NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036840

Metagenome / Metatranscriptome Family F036840

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036840
Family Type Metagenome / Metatranscriptome
Number of Sequences 169
Average Sequence Length 40 residues
Representative Sequence MRRNSRLTAIAGFAVAVILLAAGGLLLWGSTYVHNTV
Number of Associated Samples 134
Number of Associated Scaffolds 169

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.22 %
% of genes near scaffold ends (potentially truncated) 98.22 %
% of genes from short scaffolds (< 2000 bps) 91.12 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.006 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(27.811 % of family members)
Environment Ontology (ENVO) Unclassified
(26.627 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.746 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.85%    β-sheet: 0.00%    Coil/Unstructured: 46.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 169 Family Scaffolds
PF04972BON 16.57
PF00044Gp_dh_N 15.98
PF02800Gp_dh_C 7.10
PF14691Fer4_20 4.14
PF00571CBS 3.55
PF12900Pyridox_ox_2 2.96
PF13560HTH_31 1.78
PF00561Abhydrolase_1 1.78
PF01740STAS 1.18
PF00582Usp 0.59
PF04055Radical_SAM 0.59
PF00440TetR_N 0.59
PF00027cNMP_binding 0.59
PF08940DUF1918 0.59
PF01558POR 0.59
PF00406ADK 0.59
PF06013WXG100 0.59
PF13450NAD_binding_8 0.59
PF13683rve_3 0.59
PF08240ADH_N 0.59
PF09206ArabFuran-catal 0.59
PF13185GAF_2 0.59
PF00300His_Phos_1 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 169 Family Scaffolds
COG0057Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenaseCarbohydrate transport and metabolism [G] 23.08
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 0.59
COG1014Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunitEnergy production and conversion [C] 0.59
COG4842Secreted virulence factor YukE/EsxA, WXG100 familyDefense mechanisms [V] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.01 %
UnclassifiedrootN/A28.99 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZTSFBX01CI2T8All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii509Open in IMG/M
3300003505|JGIcombinedJ51221_10384177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales570Open in IMG/M
3300004082|Ga0062384_100571022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300004472|Ga0068974_1058858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia843Open in IMG/M
3300005329|Ga0070683_100185373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1975Open in IMG/M
3300005332|Ga0066388_107811653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300005434|Ga0070709_11731349Not Available511Open in IMG/M
3300005436|Ga0070713_101472683Not Available660Open in IMG/M
3300005436|Ga0070713_102485001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300005549|Ga0070704_100126142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1975Open in IMG/M
3300005614|Ga0068856_100331019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1540Open in IMG/M
3300005712|Ga0070764_10459656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300005712|Ga0070764_10532513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales710Open in IMG/M
3300006175|Ga0070712_100407247Not Available1124Open in IMG/M
3300006175|Ga0070712_100679621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia876Open in IMG/M
3300006175|Ga0070712_101110478All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300006176|Ga0070765_101074323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300006572|Ga0074051_11646746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia680Open in IMG/M
3300006755|Ga0079222_11351634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales655Open in IMG/M
3300009520|Ga0116214_1232296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300009698|Ga0116216_10670193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii624Open in IMG/M
3300009824|Ga0116219_10136154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1425Open in IMG/M
3300010361|Ga0126378_12300872Not Available615Open in IMG/M
