NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036492

Metagenome / Metatranscriptome Family F036492

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036492
Family Type Metagenome / Metatranscriptome
Number of Sequences 170
Average Sequence Length 118 residues
Representative Sequence TMAPITRRWQAAIDTTYNVDSPPAYSFGVGTDGTSTFSGGGLHEITSQIHNDMLRIDNPPAYFNLSVNVVQPGHGAGVGLIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYAKSGKYASVPAR
Number of Associated Samples 122
Number of Associated Scaffolds 170

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.61 %
% of genes near scaffold ends (potentially truncated) 89.41 %
% of genes from short scaffolds (< 2000 bps) 78.82 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.78

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.765 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(40.588 % of family members)
Environment Ontology (ENVO) Unclassified
(46.471 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.235 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.00%    β-sheet: 36.67%    Coil/Unstructured: 57.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.78
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.3.4.0: Transthyretin (synonym: prealbumin)d4q14a_4q140.54
b.3.4.1: Transthyretin (synonym: prealbumin)d1f86a_1f860.53
b.3.4.0: Transthyretin (synonym: prealbumin)d2g2na_2g2n0.53
b.3.4.0: Transthyretin (synonym: prealbumin)d2h6ua_2h6u0.53
b.3.4.0: Transthyretin (synonym: prealbumin)d3qvaa13qva0.51


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 170 Family Scaffolds
PF00005ABC_tran 18.24
PF12848ABC_tran_Xtn 10.00
PF00144Beta-lactamase 10.00
PF01471PG_binding_1 2.35
PF04014MazE_antitoxin 2.35
PF12543DUF3738 1.76
PF05973Gp49 1.18
PF03551PadR 0.59
PF05015HigB-like_toxin 0.59
PF07670Gate 0.59
PF00975Thioesterase 0.59
PF04389Peptidase_M28 0.59
PF00625Guanylate_kin 0.59
PF01850PIN 0.59
PF00150Cellulase 0.59
PF02537CRCB 0.59
PF00754F5_F8_type_C 0.59
PF01381HTH_3 0.59
PF01551Peptidase_M23 0.59
PF00691OmpA 0.59
PF13419HAD_2 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 170 Family Scaffolds
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 10.00
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 10.00
COG2367Beta-lactamase class ADefense mechanisms [V] 10.00
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 1.18
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 1.18
COG0194Guanylate kinaseNucleotide transport and metabolism [F] 0.59
COG0239Fluoride ion exporter CrcB/FEX, affects chromosome condensationCell cycle control, cell division, chromosome partitioning [D] 0.59
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.59
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.59
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.59
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 0.59
COG3549Plasmid maintenance system killer proteinDefense mechanisms [V] 0.59
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.76 %
UnclassifiedrootN/A8.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918008|ConsensusfromContig352905All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii610Open in IMG/M
3300001398|JGI20207J14881_1008596All Organisms → cellular organisms → Bacteria2949Open in IMG/M
3300001401|JGI20189J14885_1003014All Organisms → cellular organisms → Bacteria3532Open in IMG/M
3300009636|Ga0116112_1031245All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1686Open in IMG/M
3300009638|Ga0116113_1099429All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii701Open in IMG/M
3300009641|Ga0116120_1077243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1115Open in IMG/M
3300009665|Ga0116135_1258867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii678Open in IMG/M
3300009759|Ga0116101_1168870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii544Open in IMG/M
3300010379|Ga0136449_101422377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1069Open in IMG/M
