeatlandMSDHGDDAVTRARKQAAAQGRAQGLEVGWIVFSYLLAGMAAYGGIGWL
Ga0187783_1041779123300017970Tropical PeatlandMSDPGSEAVTRARKQAAARGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRAVHV
Ga0187781_1141403223300017972Tropical PeatlandMSDHGSETVARARKEAAARGRAQGLETGWTVFSYLLAGMAAYGIIGDLIGRAV
Ga0187815_1009375613300018001Freshwater SedimentVTDHGTGADTPAARAQKQAAAQGRAQGLETGWTVFSYLL
Ga0187804_1036383713300018006Freshwater SedimentMGDHGNEAVSRARKQAAAQGRAEGLETGWTVFSYL
Ga0187805_1038437713300018007Freshwater SedimentMTDYGTGADTPAARAQKQAAAQGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRAVHVPLLFPL
Ga0187766_1132375723300018058Tropical PeatlandMSSNGTSASRQGAKRKTAAQGRAQGLDVGWTVFGYLISGML
Ga0187770_1176042613300018090Tropical PeatlandMSDHGSEAVTRARKQAAARGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGR
Ga0206352_1054038813300020078Corn, Switchgrass And Miscanthus RhizosphereMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAG
Ga0179590_115618323300020140Vadose Zone SoilMSSGNDASTQAQKRAAAEGRAQGLDIGWTVFSYLLAGMAAYGAIGWLIGRAVHVSL
Ga0210407_1055496013300020579SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRAVHVPLL
Ga0210403_1147232513300020580SoilMSDHGDDAVTRAREKERKQAAARGRAQGLEVGWTVFSYLLAGMAAYGGIGWLIGR
Ga0210399_1024325713300020581SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVFSYLLAGMA
Ga0210399_1143393323300020581SoilMSDHGDDAVTRARKQAAARGRAQGLEVGWTVFSYLLAGMA
Ga0210395_1034783833300020582SoilMSDHGNAAATRVDDALKQAEAQGRAQGLGIGWTVFSYLLAGM
Ga0210396_1118939613300021180SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVFSYLLAGMAAYGGIGW
Ga0210388_1089673913300021181SoilMSSVGKQAVPQVDRRAAAAQGRAQGMDVGWTVFGYLIAGMLAYGGIGWLIGR
Ga0179583_111581113300021286Vadose Zone SoilMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLA
Ga0179958_118984113300021315Vadose Zone SoilMSSGNDATTQAQKRAAAEGRAQGLDIGWTVFSYLLAGMAAYGAIGWLIG
Ga0210383_1066269823300021407SoilMSDRGNEAVTNAQQEAAAQGRAQGLETGWTVFSYLLAGMAAYGIIGWLIGRAV
Ga0210410_1060790033300021479SoilMSDHDHKAVTPAARAQQEAAAQGRAQGLETGWTVLSYLLAG
Ga0210409_1148153523300021559SoilMSDHDHKAVTPAARAQQEAAAQGRAQGLETGWTVLSYLLAGMA
Ga0213851_105219013300021860WatershedsMNDHGNEAVTRAREQAAARGRAQGLETGWTVFSYLL
Ga0242643_11058113300022500SoilMTDHGNEAVANARKQAAAEGRALGLEAGWTVTSYLL
Ga0242659_106282623300022522SoilMSDHGNAAATRVDDALKQAEAQGRAQGLGIGWTVFSYLLAGMAAYGGIGWLIGRAVHV
Ga0242660_110449813300022531SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVFSYLLAG
Ga0212123_1044293713300022557Iron-Sulfur Acid SpringMTDHGKAALTPAARAQEQAAAQGRAEGLETGWTVFSYLLAGMAAYGAVGWLIGRAVHVP
Ga0242674_107266223300022711SoilMSDHGNAAATRVDDALKQAEAQGRAQGLGIGWTVFSYLLAGMAAYGGIGW
Ga0242653_104324413300022712SoilMNDHGNEAVTRARKQAAAQGRAQGLETGWTVFSYLLAGMAAYGGI
Ga0242673_105543813300022716SoilMTDHGDEAVANARKQAAAEGRALGLEAGWTVTSYLLA
Ga0242666_117340523300022721SoilMSEHGNGTAARTAQDEAAAQGRAQGLETGWTVFSYLLAGMAAYGIIGWLIGRAV
Ga0242657_122606313300022722SoilMNDHGNEAVTRARKQAAAEGRAQGLEIGWTVFSYLLAGMA
Ga0242665_1035383313300022724SoilMTDYGNEAVTRARKEAAAQGRAQGLEIGWTVFSYLLAGMAAYGGIGW
Ga0207416_120394523300025134Iron-Sulfur Acid SpringMTDHGNEAVTRARKHAAAEGRAQGLETGWTVTSYLLAGMAAYGGIGALIGRAVHVPVLFP
Ga0207680_1126148213300025903Switchgrass RhizosphereMSSGNDASTQAQKRAAAEGRAQGLDIGWTVFSYLLAGMAAYGAIG
Ga0207643_1020249013300025908Miscanthus RhizosphereMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGMAAYGAIGWLFGRAVHVSLLFP
Ga0207684_1012619313300025910Corn, Switchgrass And Miscanthus RhizosphereMSDHGNEAVTRARKQAAAQGRAQGLEIGWTVFSYLLAGMAAYGII
Ga0207695_1024965713300025913Corn RhizosphereMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGMAAYGAIGWLIGRAVHVS
Ga0207652_1077089013300025921Corn RhizosphereMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGMAAYGAIGWLIGRAVHVSL
Ga0207708_1055355823300026075Corn, Switchgrass And Miscanthus RhizosphereMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGMAAYGAIGWLIGRAVHVSLL
Ga0257155_106457013300026481SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVSSYLLAGMAAYGGIGWLIGRAVHVP
Ga0208126_100540623300026843SoilMSSGNDASTQAQKRAAAQGRAQGLDVGWTVFSYLLAGMAAYGAIGWLIGRAVHVS
Ga0207981_102997123300027560SoilMSSGNDASTQAQKRAAAEGRAQGLDIGWTVFSYLLAGMAAYGAIGWLIGRAVHVS
Ga0209333_110242123300027676Forest SoilMSVHGNEASTRTRQDEAAAQGRAQGLEVGWTVFSYLLAGMAAYGLIG
Ga0208696_126154223300027696Peatlands SoilMSSTGKEAVTRVDRRAAAAQGRAQGLDIGWTVFSYLIAGMLAYGAIGWLIGRAVRV
Ga0209112_1007912123300027817Forest SoilMSSGNDASTQAQKRAAAQGRAQGLDIGWTVFSYLLAGM
Ga0209274_1008194913300027853SoilMSNHGNEAVTNEAVTRAQEQAAAEGRAQGLEIGWTVFSYLLAGMAAYGLIG
Ga0209274_1024938213300027853SoilMSVHGNEASTRTRQDEAAAQGRAQGLEVGWTVFSYLLAGMAAYGLIGWLV
Ga0209166_1015102423300027857Surface SoilMSDHGKAALTPAARAQEQAAAQGRAEGLETGWTVFSYLLAGMAAY
Ga0209166_1019296013300027857Surface SoilMTDYGNEAVTRARKQAAAEGRAKGLETGWTVFSYLLAGMAAYGIIGWLI
Ga0209380_1047114023300027889SoilMSVHGNGADTRAARAQDEAAAQGRAQGLEVGWTVFSYLLAGMAAYGGIGW