3300010371|Ga0134125_13051063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii507Open in IMG/M
3300010379|Ga0136449_102469221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia747Open in IMG/M
3300010379|Ga0136449_102755708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium696Open in IMG/M
3300010379|Ga0136449_103300117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300010396|Ga0134126_12469098Not Available565Open in IMG/M
3300010400|Ga0134122_10874170Not Available867Open in IMG/M
3300010876|Ga0126361_10386995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2763Open in IMG/M
3300011024|Ga0138530_105957All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300011079|Ga0138569_1093703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii826Open in IMG/M
3300011084|Ga0138562_1032803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii583Open in IMG/M
3300012351|Ga0137386_10165258Not Available1586Open in IMG/M
3300012507|Ga0157342_1054579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii571Open in IMG/M
3300014169|Ga0181531_11101315Not Available500Open in IMG/M
3300014201|Ga0181537_10292291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1119Open in IMG/M
3300014493|Ga0182016_10380646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria840Open in IMG/M
3300014654|Ga0181525_10380877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300016294|Ga0182041_12031519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii535Open in IMG/M
3300016341|Ga0182035_10217453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1523Open in IMG/M
3300016387|Ga0182040_11965787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii502Open in IMG/M
3300016404|Ga0182037_11232676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium658Open in IMG/M
3300017924|Ga0187820_1020341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1665Open in IMG/M
3300017924|Ga0187820_1035285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1311Open in IMG/M
3300017924|Ga0187820_1136363Not Available730Open in IMG/M
3300017926|Ga0187807_1031835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1633Open in IMG/M
3300017926|Ga0187807_1092026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium951Open in IMG/M
3300017933|Ga0187801_10023795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2104Open in IMG/M
3300017937|Ga0187809_10096137Not Available989Open in IMG/M
3300017937|Ga0187809_10350095Not Available554Open in IMG/M
3300017942|Ga0187808_10259735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium778Open in IMG/M
3300017961|Ga0187778_11329433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300017972|Ga0187781_10083487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2208Open in IMG/M
3300017972|Ga0187781_10946983Not Available628Open in IMG/M
3300017973|Ga0187780_10044957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3078Open in IMG/M
3300017973|Ga0187780_10162900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1549Open in IMG/M
3300017973|Ga0187780_10217436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1334Open in IMG/M
3300017975|Ga0187782_10093257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2212Open in IMG/M
3300018007|Ga0187805_10193748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium928Open in IMG/M
3300018037|Ga0187883_10342777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300018058|Ga0187766_10860328Not Available637Open in IMG/M
3300018058|Ga0187766_11068264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii578Open in IMG/M
3300018058|Ga0187766_11128878Not Available564Open in IMG/M
3300018062|Ga0187784_10099576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2365Open in IMG/M
3300018085|Ga0187772_10079806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2071Open in IMG/M
3300018086|Ga0187769_11234744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii565Open in IMG/M
3300018086|Ga0187769_11307959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300018090|Ga0187770_10448486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1017Open in IMG/M