3300014160|Ga0181517_10517453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii602Open in IMG/M
3300014168|Ga0181534_10660661All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii607Open in IMG/M
3300014199|Ga0181535_10134212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1565Open in IMG/M
3300014199|Ga0181535_10731879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii562Open in IMG/M
3300014200|Ga0181526_10764708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii609Open in IMG/M
3300014200|Ga0181526_10778880All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii603Open in IMG/M
3300014201|Ga0181537_10910929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii596Open in IMG/M
3300014493|Ga0182016_10094848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2128Open in IMG/M
3300014493|Ga0182016_10465263All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii736Open in IMG/M
3300014499|Ga0182012_10003293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae17252Open in IMG/M
3300014499|Ga0182012_10146073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_171712Open in IMG/M
3300014499|Ga0182012_10349866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii985Open in IMG/M
3300014499|Ga0182012_10988064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii529Open in IMG/M
3300014501|Ga0182024_12193822All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii605Open in IMG/M
3300014502|Ga0182021_10544277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1387Open in IMG/M
3300014657|Ga0181522_10003300All Organisms → cellular organisms → Bacteria9066Open in IMG/M
3300014658|Ga0181519_10171902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1374Open in IMG/M
3300014838|Ga0182030_10159740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2830Open in IMG/M
3300014838|Ga0182030_10281929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1856Open in IMG/M
3300014838|Ga0182030_11275650Not Available621Open in IMG/M
3300014839|Ga0182027_10954041All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii882Open in IMG/M
3300017940|Ga0187853_10048667All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2181Open in IMG/M
3300017988|Ga0181520_10290566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1229Open in IMG/M
3300017988|Ga0181520_10872713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii602Open in IMG/M
3300017995|Ga0187816_10440538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii582Open in IMG/M
3300018013|Ga0187873_1308480All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii580Open in IMG/M
3300018014|Ga0187860_1127900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1115Open in IMG/M
3300018021|Ga0187882_1412261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii512Open in IMG/M
3300018023|Ga0187889_10031666All Organisms → cellular organisms → Bacteria2999Open in IMG/M
3300018042|Ga0187871_10107638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1602Open in IMG/M
3300018043|Ga0187887_10525999All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii698Open in IMG/M
3300018044|Ga0187890_10512787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii674Open in IMG/M
3300018057|Ga0187858_10702715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii603Open in IMG/M
3300019256|Ga0181508_1151645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii627Open in IMG/M
3300019787|Ga0182031_1097192All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1602Open in IMG/M
3300019787|Ga0182031_1097193All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17929Open in IMG/M
3300019787|Ga0182031_1143672All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1924Open in IMG/M
3300019787|Ga0182031_1191616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1924Open in IMG/M
3300019787|Ga0182031_1432437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1619Open in IMG/M
3300019788|Ga0182028_1095161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii732Open in IMG/M
3300019788|Ga0182028_1250811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii954Open in IMG/M
