NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036727

Metagenome / Metatranscriptome Family F036727

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036727
Family Type Metagenome / Metatranscriptome
Number of Sequences 169
Average Sequence Length 68 residues
Representative Sequence MEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNKGRSVSDLDVKDWSFGHPRNLRSDSTW
Number of Associated Samples 150
Number of Associated Scaffolds 169

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 23.21 %
% of genes near scaffold ends (potentially truncated) 46.15 %
% of genes from short scaffolds (< 2000 bps) 99.41 %
Associated GOLD sequencing projects 147
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.633 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(12.426 % of family members)
Environment Ontology (ENVO) Unclassified
(39.053 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(55.030 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.37%    β-sheet: 0.00%    Coil/Unstructured: 52.63%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 169 Family Scaffolds
PF00013KH_1 0.59
PF03631Virul_fac_BrkB 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 169 Family Scaffolds
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.41 %
UnclassifiedrootN/A0.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000949|BBAY94_10056680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1087Open in IMG/M
3300001263|BBAY83_10097397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea950Open in IMG/M
3300001355|JGI20158J14315_10093797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1053Open in IMG/M
3300002835|B570J40625_100555439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1063Open in IMG/M
3300003910|JGI26437J51864_10062684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea801Open in IMG/M
3300004092|Ga0062389_104391071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella530Open in IMG/M
3300004684|Ga0065168_1051782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea645Open in IMG/M
3300004685|Ga0065177_1066451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea672Open in IMG/M
3300004767|Ga0007750_1387318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea797Open in IMG/M
3300004772|Ga0007791_10134713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea729Open in IMG/M
3300004789|Ga0007752_10889153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella693Open in IMG/M
3300006029|Ga0075466_1066435All Organisms → Viruses → Predicted Viral1029Open in IMG/M
3300006357|Ga0075502_1568109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea671Open in IMG/M
3300006399|Ga0075495_1186544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea696Open in IMG/M
3300006401|Ga0075506_1759270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea718Open in IMG/M
3300006641|Ga0075471_10410877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea678Open in IMG/M
3300006803|Ga0075467_10733433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300007513|Ga0105019_1176230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1084Open in IMG/M
3300007543|Ga0102853_1094572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella558Open in IMG/M
3300007718|Ga0102852_1112994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella543Open in IMG/M
3300007725|Ga0102951_1067344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1034Open in IMG/M
3300007860|Ga0105735_1098767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella616Open in IMG/M
3300007864|Ga0105749_1134949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea570Open in IMG/M
3300007864|Ga0105749_1152008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila544Open in IMG/M
3300008012|Ga0075480_10553388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella549Open in IMG/M
3300008106|Ga0114339_1210725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila637Open in IMG/M
3300008931|Ga0103734_1010465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1250Open in IMG/M
3300008993|Ga0104258_1064032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella686Open in IMG/M
3300009002|Ga0102810_1248674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani548Open in IMG/M
3300009003|Ga0102813_1219895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300009003|Ga0102813_1288560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300009080|Ga0102815_10382712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea781Open in IMG/M
3300009180|Ga0114979_10345758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella877Open in IMG/M
3300009193|Ga0115551_1266935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella754Open in IMG/M
3300009263|Ga0103872_1039690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella660Open in IMG/M
3300009436|Ga0115008_10313680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1113Open in IMG/M
3300009466|Ga0126448_1042276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1059Open in IMG/M
3300009470|Ga0126447_1049869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1035Open in IMG/M
3300009496|Ga0115570_10279941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella728Open in IMG/M