3300020582|Ga0210395_11067734Not Available597Open in IMG/M
3300020583|Ga0210401_10453796All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300021088|Ga0210404_10087944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1544Open in IMG/M
3300021401|Ga0210393_11667481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii505Open in IMG/M
3300021402|Ga0210385_10430126Not Available994Open in IMG/M
3300021403|Ga0210397_10904145Not Available683Open in IMG/M
3300021407|Ga0210383_11436673Not Available573Open in IMG/M
3300021474|Ga0210390_11328230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii575Open in IMG/M
3300021479|Ga0210410_10592137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria985Open in IMG/M
3300021479|Ga0210410_11825269Not Available502Open in IMG/M
3300021559|Ga0210409_10581681Not Available987Open in IMG/M
3300022720|Ga0242672_1047216Not Available713Open in IMG/M
3300022873|Ga0224550_1029465Not Available779Open in IMG/M
3300022873|Ga0224550_1066172Not Available520Open in IMG/M
3300025627|Ga0208220_1027605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1779Open in IMG/M
3300025898|Ga0207692_10257361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1048Open in IMG/M
3300025911|Ga0207654_10161904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1446Open in IMG/M
3300025911|Ga0207654_11107597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300025915|Ga0207693_10981528Not Available646Open in IMG/M
3300025929|Ga0207664_10006809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7898Open in IMG/M
3300025939|Ga0207665_10340787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1130Open in IMG/M
3300026118|Ga0207675_100187694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1982Open in IMG/M
3300026118|Ga0207675_100917487Not Available892Open in IMG/M
3300026118|Ga0207675_100926405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium888Open in IMG/M
3300026999|Ga0207949_1001601All Organisms → cellular organisms → Bacteria1887Open in IMG/M
3300027567|Ga0209115_1143977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii535Open in IMG/M
3300027590|Ga0209116_1015583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii1542Open in IMG/M
3300027895|Ga0209624_10995247Not Available543Open in IMG/M
3300028775|Ga0302231_10347979Not Available623Open in IMG/M
3300028781|Ga0302223_10057769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1309Open in IMG/M
3300028789|Ga0302232_10081168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1675Open in IMG/M
3300028906|Ga0308309_10179022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1730Open in IMG/M
3300028906|Ga0308309_10478824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1074Open in IMG/M
3300029951|Ga0311371_10217639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2806Open in IMG/M
3300030503|Ga0311370_12123456Not Available555Open in IMG/M
3300030509|Ga0302183_10404933Not Available522Open in IMG/M
3300030580|Ga0311355_10235408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1887Open in IMG/M
3300030677|Ga0302317_10076475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii1630Open in IMG/M
3300030706|Ga0310039_10041391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2077Open in IMG/M
3300030737|Ga0302310_10606464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii577Open in IMG/M
3300031231|Ga0170824_122179462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii542Open in IMG/M
3300031525|Ga0302326_10244264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2935Open in IMG/M
3300031525|Ga0302326_13097185Not Available564Open in IMG/M
3300031544|Ga0318534_10091721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1734Open in IMG/M
3300031544|Ga0318534_10477791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii713Open in IMG/M
3300031544|Ga0318534_10600209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300031544|Ga0318534_10866956Not Available506Open in IMG/M