Ga0209415_1109331013300027905Peatlands SoilMSDHGDEAVTRAQEQAQKQAAARGRAQGLETGWTVTSYLLAGMAAY
Ga0209168_1033798833300027986Surface SoilMSDHGKAALTPAARAQEQAAAQGRAEGLETGWTVFSYLLA
Ga0307311_1010272823300028716SoilMSSGNDASTQAQKRAAAEGRAQGLDIGWTVFSYLLA
Ga0307280_1027852423300028768SoilMSSGNDASTQAQKRAAAEGRAQGLDIGWTVFSYLLAGM
Ga0307312_1025382913300028828SoilMSSGNDASTQAQKRAAAEGRAQGLDIGWTVFSYLLAG
Ga0308309_1040430113300028906SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRAVHVPLLF
Ga0308309_1086267733300028906SoilMSDYGSEATARAQKQAAAQGRAQGLETGWTVFSYLLAGMAAYGIIGWL
Ga0222748_107222223300029701SoilMSDHGNGAARTAQDEAAAQGRAQGLETGWTVLSYLLAGMAAYGGIGWLIGRAVHVPL
Ga0302184_1022319713300030490PalsaMSVHGNEASTRTAQDEAAAQGRAKGLEVGWTVFSYLLAGMAAYGLIGWFVGRAVHVALLFPL
Ga0311357_1180238013300030524PalsaMADHGNEAVTQAQTQAAAEGRALGLETGWMVFSYLLAG
Ga0210273_120512013300030525SoilMTDYGNEAVTRALKEAAAQGRAQGLEIGWTVFSYLLAGM
Ga0210277_1071518023300030528SoilMTDQGNRARAAQEEAAAQGRAQGLETGWTVFSYLLAGMAAYGAIGWLIGRA
Ga0210257_1030882413300030549SoilMSVHGNEASTRTRQDEAAAQGRAQGLEVGWTVFSYLLAGMAAYNKTNEKSKN
Ga0210251_1108776523300030624SoilMSVHGNEASTRTRQDEAAAQGRAQGLEVGWTVFSYLLVK
Ga0210259_1007930123300030625SoilMTDQGNRARAAQEEAAAQGRAQGLETGWTVFSYLLAGMA
Ga0210291_1109449723300030626SoilMSSTGDDAVTRAREQAAAQGRAQGLEIGWTVFSYLPAGMAAYGGIGWLIGRAVH
Ga0210291_1135953023300030626SoilMSDHGNGAARPAQDEAAAQGRAQGLETGWTVFSYLLAGMAAYGGIG
Ga0302317_1021646013300030677PalsaMSVHGNEASTRTRQDEAAAQGRAQGLEVGWTVFSYLLAGMAAYGLI
Ga0310039_1015810413300030706Peatlands SoilMSSTGKEAVTRVDRRAAAAQGRAQGLDIGWTVFSYLIAGMLAYGAIGWLIGRA
Ga0307482_130304613300030730Hardwood Forest SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVLSYLLAGMAAYGGIG
Ga0265459_1183785123300030741SoilMSDHGNGAVTRIARAQETARAQEQAAAQGRAEGREVGWTVFSYLLAGMAAYGGIGWLVGRAVQKNKKKIKK
Ga0265461_1121495723300030743SoilMSSVGKQAVPQVDRRAAAAQGRAQGMDVGWTVFGYLIAGMLAYGGIGWLVGRAVHVALLFPIKKKRENRE
Ga0265766_100900523300030863SoilMNDHGNEAVTRAREQAAAQGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRTVH
Ga0170834_11223893423300031057Forest SoilMSDHGNEAVTRAQKQAAAEGRAQGLETGWTVFSYLLAGM
Ga0170822_1601886423300031122Forest SoilMSSGDDARTRAAKAAEGRARAQGLDVGWTVFGSVTACW
Ga0302326_1117001723300031525PalsaMSSHGNETVTRAQQEAEGQGRAHGLETGWTVVSYLLAGMAAYGGIGWLIGRAVHVPVLF
Ga0318538_1066012323300031546SoilMSDHANEAVTRTRQQAAAQGRAQGLEVGWTVFSYLLAGMAAYG
Ga0318573_1026242923300031564SoilMSDHGDDAVTRAREKAQKQAAARGRAQGLEVGWTVFSYLLAGMAAYGGIGWLIGRAVDVPLL