3300009599|Ga0115103_1301298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila557Open in IMG/M
3300009599|Ga0115103_1679495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea926Open in IMG/M
3300009677|Ga0115104_10392972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila523Open in IMG/M
3300009785|Ga0115001_10531866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila723Open in IMG/M
3300010354|Ga0129333_10527697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1032Open in IMG/M
3300010388|Ga0136551_1039026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea880Open in IMG/M
3300010981|Ga0138316_10481959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella626Open in IMG/M
3300010987|Ga0138324_10403635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea668Open in IMG/M
3300012413|Ga0138258_1719031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani716Open in IMG/M
3300012415|Ga0138263_1782294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300012416|Ga0138259_1618409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella592Open in IMG/M
3300012518|Ga0129349_1027195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300012952|Ga0163180_11149430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea631Open in IMG/M
3300012953|Ga0163179_10374015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1149Open in IMG/M
3300013087|Ga0163212_1169514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella687Open in IMG/M
3300014493|Ga0182016_10273280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1047Open in IMG/M
3300016737|Ga0182047_1415843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea648Open in IMG/M
3300016748|Ga0182043_1460979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella717Open in IMG/M
3300016749|Ga0182053_1382673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea812Open in IMG/M
3300018413|Ga0181560_10423207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani610Open in IMG/M
3300018413|Ga0181560_10562570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella516Open in IMG/M
3300018421|Ga0181592_10876659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300018423|Ga0181593_11155481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300018871|Ga0192978_1079115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila603Open in IMG/M
3300018873|Ga0193553_1068660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea958Open in IMG/M
3300018928|Ga0193260_10147053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300018968|Ga0192894_10108637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani852Open in IMG/M
3300018968|Ga0192894_10253560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300018980|Ga0192961_10075062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1007Open in IMG/M
3300018982|Ga0192947_10097753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea970Open in IMG/M
3300018982|Ga0192947_10280261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella527Open in IMG/M
3300018989|Ga0193030_10237565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea599Open in IMG/M
3300019017|Ga0193569_10217936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea836Open in IMG/M
3300019017|Ga0193569_10368998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300019022|Ga0192951_10142422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea837Open in IMG/M
3300019032|Ga0192869_10204479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila841Open in IMG/M
3300019048|Ga0192981_10125200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1014Open in IMG/M
3300019108|Ga0192972_1084909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella556Open in IMG/M
3300019133|Ga0193089_1146420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani524Open in IMG/M
3300019149|Ga0188870_10058487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella940Open in IMG/M
3300019261|Ga0182097_1395261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea954Open in IMG/M
3300019280|Ga0182068_1563900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea709Open in IMG/M
3300019459|Ga0181562_10540059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300020074|Ga0194113_10452524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella931Open in IMG/M
3300020146|Ga0196977_1039461All Organisms → Viruses → Predicted Viral1134Open in IMG/M
3300020166|Ga0206128_1315262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300020175|Ga0206124_10240626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila704Open in IMG/M
3300020197|Ga0194128_10205457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1055Open in IMG/M
3300020546|Ga0208853_1026889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1063Open in IMG/M
3300020732|Ga0214201_1056507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea563Open in IMG/M
3300021128|Ga0214176_1030949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300021169|Ga0206687_1447862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea956Open in IMG/M
3300021169|Ga0206687_1559092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella618Open in IMG/M