3300031549|Ga0318571_10173401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii758Open in IMG/M
3300031573|Ga0310915_10419932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium950Open in IMG/M
3300031668|Ga0318542_10257689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii888Open in IMG/M
3300031668|Ga0318542_10772446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii503Open in IMG/M
3300031680|Ga0318574_10779003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii560Open in IMG/M
3300031681|Ga0318572_10278603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii986Open in IMG/M
3300031682|Ga0318560_10020374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3025Open in IMG/M
3300031708|Ga0310686_101072537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1291Open in IMG/M
3300031708|Ga0310686_110705661Not Available989Open in IMG/M
3300031718|Ga0307474_11425768Not Available546Open in IMG/M
3300031723|Ga0318493_10794521Not Available533Open in IMG/M
3300031724|Ga0318500_10114725All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300031736|Ga0318501_10303970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium852Open in IMG/M
3300031771|Ga0318546_10272304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1168Open in IMG/M
3300031771|Ga0318546_10392756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium968Open in IMG/M
3300031778|Ga0318498_10045174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1945Open in IMG/M
3300031779|Ga0318566_10042012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2148Open in IMG/M
3300031782|Ga0318552_10139924All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300031782|Ga0318552_10553794Not Available587Open in IMG/M
3300031796|Ga0318576_10502610Not Available572Open in IMG/M
3300031798|Ga0318523_10093850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1466Open in IMG/M
3300031805|Ga0318497_10251750Not Available980Open in IMG/M
3300031831|Ga0318564_10067707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1570Open in IMG/M
3300031831|Ga0318564_10359991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii638Open in IMG/M
3300031879|Ga0306919_11177817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300031890|Ga0306925_10863611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium934Open in IMG/M
3300031890|Ga0306925_11070175Not Available817Open in IMG/M
3300031896|Ga0318551_10113701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1452Open in IMG/M
3300031896|Ga0318551_10765012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300031910|Ga0306923_11426908Not Available728Open in IMG/M
3300031912|Ga0306921_12542679Not Available530Open in IMG/M
3300031941|Ga0310912_11228739Not Available570Open in IMG/M
3300031942|Ga0310916_10235601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1540Open in IMG/M
3300031945|Ga0310913_10819947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300032010|Ga0318569_10614445Not Available506Open in IMG/M
3300032039|Ga0318559_10219963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium875Open in IMG/M
3300032041|Ga0318549_10370241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii646Open in IMG/M
3300032052|Ga0318506_10447434Not Available573Open in IMG/M
3300032089|Ga0318525_10305715Not Available817Open in IMG/M
3300032160|Ga0311301_10681654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1451Open in IMG/M
3300032205|Ga0307472_101283498Not Available704Open in IMG/M
3300032261|Ga0306920_100797775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1386Open in IMG/M
3300032770|Ga0335085_12514826Not Available510Open in IMG/M
3300032783|Ga0335079_11743843Not Available607Open in IMG/M
3300032805|Ga0335078_10567305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1440Open in IMG/M
3300032805|Ga0335078_11639612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii709Open in IMG/M
3300032893|Ga0335069_10116881All Organisms → cellular organisms → Bacteria → Terrabacteria group3346Open in IMG/M
3300032895|Ga0335074_10007701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia14941Open in IMG/M