Ga0318561_1048816813300031679SoilMSDHGNDAVTRARKQAAAQGRAQGLEVGWTVFSYLLAGMAAYGGIGWL
Ga0318560_1049113413300031682SoilMSDHGNDAVTRARKQAAAQGRAQGLEVGWTVFSYLLAGMAAYGDIGWLIGRAVHVPLLFPVGMLV
Ga0318496_1052100923300031713SoilMSDHGNGAVTPASRAQKQAAAQGRAEGLEVGWTVSGYLISGMLAYGII
Ga0310813_1130668613300031716SoilMSSGNDASTQAQKRAAAEGRAQGLDIGWTVFSYLL
Ga0306917_1108964723300031719SoilMTNYGDEAVARAQGAQKQAAARGRAQGLEVGWTVFSYLLAGM
Ga0307475_1040934413300031754Hardwood Forest SoilMSDHGNGAAARTAQDEAAAQGRAQGLETGWTVFSYLLAGMAAYGGIGWLIGRAVHVPLLFPI
Ga0318554_1035872113300031765SoilMGDHGNGAVTPASRAQKQAAAQGRAEGLEVGWTVSGYLISGML
Ga0318554_1065077223300031765SoilMSDHGDDAVTRARKQAQKQAAARGRAQGLEVGWTVFS
Ga0318521_1039503623300031770SoilMSDHGNDAVTRARKQAAAQGRAQGLEVGWTVFSYL
Ga0318521_1089472613300031770SoilMTNYGDEAVARAQGAQKQAAARGRAQGLEVGWTVFS
Ga0318498_1052321713300031778SoilMSDHGDDAVTRARKQAQKQAAARGRAQGLEVGWTVF
Ga0318557_1052043413300031795SoilMSDHGNGAVTPASRAQKQAAARGRAEGLDVGWTVSG
Ga0318550_1029610413300031797SoilMSDHGDDAVTRARKQAAAQGRAQGLEVGWTVFSYLLAGMAAYGGIGWLIGRAVHV
Ga0318568_1019102313300031819SoilMSDHGDDAVTRARKQAAAQGRAQGLEVGWTVFSYLLAGMAAYGG
Ga0307473_1056588713300031820Hardwood Forest SoilMSSGNDASTRAQKRAAAEGRAQGLDIGWTVFSYLLAG
Ga0306919_1090429613300031879SoilMSDHGDDAVTRARKQAAARGRAQGLEVGWTVFSYLLAGMAAY
Ga0306921_1094451123300031912SoilMTNYGDEAVARAQGAQKQAAARGRAQGLEVGWTVFSYLLAGMAAYGGIGWLIGRAV
Ga0308174_1045218023300031939SoilMSSGNDASTQAQKRAAAEGRAQGLDIGWTVFSYLLAGMAAYGAIGW
Ga0306926_1070994233300031954SoilMSDHANEAVTRTRQQAAAQGRAQGLEVGWTVFSYLLAGMAAYGGIGWL
Ga0318530_1047093313300031959SoilMTNYGDEAVARAQGAQKQAAARGRAQGLEVGWTVFSYLLAGMAAYGGIGWLI
Ga0307479_1157303813300031962Hardwood Forest SoilMSDHGNEAVTRAQKQAAAEGRAQGLETGWTVFSYLLAGMAAYGIIGWLLGRAVHVALLFPLG
Ga0318558_1051330113300032044SoilMSDHGDDAVTRARKQAQKQAAARGRAQGLEVGWTVFSYLLA
Ga0318577_1044859213300032091SoilMSDHGNGAVTPASRAQKQAAARGRAEGLDVGWTVSGYLI
Ga0311301_1280182523300032160Peatlands SoilMSDHGNEAATRAQEQAAAQGRAQGLETGWTVFSYLLAGM
Ga0335072_1071560313300032898SoilMSSQNSSRRGKAGDMSDLGHEAVTRAQDQAQKQAAAEGRAQGLEIGWTVVSYLLAGMAAYGGIGWLVGRAVHVPMLF
Ga0335073_1102452123300033134SoilMSSGNDASTQAQKRAAAEGRAQGLDIGWTVFSYLLAGMAAYG
Ga0318519_1046446223300033290SoilMSDHGDDAVTRARKQAAAQGRAQGLEVGWTVFSYL
Ga0334854_106150_487_6723300033829SoilMSVHGNEASTRTRQDEAAAQGRAQGLEVGWTVFSYLLAGMAAYGLIGWLVGRAVHVALLFPL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.