3300021402|Ga0210385_10382235All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1056Open in IMG/M
3300021477|Ga0210398_10587940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii904Open in IMG/M
3300021478|Ga0210402_11237320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii674Open in IMG/M
3300022872|Ga0224526_1005722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3372Open in IMG/M
3300023101|Ga0224557_1012475All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4932Open in IMG/M
3300025439|Ga0208323_1070530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii596Open in IMG/M
3300025498|Ga0208819_1079940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii711Open in IMG/M
3300025574|Ga0208717_1019767All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1817Open in IMG/M
3300025664|Ga0208849_1000142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae70280Open in IMG/M
3300027879|Ga0209169_10036244All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2597Open in IMG/M
3300027908|Ga0209006_10229453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1603Open in IMG/M
3300027908|Ga0209006_10624246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii888Open in IMG/M
3300028268|Ga0255348_1006531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2622Open in IMG/M
3300028268|Ga0255348_1040013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17877Open in IMG/M
3300028562|Ga0302151_10219880All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii640Open in IMG/M
3300028565|Ga0302145_10095710All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1014Open in IMG/M
3300028572|Ga0302152_10286266All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii540Open in IMG/M
3300028745|Ga0302267_10122735All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300028745|Ga0302267_10196693All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii899Open in IMG/M
3300028746|Ga0302233_10113173All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1064Open in IMG/M
3300028747|Ga0302219_10393366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii542Open in IMG/M
3300028747|Ga0302219_10406369Not Available533Open in IMG/M
3300028748|Ga0302156_10050933All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2242Open in IMG/M
3300028748|Ga0302156_10496084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii520Open in IMG/M
3300028762|Ga0302202_10008374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9745Open in IMG/M
3300028762|Ga0302202_10289833All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii794Open in IMG/M
3300028773|Ga0302234_10421954All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii571Open in IMG/M
3300028779|Ga0302266_10167895All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300028788|Ga0302189_10057885All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1893Open in IMG/M
3300028788|Ga0302189_10399252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii540Open in IMG/M
3300028813|Ga0302157_10326968All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii832Open in IMG/M
3300028860|Ga0302199_1034287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1825Open in IMG/M
3300028860|Ga0302199_1138460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii764Open in IMG/M
3300028866|Ga0302278_10028877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3829Open in IMG/M
3300028866|Ga0302278_10474701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii536Open in IMG/M
3300028873|Ga0302197_10160536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1075Open in IMG/M
3300028882|Ga0302154_10379815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii683Open in IMG/M
3300029882|Ga0311368_11136133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii505Open in IMG/M
3300029883|Ga0311327_10753781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii571Open in IMG/M
3300029883|Ga0311327_10835044Not Available535Open in IMG/M