3300032896|Ga0335075_10688848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii986Open in IMG/M
3300032954|Ga0335083_10272513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1501Open in IMG/M
3300032954|Ga0335083_10274770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1493Open in IMG/M
3300033134|Ga0335073_11808441Not Available570Open in IMG/M
3300034163|Ga0370515_0067071Not Available1564Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil27.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland8.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.10%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.51%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.96%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.18%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.18%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.18%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.18%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.59%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.59%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.59%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.59%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.59%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.59%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.59%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.59%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.59%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004472Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011024Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 8 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011079Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011084Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026999Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_070650102170459024Grass SoilMRRNSHLTAIAGFALAAILLAAGGLLLWGSTYTHNMVHN
JGIcombinedJ51221_1038417713300003505Forest SoilMRRNSSHLTVIAGFAVAVILLVAGGLLTWGSAYVHNTVQGQLSAQ
Ga0062384_10057102223300004082Bog Forest SoilMRRNSRSIFSLAATAVAVILLAAGGLLVWGSAYVHNTVQNQ
Ga0068974_105885813300004472Peatlands SoilMRRNSRLSVLAGFAVAVILLAAGGLLLWGSTYVHNTVQGQ
Ga0070683_10018537313300005329Corn RhizosphereMRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNMIHNQLAA
Ga0066388_10781165313300005332Tropical Forest SoilMRRNTHLATIAGFVLSAILLAAGGLLLWGSTYTHNMVHNQLA
Ga0070709_1173134913300005434Corn, Switchgrass And Miscanthus RhizosphereMRRNTHLTVIAGFVLSAILLAAGGLLLWGSTYTHNMVHNQLAAQ
Ga0070713_10147268323300005436Corn, Switchgrass And Miscanthus RhizosphereMRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNMIHNQLAAQ
Ga0070713_10248500123300005436Corn, Switchgrass And Miscanthus RhizosphereMRRNSHLTAIAGFVLAAILLAAGGMLLWGSAYVHNTVQGQLSA
Ga0070704_10012614213300005549Corn, Switchgrass And Miscanthus RhizosphereMRRNSHLTVIAGFVLSAILLAAGGLLLWGSTYTHNMVHNQLAA
Ga0068856_10033101933300005614Corn RhizosphereMRRSVTAFVGFALAGVLLVAGGLLLWGSTYSHNMVHNQLAA
Ga0070764_1045965613300005712SoilMRRNSRSISAIAATAVAGILLAAGGMLLWGSAYVHNTVQGQLA
Ga0070764_1053251313300005712SoilMRRYSSHLTAIAGLAVAVILLVAGGLLTWGSAYVHNTVQ
Ga0070712_10040724713300006175Corn, Switchgrass And Miscanthus RhizosphereMRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNMI
Ga0070712_10067962123300006175Corn, Switchgrass And Miscanthus RhizosphereMRRNSHLTAIAGLALAAILLAAGGMLLWGSAYVHNTVQGQLSA
Ga0070712_10111047823300006175Corn, Switchgrass And Miscanthus RhizosphereMRRSTPLAAIVGFALAGILFVAGGLLLWGSTYSHNMVHNQL
Ga0070765_10107432323300006176SoilMRRNSSHLTVIVGFAVAAILLVAGGLLTWGSAYVHNTVQGQ
Ga0074051_1164674613300006572SoilMRRNSHLTVIAGFVMAAILFVAGGLLLWGSTYTHNMVHN
Ga0079222_1135163433300006755Agricultural SoilMRRNSHLTAIAGFVLAAILLAAGGLLLWGSTYTHNMVHNQLA
Ga0116214_123229613300009520Peatlands SoilMRRNSRLSVLAGFAVAVILLAAGGLLLWGSTYVHNTV
Ga0116216_1067019323300009698Peatlands SoilMRRNSRFTLAIAGFAAAVLLAVAGGLLLWGSTYVHNTVQ
Ga0116219_1013615423300009824Peatlands SoilMGGITMRRNSRLSVLAGFAVAVILLAAGGLLLWGS
Ga0126378_1230087223300010361Tropical Forest SoilMRRNSHLAAIMGFALSAVLLVSGGLLLWGSTYTHNMVHNQLA