3300021342|Ga0206691_1335612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella535Open in IMG/M
3300021342|Ga0206691_1716184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella846Open in IMG/M
3300021345|Ga0206688_10921092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300021353|Ga0206693_1818488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea534Open in IMG/M
3300021359|Ga0206689_11009085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea961Open in IMG/M
3300021359|Ga0206689_11086003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila737Open in IMG/M
3300021365|Ga0206123_10421597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300021371|Ga0213863_10161231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1014Open in IMG/M
3300021373|Ga0213865_10295263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea757Open in IMG/M
3300021927|Ga0063103_1048168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila512Open in IMG/M
3300021941|Ga0063102_1052607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila505Open in IMG/M
3300021959|Ga0222716_10455093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella730Open in IMG/M
3300023706|Ga0232123_1076368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea641Open in IMG/M
3300025626|Ga0209716_1067575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1108Open in IMG/M
3300025869|Ga0209308_10282636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea699Open in IMG/M
3300025869|Ga0209308_10398856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella549Open in IMG/M
3300025941|Ga0207711_12113052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella506Open in IMG/M
3300026448|Ga0247594_1050896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila712Open in IMG/M
3300026462|Ga0247568_1075910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila657Open in IMG/M
3300027719|Ga0209467_1200952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella695Open in IMG/M
3300027720|Ga0209617_10205779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea757Open in IMG/M
3300027805|Ga0209229_10190998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea918Open in IMG/M
3300027810|Ga0209302_10494182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300027899|Ga0209668_10324524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia993Open in IMG/M
3300028008|Ga0228674_1158736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea749Open in IMG/M
3300028102|Ga0247586_1108599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila519Open in IMG/M
3300028137|Ga0256412_1373600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila523Open in IMG/M
3300028233|Ga0256417_1126665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300028290|Ga0247572_1181676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea528Open in IMG/M
3300028575|Ga0304731_11236615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella626Open in IMG/M
3300030551|Ga0247638_1111384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella627Open in IMG/M
3300030552|Ga0247654_1166521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella545Open in IMG/M
3300030569|Ga0247628_1208214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella565Open in IMG/M
3300030574|Ga0247648_1159803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella558Open in IMG/M
3300030575|Ga0210288_1024794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1005Open in IMG/M
3300030575|Ga0210288_1048140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella858Open in IMG/M
3300030604|Ga0247637_1198455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella523Open in IMG/M
3300030607|Ga0247615_10184921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella677Open in IMG/M
3300030608|Ga0247651_10298640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella534Open in IMG/M
3300030609|Ga0247634_10453700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella551Open in IMG/M
3300030628|Ga0247629_10198473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella683Open in IMG/M
3300030699|Ga0307398_10267958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea921Open in IMG/M
3300030702|Ga0307399_10398173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea667Open in IMG/M
3300030702|Ga0307399_10402443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila664Open in IMG/M
3300030709|Ga0307400_10518293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea751Open in IMG/M
3300030715|Ga0308127_1028254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella686Open in IMG/M
3300030743|Ga0265461_11153785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella792Open in IMG/M
3300030743|Ga0265461_13625587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella524Open in IMG/M
3300030840|Ga0074020_10061410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella723Open in IMG/M
3300030959|Ga0102747_10627196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella606Open in IMG/M
3300031034|Ga0074041_11081266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella593Open in IMG/M