3300029908|Ga0311341_10264649All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300029908|Ga0311341_10482156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii709Open in IMG/M
3300029908|Ga0311341_10740284All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii546Open in IMG/M
3300029911|Ga0311361_10328857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1683Open in IMG/M
3300029911|Ga0311361_10662674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii970Open in IMG/M
3300029911|Ga0311361_11505916All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii507Open in IMG/M
3300029913|Ga0311362_10193283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2351Open in IMG/M
3300029913|Ga0311362_11174971Not Available575Open in IMG/M
3300029914|Ga0311359_10046941All Organisms → cellular organisms → Bacteria → Acidobacteria4637Open in IMG/M
3300029914|Ga0311359_10130761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2350Open in IMG/M
3300029916|Ga0302148_1015889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2223Open in IMG/M
3300029917|Ga0311326_10328446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii771Open in IMG/M
3300029920|Ga0302142_1101070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii893Open in IMG/M
3300029920|Ga0302142_1157292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii695Open in IMG/M
3300029922|Ga0311363_10696817All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17965Open in IMG/M
3300029939|Ga0311328_10363413All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_171051Open in IMG/M
3300029945|Ga0311330_11078407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii588Open in IMG/M
3300029951|Ga0311371_10173604All Organisms → cellular organisms → Bacteria3251Open in IMG/M
3300029952|Ga0311346_10596301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii991Open in IMG/M
3300029953|Ga0311343_10114286All Organisms → cellular organisms → Bacteria3051Open in IMG/M
3300029953|Ga0311343_11428380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii514Open in IMG/M
3300029954|Ga0311331_10503885All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_171181Open in IMG/M
3300029955|Ga0311342_10570677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii926Open in IMG/M
3300029955|Ga0311342_11083410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii587Open in IMG/M
3300029955|Ga0311342_11119318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii573Open in IMG/M
3300029956|Ga0302150_10234366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii690Open in IMG/M
3300029984|Ga0311332_11494826All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii547Open in IMG/M
3300029988|Ga0302190_10082069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1481Open in IMG/M
3300029992|Ga0302276_10005692All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10324Open in IMG/M
3300029999|Ga0311339_10091883All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3792Open in IMG/M
3300030004|Ga0302186_10245509All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii607Open in IMG/M
3300030011|Ga0302270_10348790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii801Open in IMG/M
3300030051|Ga0302195_10053751All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2224Open in IMG/M
3300030057|Ga0302176_10053118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1556Open in IMG/M
3300030399|Ga0311353_11197306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii627Open in IMG/M
3300030506|Ga0302194_10207974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii802Open in IMG/M
3300030507|Ga0302192_10041577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2421Open in IMG/M
3300030507|Ga0302192_10285340All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii691Open in IMG/M
3300030508|Ga0302185_10090821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1110Open in IMG/M
3300030508|Ga0302185_10315508All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii526Open in IMG/M