Ga0134125_1305106313300010371Terrestrial SoilMRRNSHLTAVAGFALAAILLAAGGMLLWGSAYVHNTVQGQLSA
Ga0136449_10246922123300010379Peatlands SoilMRRNYRLTAIAGFAVAVILLAAGGLLLWGSTYVHN
Ga0136449_10275570813300010379Peatlands SoilMRRNSHFTLAIAGFAVAVLLAVAGGLLLWGSTYVHNTVTN
Ga0136449_10330011723300010379Peatlands SoilMRRNSHFTLAIAGFAVAVLLAVAGGLLLWGSTYVH
Ga0134126_1246909823300010396Terrestrial SoilMRRNSHLTAIAGLALAAILLAAGGMLLWGSAYVHNTVQGQLS
Ga0134122_1087417013300010400Terrestrial SoilMRRNSPLTAIAGFALAAILLAAGGLLLWGSTYTHNMVHNQLAAQ
Ga0126361_1038699543300010876Boreal Forest SoilMRRNSHFTLAIAGFATAVLLAVAGGLLLWGSAYVHNSVTNQLVA
Ga0138530_10595743300011024Peatlands SoilMRRNSRLTAIAGFAVAVILLAAGGLLLWGSTYVHNTV*
Ga0138569_109370313300011079Peatlands SoilMRRNYRLTAIAGFAVAVILLAAGGLLLWGSTYVHNTVQGQLASQ*
Ga0138562_103280323300011084Peatlands SoilMRRNSRLTAIVGFAAAAILLVAGGLLLWGSAYVHNTVQGQLSA
Ga0137386_1016525823300012351Vadose Zone SoilMRRNSHLTAIAGFVMAAILLAAGGLLLWGSTYTHNMVHNQLAAQ
Ga0157342_105457923300012507Arabidopsis RhizosphereMRRNSHLAVIAGFVMSAILLAAGGLLLWGSTYTHN
Ga0181531_1110131513300014169BogMRRYSSHLTVIAGLAVAVLLLAAGGLLTWGSAYVHNTVQGQ
Ga0181537_1029229113300014201BogMRRYSSHLTVIAGFAVAVILLAAGGLLTWGSAYVHNTVQGQ
Ga0182016_1038064623300014493BogMRRNSRLTVIAGFAVAVILLVAGGLLTWGSAYVHN
Ga0181525_1038087723300014654BogMRRSSSRFIAGFVAGAFLLVAGGLLTWGSAYVHNTV
Ga0182041_1203151913300016294SoilMRRNRLVAFAGIALSAILLACGGLLLWGSTYVHNTVQNQLAAQQI
Ga0182035_1021745333300016341SoilMRRNSHFVLTIAGFASAVLLAVAGGLLLWGSAYVHNT
Ga0182040_1196578713300016387SoilMRRNSHLTLTIAGFAAAVLLAVAGGLLLWGSAYVHNTVTNQ
Ga0182037_1123267623300016404SoilMTMRRNSRFTLAVAGFAAAVLLAVTGGMLLWGSAYVHNTVQNQLAAQQI
Ga0187820_102034113300017924Freshwater SedimentMRRNSRFTLAIAGFAAAVLLAVAGGLLLWGSTYVHNTVQNQ
Ga0187820_103528513300017924Freshwater SedimentMRRNSHFTLAIAGFAAAVLLAVAGGLLLWGSAYVHNTVQN
Ga0187820_113636323300017924Freshwater SedimentMRRNSHFTAAIAGFAVAAVLLVAGGLLLWGSTYVHNTVT
Ga0187807_103183533300017926Freshwater SedimentMRRNSHFTLAIAGFVAAVLLAAAGGLLLWGSTYVHNTVTNQLSA
Ga0187807_109202623300017926Freshwater SedimentMRRNSHFTAAIAGFAVAAVLLVAGGLLLWGSTYVHNTVTSQLAAQQ
Ga0187801_1002379533300017933Freshwater SedimentMRRNSRFTLAIAGFAAAVLLAVAGGLLLWGSAYVHNT
Ga0187809_1009613723300017937Freshwater SedimentMRRNSHFVLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVT
Ga0187809_1035009523300017937Freshwater SedimentMRRNSHFTAAIAGFAVAAVLLVAGGLLLWGSTYVHN
Ga0187808_1025973513300017942Freshwater SedimentMRRNSHFPLAIAGFAAAVLLAVAGGLLLWGSTYVHNT
Ga0187778_1132943323300017961Tropical PeatlandMRRNSHFTAAVAGFAVAAVLLVAGGLLLWGSTYVHNTVTNQLAA
Ga0187781_1008348743300017972Tropical PeatlandMRRNSHLVLVIAGFAAAVLLAVAGGLLLWGSTYVH
Ga0187781_1094698313300017972Tropical PeatlandMRRNSHLTLALAGLAAAVLLAVAGGLLLWGSAYVHNT
Ga0187780_1004495743300017973Tropical PeatlandMRRNSHFTAAVAGFAVAAVLLVAGGLLLWGSTYVHN
Ga0187780_1016290033300017973Tropical PeatlandMRRKSHFVLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQNQLAAQ
Ga0187780_1021743633300017973Tropical PeatlandMRRNSHFVLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQNQLAAQ
Ga0187782_1009325743300017975Tropical PeatlandMRRNSHLVLVIAGFAAAVLLAVAGGLLLWGSTYVHN
Ga0187805_1019374823300018007Freshwater SedimentMRRNSHFTLAIAGFAAAVLLAVAGGLLLWGSTYVHNTVQN
Ga0187883_1034277723300018037PeatlandMRRNYSRLAVIGVLAVAAILLVAGGLLTWGSAYVHNTVQG
Ga0187766_1086032823300018058Tropical PeatlandMRRNSHFVLVIAGFAAAVLLAVAGGLLLWGSAYVHNTV
Ga0187766_1106826423300018058Tropical PeatlandMRRKSHFVLVIAGFAAAVLLAVAGGLLLWGSAYVHNTV
Ga0187766_1112887823300018058Tropical PeatlandMRRNSHFTLAVAGFVAAALLAVAGGLLLWGSAYVHNTV
Ga0187784_1009957643300018062Tropical PeatlandMRRNSHFTLALVGFAAAVILAVAGGLLLWGSTYVHNTVHS
Ga0187772_1007980613300018085Tropical PeatlandMRRNSHFTLALVGFAAAVILAVAGGLLLWGSTYVHNTVQS
Ga0187769_1123474423300018086Tropical PeatlandMRRSYSLWAVIAGFALSAVLLISGGLLLWGSAYVHNTVQNQLAAQQ
Ga0187769_1130795923300018086Tropical PeatlandMRRNSHFTLAIVGFAAAALLAVAGGLLLWGSTYVHNTVQN
Ga0187770_1044848623300018090Tropical PeatlandMRRSYSLWAVIAGFALSAVLLISGGLLLWGSAYVHNTVQNQLSEQQIY
Ga0210395_1106773413300020582SoilMRRNSHLTAIAGFALAAILLAAGGMLLWGSAYVHNT