3300031034|Ga0074041_11602515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella620Open in IMG/M
3300031035|Ga0074026_10928474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea512Open in IMG/M
3300031231|Ga0170824_124787067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea616Open in IMG/M
3300031446|Ga0170820_14332256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella585Open in IMG/M
3300031524|Ga0302320_11611597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella631Open in IMG/M
3300031569|Ga0307489_10242313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1139Open in IMG/M
3300031710|Ga0307386_10290966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea818Open in IMG/M
3300031725|Ga0307381_10260625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea617Open in IMG/M
3300031725|Ga0307381_10408513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella502Open in IMG/M
3300031729|Ga0307391_10271084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea915Open in IMG/M
3300031729|Ga0307391_10448145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300031734|Ga0307397_10171635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea947Open in IMG/M
3300031734|Ga0307397_10633612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella501Open in IMG/M
3300031742|Ga0307395_10304321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300031758|Ga0315907_11163337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella543Open in IMG/M
3300032150|Ga0314779_1021550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella628Open in IMG/M
3300032491|Ga0314675_10473252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea622Open in IMG/M
3300032491|Ga0314675_10556362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila564Open in IMG/M
3300032520|Ga0314667_10771771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella521Open in IMG/M
3300032756|Ga0315742_12474140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella591Open in IMG/M
3300033498|Ga0316610_1084553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300033978|Ga0334977_0360722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella685Open in IMG/M
3300033980|Ga0334981_0160519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1070Open in IMG/M
3300034073|Ga0310130_0244403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella564Open in IMG/M
3300034272|Ga0335049_0851156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.43%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.24%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.51%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.92%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.33%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.73%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.55%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.37%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.37%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.78%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.78%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.78%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.78%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.78%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.78%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.78%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.18%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.18%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond1.18%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.18%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.59%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.59%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.59%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.59%
Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat0.59%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.59%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.59%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.59%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.59%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.59%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.59%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.59%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.59%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.59%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.59%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.59%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.59%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.59%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.59%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003910Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LWEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004684Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2)EnvironmentalOpen in IMG/M