3300030518|Ga0302275_10584866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii543Open in IMG/M
3300030519|Ga0302193_10324809All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300030520|Ga0311372_12348125Not Available607Open in IMG/M
3300030524|Ga0311357_11439376Not Available585Open in IMG/M
3300030617|Ga0311356_10397399All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa1361Open in IMG/M
3300030688|Ga0311345_10333517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1408Open in IMG/M
3300030688|Ga0311345_10379502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1281Open in IMG/M
3300030693|Ga0302313_10059567All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1654Open in IMG/M
3300030737|Ga0302310_10125445All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1564Open in IMG/M
3300031028|Ga0302180_10066225All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2137Open in IMG/M
3300031232|Ga0302323_100821050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1023Open in IMG/M
3300031234|Ga0302325_12252876All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa660Open in IMG/M
3300031234|Ga0302325_13062435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii538Open in IMG/M
3300031236|Ga0302324_102100913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii705Open in IMG/M
3300031236|Ga0302324_102279593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii669Open in IMG/M
3300031258|Ga0302318_10045957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1736Open in IMG/M
3300031259|Ga0302187_10010558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6878Open in IMG/M
3300031261|Ga0302140_10134874All Organisms → cellular organisms → Bacteria2378Open in IMG/M
3300031261|Ga0302140_10903115All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii618Open in IMG/M
3300031261|Ga0302140_11087948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii543Open in IMG/M
3300031708|Ga0310686_110562968All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii720Open in IMG/M
3300031708|Ga0310686_116628624All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii671Open in IMG/M
3300031788|Ga0302319_11314698Not Available658Open in IMG/M
3300031788|Ga0302319_11459054All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii612Open in IMG/M
3300031823|Ga0307478_10473952All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1042Open in IMG/M
3300031837|Ga0302315_10397378All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii768Open in IMG/M
3300033818|Ga0334804_089732All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii811Open in IMG/M
3300033818|Ga0334804_148112All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii583Open in IMG/M
3300033824|Ga0334840_177549All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii549Open in IMG/M
3300033887|Ga0334790_064745All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1297Open in IMG/M
3300033891|Ga0334811_071437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii910Open in IMG/M
3300034163|Ga0370515_0180749All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii901Open in IMG/M
3300034163|Ga0370515_0302945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii676Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog40.59%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa12.35%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog8.24%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.47%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.47%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.12%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.35%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.76%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.18%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.18%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.18%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.59%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.59%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.59%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.59%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300001398Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012EnvironmentalOpen in IMG/M