Ga0210401_1045379613300020583SoilMRRNSHLTLAIAGFATAVLLAVAGGLLLWGSAYVHN
Ga0210404_1008794433300021088SoilMRRNSHLTAIAGFVLAAILLAAGGLLLWGSTYTHNMVH
Ga0210393_1166748113300021401SoilMRRNSHLTAIAGFALAAILLAAGGMLLWGSAYVHNTVQGQLSAQ
Ga0210385_1043012623300021402SoilMRRNSSHLTVIAGFAVTVILLVAGGLLTWGSAYVHNTV
Ga0210397_1090414513300021403SoilMRRNSHLAAIAGFALAAILFVAGGLLLWGSTYTHNMV
Ga0210383_1143667323300021407SoilMTMRRNSHFVLVIAGFAAAVLLAVAGGLLLWGSTYVHN
Ga0210390_1132823023300021474SoilMRRSSRLTAIVGFALAAVLLIAGGLLLWGSTYVHNTVQGQLTS
Ga0210410_1059213723300021479SoilMRRNSSHLTVIAGFAVAVILLVAGGLLTWGSAYVHNTVQ
Ga0210410_1182526913300021479SoilMRRNSSRLTVIAGFAVAVILLVAGGLLTWGSAYVHNTVQG
Ga0210409_1058168123300021559SoilMRRNSHLTAIAGFALAAILLAAGGMLLWGSAYVHNTVQGQLSAQQIF
Ga0242672_104721613300022720SoilQGGITMRRNSHLTLAIAGFATAVLLAVAGGLLLWGSAYVHNTVHNQLAAQKKRN
Ga0224550_102946523300022873SoilMRRNSLTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVTNQLSAQ
Ga0224550_106617213300022873SoilMRRNSRFTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVTNQLSAQQ
Ga0208220_102760533300025627Arctic Peat SoilVSHLILTQRALAAVLLIVGGLTLWGSAYVHNTVQSQ
Ga0207692_1025736133300025898Corn, Switchgrass And Miscanthus RhizosphereMRRNSHLTAIAGLVLAAILLAAGGLLLWGSAYTHNMVRNQL
Ga0207654_1016190413300025911Corn RhizosphereMRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNMIHNQLAAQQ
Ga0207654_1110759723300025911Corn RhizosphereMRRSTPLAAIAGFALAAVLFVAGGLLLWGSTYSHNMVHNQ
Ga0207693_1098152813300025915Corn, Switchgrass And Miscanthus RhizosphereMRRSTPLAAIVGFALAGILFVAGGLLLWGSTYSHNMVHNQ
Ga0207664_1000680913300025929Agricultural SoilMRRSVTAIVGFALAAVLLVAGGLLLWGSTYSHNMVHNQLA
Ga0207665_1034078713300025939Corn, Switchgrass And Miscanthus RhizosphereMRRNSHVTVIAGFVLSAILLAAGGLLLWGSTYTHNMIHNQLA
Ga0207675_10018769413300026118Switchgrass RhizosphereMRRNSPLTAIAGFALAAILLAAGGLLLWGSTYTHNMVHN
Ga0207675_10091748713300026118Switchgrass RhizosphereMRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNM
Ga0207675_10092640523300026118Switchgrass RhizosphereMRRNSHLTVIAGFVLAAVLLAAGGLLLWGSTYTHNMVHNQLAAQ
Ga0207949_100160113300026999Forest SoilMRRNSHLTAIAGFALAAILLAAGGMLLWGSAYVHNTVQG
Ga0209115_114397713300027567Forest SoilMRRTSTRSIIATVTTGVAVILLAAGGLLMWGSAYVHNTVQG
Ga0209116_101558323300027590Forest SoilMRRYSSHLTVIAGFAVAVILLAAGGLLTWGSAYVHNTVQG
Ga0209624_1099524713300027895Forest SoilMRRYSSHLTIIAGFAVAVILLAAGGLLTWGSAYVHNTVQGQLSAQQIF
Ga0302231_1034797913300028775PalsaMRRYSSHLTAIAGLAVAVILLAAGGLLTWGSAYVHNT
Ga0302223_1005776923300028781PalsaMRRNSSHLTAIVGLAVAVILLAAGGLLTWGSAYVH
Ga0302232_1008116833300028789PalsaMRRNSLTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVTNQLS
Ga0308309_1017902223300028906SoilMRRNSSHLTVIAGFAVAVILLVAGGLLTWGSAYVHNT
Ga0308309_1047882423300028906SoilMRRNSSHLTVIVGFAVAVILLVAGGLLTWGSAYVHNTVQGQLSAQ
Ga0311371_1021763943300029951PalsaMRRNSLTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVTNQLSA
Ga0311370_1212345623300030503PalsaMRRYSSHLTAIAGLAVAVILLAAGGLLTWGSAYVHNTVQGQLA
Ga0302183_1040493313300030509PalsaMRRYSSHLTAIAGLAVAVILLAAGGLLTWGSAYVH
Ga0311355_1023540843300030580PalsaMRRNSRFTLTLAGFAAAVLLAVAGGLLLWGSTYVHN
Ga0302317_1007647523300030677PalsaMRRYSSHLTAIAGLAVAVILLAAGGLLTWGSAYVHNTVQ
Ga0310039_1004139133300030706Peatlands SoilMRRNSRLSVLAGFAVAVILLAAGGLLLWGSTYVHNTVQGQL
Ga0302310_1060646423300030737PalsaMRRNSRFTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVTNQL
Ga0170824_12217946213300031231Forest SoilMRRNSHLTAIAGFALAAILLAAGGLLLWGSTYTHNMVHNQL
Ga0302326_1024426413300031525PalsaMRRYSSHLTVIAGLAVAVILLAAGGLLTWGSAYVHNTVQGQLAS
Ga0302326_1309718523300031525PalsaMRRNSSHLTAIVGLAVAVILLAAGGLLTWGSAYVHN
Ga0318534_1009172133300031544SoilMRRNSHFVLTIAGFVSAVLLAVAGGLLLWGSAYVHNTVQN
Ga0318534_1047779123300031544SoilMRRSSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQN
Ga0318534_1060020923300031544SoilMRRNSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNT
Ga0318534_1086695613300031544SoilMRRNSHFKLALAGLAATVVLAVSGGLLLWGSTYVHNTVQN
Ga0318571_1017340113300031549SoilMRRNSHLAVIAGFALSAVLFVAGGLLLWGSTYTHNMVH