3300004685Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004772Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5MEnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007543Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3EnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008106Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTREnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009470Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010388Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020546Freshwater microbial communities from Lake Mendota, WI - 03OCT2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020732Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnionEnvironmentalOpen in IMG/M
3300021128Freshwater microbial communities from Trout Bog Lake, WI - 20AUG2007 epilimnionEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300023706Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027719Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030552Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030569Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030574Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030604Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030607Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030608Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030628Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030860Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030959Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031034Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033498Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2017.111BEnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033980Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BBAY94_1005668013300000949Macroalgal SurfaceMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNQGRSVSDLEVKDWSFGHPKNLRSESTW*
BBAY83_1009739723300001263Macroalgal SurfaceMEVCPDHILEGLRENRKWYLRAEAIDNETYKRAMTVSDYNKGKSVSDLNIKSWSFGTAANLRSDSTW*
JGI20158J14315_1009379723300001355Pelagic MarineMNEKISIMEVCPDHVLEGLRERRKWSLRAESIDNETYKRAMTVGDYNKGRSVSDLTIKDWSYGSARNLRSESTW*
B570J40625_10055543923300002835FreshwaterMEVCPDHILEGLREKKKHFLRAESIDNETYKRAMTVSDFNKGRSVSDLKLKTWDYGKHLRSDSYY*
JGI26437J51864_1006268413300003910Freshwater Lake SedimentMNIMEVCPDHVLEGLREKKKWYARAEVIDNETYRRAMQVADYNRGRSVSDLKLKSWDYGDSLRSDSLY*
Ga0062389_10439107123300004092Bog Forest SoilMEICPDHILEGLREKKKWYLRAEVIDNETYKRAMIVGDYNKGKSVTDLQLKTWEHGKGGNLKSDSLWQDDRYNPTK
Ga0065168_105178213300004684FreshwaterMEVCPDHILESLREKRKWLLRAQAIDNETYKRAMTVSDYNQKRSVSDLDIKDWTAG*
Ga0065177_106645123300004685FreshwaterMEVCPDHILESLREKRKWLLRAQAIDNETYKRAMTVSDYNQKRSVRDLDIKDWTAG*
Ga0007750_138731823300004767Freshwater LakeMEVCPDHILESLREKRKWLLRAQAIDNETYKRAMTVGDYNRRKSVSDIEIKDWTAG*
Ga0007791_1013471323300004772FreshwaterMEVCPDHILESLREKRKWLLRAQAIDNETYKRAMTVSDYNQKRSVSDLEIKDWTAG*
Ga0007752_1088915323300004789Freshwater LakeMEVCPDHVLEGLREKKKWTLRAEVIDNQTYKRAMQVSDYNKGRSVSELKLKTWEFGKGENLKSDSYWQDNRYNPTVYSH
Ga0075466_106643523300006029AqueousMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDFNKGRSVADLECKDWSFGHPRNLRSDSAW*
Ga0075502_156810923300006357AqueousMEVCPDHVLEGMRERRKWWLRAEAIDNETYKRAMTVSDYNRGRSTLDLDVKDWSFGHPSDLRSDSTW*
Ga0075495_118654433300006399AqueousMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMSVGDYNQGRSVSDLDVKDWSFGHPRNLRSENTW*
Ga0075506_175927013300006401AqueousMEVCPDHVLEGMRERRKWWLRAEAIDNETYKRAMTVSDYNRGRSTLDLDVKDWSFGHPSNLRSDSTW*
Ga0075471_1041087713300006641AqueousMEVCPDHVLEALREKKKHYLRAESIDNETYKRAMTVSDFNKGRSVSDLKLKTWDYGKHL
Ga0075467_1073343313300006803AqueousIMEVCPDHVLAGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVSDLTLKSWEYGKACNLRSDSLF*
Ga0105019_117623023300007513MarineMEVCPDHVLEGLREKRKWFLRAEAIDNETYKRAMTVGSYNCGRSVRDLSIKDWSYGDVSNMRSDSTW*
Ga0102853_109457223300007543EstuarinePDHVLDALREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDYGKTANLRSDSFW*
Ga0102852_111299413300007718EstuarineNCSNEKISIMEVCPDHVLEGLRERRKWFMRAEAIDNATYKRAMSVSDYNKNRSVSDLELKDWSFGHPRNLRSDSVW*
Ga0102951_106734423300007725WaterMEVCPDHVLEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLDVKSWDYGHPKSLRSDSTW*
Ga0105735_109876713300007860Estuary WaterKDKANPEACFQEKINIMEVCPDHILEGLREKKKHFLRAESIDNETYKRAMTVSDFNKGRSVSDLKLKSWDYGKHLRSDSYY*
Ga0105749_113494913300007864Estuary WaterMEVCPDHILEALREKRKWMLRAQTIDNETYKRAMVVGDYNKGKSVSDLNIKDWSYGTAKNMRSDST
Ga0105749_115200813300007864Estuary WaterAGKDNCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSNYNAGKSVSDLNIKDWSYGHPRNLRSESTW*
Ga0075480_1055338813300008012AqueousCFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNKERSVSDLKLKTWDYGKTANLRSDSLW*
Ga0114339_121072513300008106Freshwater, PlanktonMNIMEVCPDHVLEGLREKKKWYARAEVIDNETYRRAMQVADYNRGRSVSDLKLKSWDYGDSLRSDSVY*
Ga0103734_101046553300008931Ice Edge, Mcmurdo Sound, AntarcticaQSLEAKISIMEVCPDHVLEGLREKRKWYLRAQTIDNQTYKRAMTIADYNKGRSVADLEIKDWSYGNPKNLRSDSTW*
Ga0104258_106403223300008993Ocean WaterMEVCPEHVLEGLREKRKWMLRAQAIDNETYKRAMTVSDFNKGKSVSDLHIKDWSYGHAKNLRSDSTWEDDRYDPLKYS
Ga0102810_124867413300009002EstuarineKISIMEVCPDHVLEGLRERRKWFMRAEAIDNATYKRAMSVSDYNKNRSVSDLELKDWSFGHPRNLRSDSVW*
Ga0102813_121989513300009003EstuarineDKCFNEKISIMEVCPDHVLEGLRERRKWYLRAESIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW*
Ga0102813_128856023300009003EstuarineEGMRERRKWWLRAEAIDNETYKRAMTVSDYNRGRSTLDLDVKDWSFGHPSNLRSDSTW*
Ga0102815_1038271223300009080EstuarineMEVCPDHVLEGMRERKKWWLRAEAIDNETYKRAMTVSDYNRGRSTLDLDVKDWSFGHPSNLRSDSTW*