3300001401Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022872Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025574Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes)EnvironmentalOpen in IMG/M
3300025664Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300026456Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028562Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029916Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1EnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029920Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029988Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3EnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030004Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1EnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030508Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030693Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Bog_all_C_062408002140918008SoilRRWQVAIDTTYNIDSPPAYSFGVGNDGTATFSGGGLHEITSQIHNDMLRIDNPPAYFNLGMNVVQPGHGAGVGLIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYAKSGKYASVPAR
JGI20207J14881_100859643300001398Arctic Peat SoilMAPLNRHYQAAIDTTYDQNNPTHYEFGEATDGTTSFSGGGVHEITDQVHHGALRIDNPPAYFMLGLYFPTPHRGGDVGLVYRQCFGPVTNLYFVAKDPSNPDNDWDWLYAKSGKYATPPAQ*
JGI20189J14885_100301423300001401Arctic Peat SoilMAPLNRHYQAAIDTNYDQNNPPHYEFGVATDGTTTFSGGGAHEITDQVHNGALRIDNPAAYFMLGLYFPTTHRGGDVGLVYRQCFGPVTNLYFVAKDPSNPDNDWDWLYAKSGKYAARPAQ*
Ga0116112_103124533300009636PeatlandVGNDGTSTYSGGGLHEITDQIRNGMLRIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPVTMLYYVVKDPSNPADGGDWLYANSGKYAVPPTR*
Ga0116113_109942913300009638PeatlandVVAAKNMAPINRKFQVAIDTTYNQDNPTPPSYTFGVGQDGTATYSGGGLHEITSQVRNGTLRIDNPPASFNLSVNIPTPNRGADIGLVYRQCFAPITNLYYVVKDPDDMGKGADFLFAKSGKYAAAP*
Ga0116120_107724323300009641PeatlandSIVVRVVAAKTMAPINRKFQAAIDTTYDQNNPTPPHYEFGVGNDGTSTYSGGGLHEITDQIHNGMLRIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPVTMLYDVIKDPSNPADGGDWLYAKSGEYAVPPSQ*
Ga0116135_125886713300009665PeatlandQNSCTVVVRVVQAKTMAPVTKKFQIAIDTSFNVKSPSPYTFGVGLDGTATYSGGGVHEVTNFVHNGMLSIPNPPPYFMLGVNIPTPHIGADLNLIYRQCFAPITVLYRLVNDVNDPQKGGDWLWAKAGKYATVPAAH*
Ga0116101_116887013300009759PeatlandKTMAPVTRPWQFAIDTTFNQDHPSPYTFGVGNDGTSTFSGGSIHEISNQIHNDMLRIDNPPATFYKAMNVKQPGRGTEAGMIYRQCFAPVTMLYYVMKDPADIGKGADWLYAKAGKYAAVPAK*
Ga0136449_10142237723300010379Peatlands SoilMAPITRRWQVAIDTTYNIDSPPAYSFGVGNDGTATFAGGGLHEITSQVHNDMVRIDNPPAYFNLSMNVVQPGHGAGLGLIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYAKSGKYASVPAR*
Ga0181517_1051745313300014160BogSCSIVVRVVAAKTMAPINRKFQAAIDTTYDQNNPTPPHYVFGVGNDGTSTYSGGGLHEITDQIRNGMLRIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPVTMLYYVVKDPSNPADGGDWLYANSGKYAVPPTR*
Ga0181534_1066066113300014168BogDTTYKIEDPPHYTFGVGDDGTSTFSGGGLHEITDQVRNGMLRVDNPPPYFTFTVNVPTPHEGAADGFIYRQCFAPVTMLYYILKDPTDPGKGTDFLYAKSGKYAKAP*
Ga0181535_1013421213300014199BogPSYQFGVGNDGTATYSGGGLHEITNQVRNGTLRIDNPPSYFNLSMNIVSPGQGAGVGLIYRQCFAPVTNLYYIVKDPSDLTKGADFLYAKSGKYAAPAH*
Ga0181535_1073187913300014199BogTMAPITRRWQAAIDTTYNVDSPPAYSFGVGTDGTSTFSGGGLHEITSQIHNDMLRIDNPPAYFNLSVNVVQPGHGAGVGLIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYAKSGKYASVPAR*
Ga0181526_1076470813300014200BogLIHIVAAKTMAPFTRRWQAAIDTTYNQDSPTPPHYEFGVGRDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAMNVVQPGHGTAIGLLYRQCFAPVTMLYYVLKDPNDPGAGGDYLYAKAGKYAAVPTR*
Ga0181526_1077888013300014200BogIDTTYNQDNPTPPSYQFGVGNDGTATYSGGGLHEITNQVRNGTLRIDNPPSYFNLSMNIVSPGQGAGVGLIYRQCFAPVTNLYYIVKDPSDLTKGADFLYAKSGKYAAPAH*
Ga0181537_1091092913300014201BogILLHVVAAKTMAPINRKYQVAIDTTYKIEDPPHYTFGVGDDGTSTFSGGGLHEITDQVRNGMLRVDNPPPYFTFTVNVPTPHEGAAGGYIYRQCFAPVTNLYYILKDPSDPGKGTDFLYAKSGKYAAVAAH*
Ga0182016_1009484813300014493BogVAAKTMAPLNRKFQVAIDTTYDQDSPTPPSYIFGVRPDGTSTYSGGGLHEITSQVHNGTLRIDNPPAYFNLSVNIPTPNRGAGIGLVYRQCFAPVTNLYYVVNDPEDMSKGADFLYAKSGKYAAVP*