Ga0310915_1041993213300031573SoilMRRNSHLTLTIAGFAAAVLLAVAGGLLLWGSAYVHNTVTNQLAA
Ga0318542_1025768923300031668SoilMRRNSHLAAIVGFALSAVLLVSGGLLLWGSTYTHNMV
Ga0318542_1077244623300031668SoilMRRNSHLAAIAGFALSAILFVAGGLLLWGSTYTHNMVHNQLAAQQI
Ga0318574_1077900323300031680SoilMRRNSHFVLTIAGFVSAVLLAVAGGLLLWGSAYVHNTVQNQLA
Ga0318572_1027860313300031681SoilMRRNSHLAVIAGFALSAVLFVAGGLLLWGSTYTHN
Ga0318560_1002037413300031682SoilMRRNSHLAAIVGFALSAVLLVSGGLLLWGSTYTHN
Ga0310686_10107253713300031708SoilMRRTSVLSLVGVAVAVVLAAAGGLLMWGSAYVHNTVQGQLASQQI
Ga0310686_11070566123300031708SoilMHRNSSRITAIAGFAVAVILLVAGGLLTWGSAYVH
Ga0307474_1142576813300031718Hardwood Forest SoilMRRNSHLTAIAGFVLSAILLAAGGLLLWGSTYTHNMVHNQL
Ga0318493_1079452113300031723SoilMRRNSHFILVIAGFAAAVLLAVGGGLLLWGSAYVHNTVQNQLAAQQ
Ga0318500_1011472533300031724SoilMRRSSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQNQLAAQ
Ga0318501_1030397023300031736SoilMRRNSHFTAAVAGFAVAAVLLVAGGLMLWGSTYVHN
Ga0318546_1027230433300031771SoilMRRNSHFKLALAGLAATLTLGLAGGLMLWGSTYVHNTVTNQLAAQQIY
Ga0318546_1039275623300031771SoilMRRSSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQNQLSAQQ
Ga0318498_1004517433300031778SoilMRRNSHFTAAVAGFAVAAVLLVAGGLMLWGSTYVHNTVT
Ga0318566_1004201233300031779SoilMRRNSHFILVIAGFAAAVLLAVGGGLLLWGSAYVHNT
Ga0318552_1013992413300031782SoilMRRNSHFVLVIAGFAAAVLLAMAGGLLLWGSAYVHNTVQNQ
Ga0318552_1055379423300031782SoilMRRNSHFKLALAGLAATVTLAVSGGLLLWGSTYVHNTVKDQLAARLGVRERG
Ga0318576_1050261013300031796SoilMRRNSHFKLALAGLAATVTLAVSGGLLLWGSTYVHNTVKDQIEKR
Ga0318523_1009385023300031798SoilMRRNSHFKLALAGLAATVTLAVSGGLLLWGSTYAHNTVKDQ
Ga0318497_1025175023300031805SoilMRRNSRIFAYAGFALSAILLVSGGLLLWGSAYVHNTVQSQLAAQ
Ga0318564_1006770723300031831SoilMRRNSHLTLTIAGFAAAVLLAVAGGLLLWGSAYVPSTPGSSC
Ga0318564_1035999123300031831SoilMRRNHLAALAGFALSAILLVSGGLLLWGSAYVHNTVQSQ
Ga0306919_1117781723300031879SoilMRRNSHFTAAVAGFAVAAVLLVAGGLMLWGSTYVHNTVTNQ
Ga0306925_1086361113300031890SoilMRRSSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQNQLAAQQ
Ga0306925_1107017523300031890SoilMRRNSHLAVIVGFVLSAFLFVAGGLLLWGSTYTHNMVHNQL
Ga0318551_1011370133300031896SoilMRRNSHFTAAVAGFAVAAVLLVAGGLMLWGSTYVHNT
Ga0318551_1076501213300031896SoilMRRNSHLAAIAGFALSAILFVAGGLLLWGSTYTHN
Ga0306923_1142690823300031910SoilMRRNSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHNTVQ
Ga0306921_1254267923300031912SoilMRRNSHLAVIAGFALSAILFVAGGLLLWGSTYTHNMVHNQL
Ga0310912_1122873923300031941SoilMRRNSHLAVIVGFVLSAFLFVAGGLLLWGSTYTHNMVHNQ
Ga0310916_1023560113300031942SoilMRRNSHFKLALAGLAAALTLGLAGGLMLWGSTYVHNTVT
Ga0310913_1081994713300031945SoilMRRNSHLAAIAGFALSAILFVAGGLLLWGSTYTHNMV
Ga0318569_1061444513300032010SoilMRRSSHLTLVIAGFAAAVLLAVAGGLLLWGSAYVHN
Ga0318559_1021996323300032039SoilMRRNTHLAAIVGFALSAVLLVSGGLLLWGSTYIHNT
Ga0318549_1037024123300032041SoilMRRNSHLAAIAGFALSAILFVAGGLLLWGSTYTHNMVHNQLAAQQ
Ga0318506_1044743413300032052SoilMRRNSHFKLALAGLAATVTLAVSGGLLLWGSTYVH
Ga0318525_1030571523300032089SoilMRRNSRFAALAGFALAAILLAAGGLLLWGSTYVHN
Ga0311301_1068165423300032160Peatlands SoilMRRNSRLSVLAGFAVAVILLAAGGLLLWGSTYVHNTVQ
Ga0307472_10128349813300032205Hardwood Forest SoilMRRNSHLAAIAGFALAAILLAAGGLLLWGSTYTHNM
Ga0306920_10079777513300032261SoilMRRNSHLAAIAGFALSAILFVAGGLLLWGSTYTHNMVHDQ
Ga0335085_1251482613300032770SoilMRRSTPLAAIAGFALAAVLFVAGGLLLWGSTYSHNMVHN
Ga0335079_1174384313300032783SoilMRRNSRLFAYAGFALSAILLVAGGLLLWGSTYVHNTV
Ga0335078_1056730513300032805SoilMRRNSHLAAIIGFALSAVLFVAGGLLLWGSTYTHNMVHNQ
Ga0335078_1163961223300032805SoilMRRNSRLFAYAGFALSAILLIAGGLLLWGSAYVHNTVQG
Ga0335069_1011688113300032893SoilMRRNSRLFAIAGFTLSAVLLIAGGLLLWGSAYVHNTVQS
Ga0335074_1000770113300032895SoilMRRTPRFYVSLASAALAVLLLAAGGLLLWGSAYVHNTV
Ga0335075_1068884813300032896SoilMRRSSSLTAIAGFALAAILFVAGGLLLWGSTYVHNEV
Ga0335083_1027251333300032954SoilMRRSTPLAAIAGFALAAVLFVAGGLLLWGSTYSHNMVHNQL
Ga0335083_1027477043300032954SoilMRRNSHLAVIVGFALSAVLLVAGGLLLWGSTYTHNMVHNQLAAQQ
Ga0335073_1180844113300033134SoilMRRNSRFTLAIAGFAAAVLLAVAGGLLIWGSAYVHNT
Ga0370515_0067071_1449_15623300034163Untreated Peat SoilMRRNSLTLTLAGFAAAVLLAVAGGLLLWGSTYVHNTVT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.