Ga0114979_1034575823300009180Freshwater LakeMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVSDLKLKTWEFGKGANLRSDSVW*
Ga0115551_126693523300009193Pelagic MarineMEVCPDHILEALREKRKWMLRAQTIDNETYKRAMVVGDYNKGKSVSDLNIKDWSYGTAKNMRSDSTWEDDR
Ga0103872_103969013300009263Surface Ocean WaterMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMQVSDFNKNRSVSDLTLKTWEHGKAKNLRSDSLW*
Ga0115008_1031368023300009436MarineMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW*
Ga0126448_104227613300009466Meromictic PondMEVCPDHILEGLREKRKWMLRAEAIDNETYKRAMTVSDYNRGRSVSDLNIKSWEYGHPKNLRSDSTW*
Ga0126447_104986923300009470Meromictic PondMEVCPDHILEGLREKRKWMLRAEVIDNETYKRAMTVSDYNRGRSVSDLNIKSWEYGHPKNLRSDSTW*
Ga0115570_1027994123300009496Pelagic MarineMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTIGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW*
Ga0115103_130129813300009599MarineANSGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMSVGDYNQGRSVSDLDVKDWSFGHPRNLRSENTW*
Ga0115103_167949523300009599MarineMEVCPMHVLEGLRERRKWWLRAESIDNTTYKRAMEVSEYNKGRSVSDLEIKDWSYGMPSKLRSDSVW*
Ga0115104_1039297213300009677MarineDKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNKGRSVSDLDIKDWTFGHPKNLRSDSTW*
Ga0115001_1053186613300009785MarineMEVCPDHVLESLREKRKWYLRAQAIDNETYKRAMKVSDFNKGKSVSDLSIKDWSYGSVRNMRSDSTWEDDRYDPLKYSHPHR
Ga0129333_1052769723300010354Freshwater To Marine Saline GradientVLEGLREKRKWMLRAQAIDNETYKRAMTVGEYNKGRSVADLSCKDWSYGTPQNLRSDSTW
Ga0136551_103902623300010388Pond Fresh WaterMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVTDLKLKTWEYGKGANLRSDSVW*
Ga0138316_1048195923300010981MarineMEVCPDHVLEALREKRKWYLRAQAIDNETYKRAMTVSDYNKGRSVSDIDAKDWTAGKPENLRPDG
Ga0138324_1040363523300010987MarineMEVCPDHVLEALREKRKWYLRAQAIDNETYKRAMTVSDYNKGRSVSDIDAKDWTAGKPENLRPDGTYIDDRYHPMSYSH
Ga0138258_171903113300012413Polar MarinePEHILEGLREKKKHMLRAEVIDNETYRRAMSVGEYNKTRSVSDLSLKTWAHGKTLRTESGY*
Ga0138263_178229413300012415Polar MarineKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMSVGEYNKTRSVSDLSLKTWAHGKTLRTESGY*
Ga0138259_161840913300012416Polar MarineMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMNVGDYNKGRSVSDLDVKDWSFGHPRNLRTESTW*
Ga0129349_102719523300012518AqueousMEVCPDHVLDQLKERKKWTLRAESIDNQTYKRAMKVSDYNRGRSVTDLHLRDWSYGYKIRSDTLY*
Ga0163180_1114943013300012952SeawaterMEVCPDHVLEALREKKKHMLRAEVIDNETYKRAMQVSDFNRGRSVSDLKLKTWAYGCGGNLRSDSLY*
Ga0163179_1037401513300012953SeawaterMNEKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNETYKRAMIVGDYNKGKSVSDLTIKDWSYGHVKNMRSDSTW*
Ga0163212_116951423300013087FreshwaterMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSGFNQGRSVSDLKLKTWDYGKTANLRSDSFW*
Ga0182016_1027328013300014493BogMEVCPDHVLDGLREKKKWYMRAEVIDNETYKRAMTIGDYNRSRSVSDLTLKTWEHGTAGKMRSDSIW*
Ga0182047_141584323300016737Salt MarshMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDFNKGRSVADLECKDWSFGHPKNLRSDS
Ga0182043_146097923300016748Salt MarshMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDFNKGRSVADLECKYWSFGHPRNLRSDSAW
Ga0182053_138267323300016749Salt MarshMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDFNKGRSVADLECKDWSF
Ga0181560_1042320723300018413Salt MarshMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDFNKGRSVADLECKDWSFGHPRNLRSDSAW
Ga0181560_1056257013300018413Salt MarshIMEVCPDHVLEGLKEMKKHNLRAESIDNETYKRAMSVSDFNKGRSVRDLQLKTWAYGKHLRSDSWY
Ga0181592_1087665913300018421Salt MarshLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNRGRSVSDLTIKDWSFGDPTNLRSESTW
Ga0181593_1115548113300018423Salt MarshDHVLEALREKKKWFLRAEQIDNDTYRRAMEVSDYNKNRSVSDLKLKDWSHGTAKNMRTDSLW
Ga0192978_107911513300018871MarineMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMNVGDYNKGRSVSDLDVKDWSFGHPRNLRTESTW
Ga0193553_106866023300018873MarineMEVCPDHILEGLREKKKWMLRAEVIDNETYRRAMEVSDFNRGRSVSELKLKTWEAGMAHKLRSDSLF
Ga0193260_1014705323300018928MarineCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMQVSDYNAGKSVSDLEIKDWSFGHPKNLRSDSTW
Ga0192894_1010863723300018968MarineMEVCPDHVLEGLRERRKWNMRAEAIDNTTYKRAMTISDYNQGKSVSDLVIKDWNFGHPKNLRSESAW
Ga0192894_1025356013300018968MarineENCFNEKIGIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDFNAGRSVSDLEIKDWSYGHSKNLRT
Ga0192961_1007506213300018980MarineMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0192947_1009775323300018982MarineMEVCPDHVLEGLRERRKWFLRAEAIDNQTYKRAMTVSDYNKGRSVSDLTIKDWSFGTADNLRTDSTW
Ga0192947_1028026123300018982MarineVCPDHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNKHRSVSDLKMKTWDYGKTANLRSDSLW
Ga0193030_1023756513300018989MarineMSAKLSVMEVCPDHILEALREKKKHMLRAEVIDNETYKRAMQVSDFNRGRSVSDLSLKTWAYGCGGSLRSDSLY
Ga0193569_1021793623300019017MarineMSAKLSVMEVCPDHILEALREKKKHMLRAEVIDNETYKRAMQVSDFNRGRSVSDLKLKTWAYGCGGSLRSDSLY
Ga0193569_1036899823300019017MarineMSAKLSVMEVCPDHILEALREKKKHMLRAEVIDNETYKRAMQVSDFNRGRSVSDLKLKTWAYGCG
Ga0192951_1014242223300019022MarineMEVCPDHVLESLREKRKWYLRAQAIDNETYKRAMKVSDFNKGKSVSDLHVKDWSYGCA
Ga0192869_1020447913300019032MarineMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNKGRSVSDLDVKDWSFGHPRNLRSDSTW
Ga0192981_1012520023300019048MarineMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMNVGGYNKGRSVSDLDVKDWSFGHPRNLRSDSTW
Ga0192972_108490913300019108MarineNKEVCLNDKISIMEVCPEHILEGLREKKKHMLRAEVIDNETYRRAMSVGEYNKTRSVSDLHLKTWAHGKTLRTESGY
Ga0193089_114642013300019133MarineIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNQGRSVSDLDVKDWSFGHPKNLRSESTW
Ga0188870_1005848723300019149Freshwater LakeMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNAGKSVSDLNIKDWSYGHPRNLRSESTW
Ga0182097_139526113300019261Salt MarshMEVCPDHVLEGMRERRKWWLRAEAIDNETYKRAMTVSDYNRGRSTLDLDVKDWSFGHPSNLRSDSTW
Ga0182068_156390013300019280Salt MarshMEVCPDHVLEGLREKKKWFMRAEMIDNDTYKRAMQVSDFNKNRSVSDLTLKTWEHGKAKNLRSDSLW
Ga0181562_1054005913300019459Salt MarshCFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0194113_1045252423300020074Freshwater LakeMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSGFNQGRSVSDLKLKTWDYGKTANLRSDSFW
Ga0196977_103946133300020146SoilMCAQQKNAESCFNDKINIMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMSVGSYNKGRSVSDLKLKTWEYGKGGRLRSDSLW
Ga0206128_131526223300020166SeawaterMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVGDYNKGKSVSDLHIKDWSFGHPRNLRSDSTW
Ga0206124_1024062613300020175SeawaterMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTIGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0194128_1020545713300020197Freshwater LakeMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSGFNQGRSVSDLKLKTWDYGKT
Ga0208853_102688923300020546FreshwaterMEVCPDHILEGLREKKKHFLRAESIDNETYKRAMTVSDFNKGRSVSDLKLKTWDYGKHLRSDSYY
Ga0214201_105650713300020732FreshwaterMEVCPDHILESLREKRKWLLRAQAIDNETYKRAMTVSDYNQKRSVSDLDIKDWTAG
Ga0214176_103094913300021128FreshwaterMEVCPDHILESLREKRKWLLRAQAIDNETYKRAMTVSDYNQKRSVSDLEIKDWTAG
Ga0206687_144786223300021169SeawaterMEVCPQHVLEALRERRKWWLRAESIDNTTYKRAMEVSDYNSGRSVSDLTIREWGYGHPSNLRSESTW
Ga0206687_155909223300021169SeawaterMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVSDLTLKSWDYG
Ga0206691_133561223300021342SeawaterMEVCPDHVLEGLREKRKWYLRAEAIDNETYKRAMTVSDFNKGKSVSDLEIKNWSFGHPKSLKSDSVWQDDRYDPI
Ga0206691_171618423300021342SeawaterMEVCPDHILEGLREKRKWFLRAEAIDNQTYKRAMTVGDYNKGRSVSDLAIKDWSFGHPRNLRTDSTW
Ga0206688_1092109213300021345SeawaterCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMNVSEYNKGKSVADLDIKDWSYGHPRNLRSESTW
Ga0206693_181848813300021353SeawaterLNEKVSIMEVCPDHILEGLREKRKWMLRAEAIDNETYKRAMTVGTYNKGRSVSDLDIKDWTYGHPKNLRSDSTW
Ga0206689_1100908523300021359SeawaterMEVCPDHVLEGLRERRKWWLRAEAIDNETYKRAMTVSDYNKGRSTRDLDVKDWSFGTAKNLRSDSTW
Ga0206689_1108600313300021359SeawaterMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNKGRSVSDLDIKDWTFGHPKNMRSDSTW
Ga0206123_1042159733300021365SeawaterCPDHVLEGLRERRKWSLRAESIDNETYKRAMTVGDYNKGRSVSDLTIKDWSYGSARNLRSESTW
Ga0213863_1016123123300021371SeawaterMNEKISIMEVCPDHVLEGLRERRKWSLRAESIDNETYKRAMTVGDYNKGRSVSDLTIKDWSYGSARNLRSESTW
Ga0213865_1029526313300021373SeawaterMEVCPDHVLEGLRERRKWFLRAEAIDNTTYKRAMTVSDYNKGRSVSDIDMKEWSFGHP
Ga0063103_104816813300021927MarineKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0063102_105260713300021941MarineFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0222716_1045509323300021959Estuarine WaterMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNQGRSVSDLEVKDWSFGHPKNLRSESTW
Ga0232123_107636813300023706Salt MarshMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDFNKGRSVADLECKDWSFGHPRNLRS
Ga0209716_106757513300025626Pelagic MarineMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMSVGDYNQGRSVSDLDVKDWSFGHPRNLRSENTW
Ga0209308_1028263623300025869Pelagic MarineMEVCPDHILEALREKRKWMLRAQTIDNETYKRAMVVGDYNKGKSVSDLNIKDW
Ga0209308_1039885613300025869Pelagic MarineACFNDKISIMEVCPDHVLEGLREKRKWMLRAEAIDNQTYKRAMTVSSYNMGRSVSDLDVKSWEHGHPKNMRSDSTW
Ga0207711_1211305223300025941Switchgrass RhizosphereMEVCPDHVLEGLREKKKWYMRAEVIDNQTYKRAMTVGDYNKGRSVSDLQLKTWEYGKGGSLRSDS
Ga0247594_105089613300026448SeawaterMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNKGRSVSDLDIKDWTFGHPKNLRSDSTW
Ga0247568_107591013300026462SeawaterMEVCPDHVLEGMRERRKWWLRAEAIDNETYKRAMTVSDYNRGRSTLDLDVKDWSFGHPSNLRSD
Ga0209467_120095213300027719FreshwaterLGDKISIMEVCPDHILEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSISELQLKTWEYGKGGKLRSDSVW
Ga0209617_1020577913300027720Freshwater And SedimentMEVCPDHILESLREKRKWLLRAQAIDNETYKRAMTVGDYNRRKSVSDIEIKDWTAG
Ga0209229_1019099823300027805Freshwater And SedimentMNIMEVCPDHVLEGLREKKKWYARAEVIDNETYRRAMQVADYNRGRSVSDLKLKSWDYGDSLRSDSLY
Ga0209302_1049418213300027810MarineLEGLREKKKHMLRAEAIDNETYKRAMQVGDYNKDRSVSDLKLKTWAHGKTLRSESAW
Ga0209668_1032452423300027899Freshwater Lake SedimentMNIMEVCPDHVLEGLREKKKWYARAEVIDNETYRRAMQVADYNRGRSVSDLKLKSWDYGDSLRSDSVY
Ga0228674_115873613300028008SeawaterMEVCPDHILEALREKRKWTLRAEAIDNETYKRAMTVGDYNQGKSVSDLTIREWSYGSPKNMRSDSTWEDDRYDPTKFPH
Ga0247586_110859913300028102SeawaterGKEKCFNEKISIMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMTVGDYNNGRSVSDLDVKDWSFGHPRNLRSDSTW
Ga0256412_137360013300028137SeawaterDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSNYNNGRSVSDLDIKDWSFGHPRNLRSDSTW
Ga0256417_112666523300028233SeawaterMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDYNAGKSVADLDIKDWSYGHPRNLRSESTW
Ga0247572_118167623300028290SeawaterMEVCPDHILEALREKRKWMLRAQAIDNETYKRAMVVGDYNKGKSVTDLTIRDWTYGSAKNMRSDS
Ga0304731_1123661533300028575MarineMNQKLSIMEVCPDHVLEALREKRKWYLRAQAIDNETYKRAMTVSDYNKGRSVSDIDAKDWTAGKPENLRPDG
Ga0247638_111138413300030551SoilAAAGSAKDEVCFNDKINIMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMVVGDYNKGRSVSDLTLKTWDYGKAGNLRSDSLW
Ga0247654_116652113300030552SoilLNDKINIMEVCPEHVLEGLREKKKWYLRAEVIDNETYKRAMSVGDYNRGRSVSDLQLKTWEYGKGGQLRLDSIW
Ga0247628_120821413300030569SoilVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMSVGSYNKNKSVSDLQLKTWEYGKGGNLRSDSLW
Ga0247648_115980323300030574SoilCINDKISIMEVCPEHVLEGLREKKKHYLRAEVIDNETYKRAMSVGDYNRGRSVSDLQLKTWEYGKGGQLRSDSIW
Ga0210288_102479423300030575SoilMEVCPDHILEGLREKKKWYLRAEVIDNETYKRAMSVGAYNKGRSVSDLKLKTWEHGKGGRMRSDSLW
Ga0210288_104814023300030575SoilMEVCPDHVLEGLREKKKWYLRAEVIDNDTYKRAMEISDYNKGRSVSDLKLKTWDHGTAANLHSGTTW
Ga0247637_119845513300030604SoilQLCAAKSSKEACIPEKISIMEVCPDHILEGLREKKKWFLRAEVIDNETYKRAMSVGDYNRGKSVSDLKLKTWEYGKGGNLKSDSLW
Ga0247615_1018492113300030607SoilMEVCPEHILEGLREKKKHYLRAEVIDNETYKRAMSVGAYNRGRSVSDLKLKTWEYGKGG
Ga0247651_1029864013300030608SoilDHVLEGLREKKKWFLRAEVIDNETYKRAMSVGDYNRGKSVSDLQLKTWEYGKGANLKSDSVW
Ga0247634_1045370013300030609SoilHILEGLREKKKWYMRAEVIDNETYKRAMSVGVYNRNRSVSDLQLKTWDYGKGGQLRSDSI
Ga0247629_1019847313300030628SoilMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMSVGSYNKNKSVSDLQLKTWEYGKGGNLRSDSLW
Ga0307398_1026795823300030699MarineMEVCPDHVLESLREKRKWYLRAQAIDNETYKRAMKVSDFNKGKSVTDL
Ga0307399_1039817313300030702MarineMEVCPDHVLEGLREKRKWYLRAEAIDNETYKRAMTVSDYNSGRSVSDLTIKDWSYGHSSNMRSDSTW
Ga0307399_1040244313300030702MarineMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMQVSDYNTGKSVSDLDIKDW
Ga0307400_1051829313300030709MarineMEVCPQHVLESLRERRKWWLRAESIDNTTYKRAMEVSDYNAGRSVTDLEIKEWGHGHPSNLRSDSTW
Ga0308127_102825413300030715MarineMEVCPEHVLEGLREKRKWMLRAQAIDNETYKRAMTVSDFNKGKSVSDLHIKDWSYGHAKNMRSDSTWEDDRYDPLKYSH
Ga0265461_1115378523300030743SoilMEVCPDHVLEGLREKKKWYLRAEVIDKETYKRAMIVGDYNRGRSVSELKLKTWEHGKGKNIRSDSTW
Ga0265461_1362558723300030743SoilFNDKISIMEVCPDHVLQGLQEKKKWYLRAELIDNETYKRAMVVGDYNKGRSVSELKLKTWEDGKRLNMRTDSYW
Ga0074020_1006141013300030840SoilMEVCPDHILEGLREKKKWYLRAEVIDNETYKRAMIVGDYNKGKSVSDLQLKTWDYGKGGRLRSDSLWQD
Ga0074000_1008387333300030860SoilLREKKKWYLRAEVIDNETYKRAMVVGDYNKGRSVSDLTLKTWDYGKAGNLRSDSLW
Ga0102747_1062719623300030959SoilACFNDKINIMEVCPDHVLDGLREKKKWYLRAELIDNETYKRAMVVGDYNRGRSVSDLKLKSWDYGTAGNLRSDSLW
Ga0074041_1108126613300031034SoilLCAAAAGSAKDEVCFNDKINIMEVCPDHVLEGLREKKKWYLRAEVIDNETYKRAMVVGDYNKGRSVSDLTLKTWDYGKAGNLRSDSLW
Ga0074041_1160251513300031034SoilAKEEVCFNDKISIMEVCPDHILEGLREKKKWYLRAEVIDNETYKRAMIVGDYNKGKSVSDLQLKTWDYGKGGRLRSDSLWQD
Ga0074026_1092847413300031035SoilCFNDKISIMEVCPDHILEDLREKKKWYLRAEVIDNETYKRAMTVGEYNKGRSVSDLKLKVWEDGLQKNMRTDSYF
Ga0170824_12478706723300031231Forest SoilMEVCPDHVLAALREKKKWFLRAQVIDNATYKRAMSVSSYNKGRSVSDLTLKSWSYGQSKNLR
Ga0170820_1433225613300031446Forest SoilMEVCPDHVLEGLREKKKWYLRAEVIDNETYRRAMSVGDYNRGKSVSDLKLKTWEYGKGSNLRSDTTW
Ga0302320_1161159723300031524BogATKRGADNCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVTDLQLKTWEHGKGGRLRSDTVW
Ga0307489_1024231323300031569Sackhole BrineMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDFNKGKSVSDLEIKDWSFGHPSNLRSESTW
Ga0307386_1029096623300031710MarineMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMVVSDFNKGRSVSDLTLKSWDYGKAKNLRSDSIW
Ga0307381_1026062523300031725MarineMEVCPDHVLEGLREKKKWYLRAEMIDNDTYQRAMVVSDFNKGRSVSDLTLKSWDYGK
Ga0307381_1040851323300031725MarineMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMNVGDYNKGRSVSDLDVKDWSFGHPRNLRSESTW
Ga0307391_1027108423300031729MarineMEVCPDHILEGLRERRKWYLRAEAIDNETYKRAMTVGDYNRGRSVTDLDVKDWSFGHPRNLRSESTW
Ga0307391_1044814523300031729MarineMEVCPQHVLESLRERRKWWLRAECIDNTTYKRAMEVSDYNAGRSVTDLEIKEWGHGHPTKLRSDSTW
Ga0307397_1017163523300031734MarineMEVCPQHVLESLRERRKWWLRAESIDNTTYKRAMEVSDYNAGRSVTDLEIKEWGHGHPTKLRSDSTW
Ga0307397_1063361213300031734MarineSSNKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNAHRSVSDLKLKTWDHGKTANMRSDSLW
Ga0307395_1030432113300031742MarineMEVCPDHVLESLREKRKWYLRAQAIDNETYKRAMKVSDFNKGKSVTDLQVKDWSYGCAKNMRSDSTWEDDRYDPLKYPHPH
Ga0315907_1116333713300031758FreshwaterEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKHRSVSDLKLKTWDYGKTANLRSDSIW
Ga0314779_102155023300032150SedimentMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDFNKGRSVSDLDIKDWSF
Ga0314675_1047325223300032491SeawaterMEVCPDHVLESLREKRKWYLRAQAIDNETYKRAMKVSDFNKGKSVSDLSIKDWSYGCA
Ga0314675_1055636213300032491SeawaterMEVCPDHVLEGLRERRKWYLRAEAIDNETYKRAMSVGDYNQGRSVSDLEVKDWSFG
Ga0314667_1077177113300032520SeawaterDACFNDKLSIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMQVSDYNKSRSVADLDIKNWAYGHPKNLRTGTTW
Ga0315742_1247414013300032756Forest SoilMEVCPDHVLEGLKERKKWYLRAEVIDNETYKRAMSVGEYNRGRSVSNLALKTWEYGKA
Ga0316610_108455323300033498Microbial MatMEVCPDFVLEGLREKKKWFLRAQVIDNATYRRGMAVSSYNQGRSLSELTPKTWTHGTKRFMRPDSYWA
Ga0334977_0360722_516_6833300033978FreshwaterMEVCPDHILEGLREKKKHFLRAESIDNETYKRAMTVSDFNKGRSVSDLKLKTWDYG
Ga0334981_0160519_461_7123300033980FreshwaterLCKDKSNPEACFQEKINIMEVCPDHILEGLREKKKHFLRAESIDNETYKRAMTVSDFNKGRSVSDLKLKTWDYGKHLRSDSYY
Ga0310130_0244403_352_5553300034073Fracking WaterMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVSDLKLKTWEYGKGGQLRSDTVW
Ga0335049_0851156_1_1833300034272FreshwaterDHILEGLREKKKHFLRAESIDNETYKRAMTVSDFNKGRSVSDLKLKTWDYGKHLRSDSYY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.