Ga0182016_1046526313300014493BogSPTPPSYQFGVGNDGTATFAGGGLHEITSQIHNGTLRIENPPGYFNLSTNFIQPGRGAGITLIYRQCFAPTTVLYFVLKDPSDPGAGGDWLYAKSGKYSTAPSN*
Ga0182012_1000329313300014499BogILHVVAAKTMAPLNRKFQVAIDTTYDQDSPTPPSYIFGVRPDGTSTYSGGGLHEITSQVHNGTLRIDNPPAYFNLSVNIPTPNRGAGIGLVYRQCFAPVTNLYYVVNDPEDMSKGADFLYAKSGKYAAVP*
Ga0182012_1014607343300014499BogAIDTTYNQDDPHPAGYTFGVGRDGTSTYAGGGLHEITSQVKNFTLRIDNPPAYFNFGVNVPTPNTGANVGLIYRQCFAPVTNLYYILKDASNPGSGGDYLYAKSGKYAAPSR*
Ga0182012_1034986613300014499BogKTMAPINRKFQAAIDTTYNQDAPTPPQYVFGVGRDGTSTYAGGGLHEITNQVRDGVLRIDNPPAYFMLGVNIPTPNEGANVGLIYRQCFAPVTVLYDIIKDPSDPGKGADWLYAKAGKYATAPAH*
Ga0182012_1098806413300014499BogILHVVAAKTMAPLNRKFQVAIDTTYDQDSPTPPSYIFGVRPDGTSTYSGGGLHEITSQVRNGSLRIDNPPAYFNLSVNIPTPNRGAGIGLVYRQCFAPVTNLYYVVNDPEDMSKGADFLYAKSGKYAVAP*
Ga0182024_1219382213300014501PermafrostSANSCTIVVHAVASKTMAPLNRHFQAAIDTTYNQSSPPHYTFGVATDGTTSFSGGGVHEITDQVHNGVFRIDNPPAYFMLGVYFPTPNRGGDVGLVYRQCFGPVTNLYFVAKDPTNPDDGWDWLYAKSGKYATSPAQ*
Ga0182021_1054427723300014502FenWQAAIDTTYNQDSPTPPAYSFGVGTDGTSTFSGGGLHEITSQIRNGMLRIDNPPAYFNLSTNFIQPGRGAGIGLIYRQCFAPTTMLYYVLKDPNDPGAGGDFLYARSGKYASVPMH*
Ga0181522_1000330013300014657BogYSFGVGNDGTATFSGGGLHEITSQIRDDMLRIDNPPAYFNLSMNVVQPGHGAGAGGLIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYARSGKYALLTTRCSRID*
Ga0181519_1017190213300014658BogDTTYNQDDPNPPHYTFGVGNDGTSTFSGGGLHEITSQIHNDMLRIDNPPAYFNLAVNVVQPGHGTSTGLFYRQCFYPTTMLYYVLKDPDDPGKGGDYLYAKAGKYATVPTH*
Ga0182030_1015974023300014838BogVVRVVAAKTMAPVTRRWQAAIDIAYNVDHPPAYNFGVGNDGTATFAGGGLHEITSQIHNDMLRIDNPPVYFNLSLNVVQPNHGAGTALIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYAKSGKYAPVPAR*
Ga0182030_1028192923300014838BogPTPPSYQFGVGNDGTATFAGGGLHEITSQIRNGTLRIENPPAYFNLSTNFIQPGRGAGITLIYRQCFAPTTVLYFVLKDPNDPGAGGDWLYAKSGKYSIAPSN*
Ga0182030_1127565013300014838BogPHYEFGVGADGTSTYAGGGLHEITNQIHNGMLRIDSPPAYFMFGVNIPTPNHGADVGLIYRQCFAAITNLYYVVKDPSNPANGGDWLYAKAGKYTAPPAQ*
Ga0182027_1095404113300014839FenTYDQNSPTPPHYVFGVGADGTSTYSGGGLHEITNQIHNGTLRIDNPPAYFMFGVNIPTPHRGADVGLIYRQCFAPVTMLYYVVKDPDNPANGGDWLYAKAGKFATAPAP*
Ga0187853_1004866713300017940PeatlandNPTPPHYVFGVGVDGTSTYSGAGLHEITDQIRNGMLRIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPVTMLYYVVKDPSNPADGGDWLYANSGKYAVPPTR
Ga0181520_1029056613300017988BogRKWQAAIDTTYNQDNPTPPHYEFGSATDGTSTFAGGGLHEITSQIRNDTLRIENPPAYFNFATNFIQPGRGAGIGLIYRQCFAPTTMLYFVLKDPNDPGAGGDFLYAKSGEYATVPTH
Ga0181520_1087271313300017988BogTPPHYVFGVGVDGTSTYSGAGLHEITDQIRNGMLRIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPVTMLYYVVKDPSNPADGGDWLYANSGKYAVPPTR
Ga0187816_1044053813300017995Freshwater SedimentAIDTTYIIDSPPAYSFGMGNDGTATFSGGGLHEITSQVHNDMVRIDNPPAYFNLSMNVVQPGHGAGVGLIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYAKSGKYASVPAR
Ga0187868_128837823300018002PeatlandVGNDGTSTFSGGGLHEITNQIRNGMLRIDNPPPYFNLSMNIVQPGHGAGLSLIYRQCFAPTTMLYYVVKDPGNPGEGGDWLYAKAGKYAAAPTH
Ga0187873_130848013300018013PeatlandRRWQAAIDTTYTMASPSPPAYSFGMGTDGSSTFSGGGLHEITSQIHNDMLRIDNPPAYFNLSMNVVQPGHGAGIGLIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYAKSGKYASVPAR
Ga0187860_112790013300018014PeatlandTMAPINRAYQAAIDTTYDQNNPTPPHYVFGVGNDGTSTYSGGGLHEITNQIHNGMLRIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPVTMLYDVIKDPSNPADGGDWLYAKSGKYAVPPTQ
Ga0187882_141226113300018021PeatlandPPHYVFGVGNDGTSTYSGGGLHEITDQIRNGMLCIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPTTMLYFVVKDPSNPANGGDWLYAKAGKYAALPAH
Ga0187889_1003166613300018023PeatlandRRYQVAIDTTYNQDAPTPPHYEFGVGNDGTSTFSGGGLHEITNQIRNGMLRIDNPPPYFNLSMNIVQPGHGAGLSLIYRQCFAPTTMLYYVVKDPGNPGEGGDWLYAKAGKYAAAPTH
Ga0187871_1010763823300018042PeatlandNQDNPTPPSYTFGVGQDGTATYSGGGLHEITSQVRNGTLRIDNPPASFNLSVNIPTPNRGADIGLVYRQCFAPITNLYYVVKDPDDMGKGADFLFAKSGKYAAAP
Ga0187887_1052599923300018043PeatlandVAAKTMAPINRKFQAAIDTTYNQDAPTPPHYVFGVGDDGTSTYSGGGLREITNQVHNGMLRIDDPPAYFMLGVNIPTPHEGADVGLIYRQCFAPVTVLYDVIKDPSDPGKGNDWLYAKAGKYATVPAH
Ga0187890_1051278713300018044PeatlandNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0187858_1070271513300018057PeatlandPNPPHYQFGVGNDGTSTFSGGGLHEITNQVHNGMLRIDNPPAYFNLGVNIPTPNHGADVGLIYRQCFAPTTMLYFVVKDPSNPANGGDWLYAKAGKYAALPAH
Ga0181508_115164513300019256PeatlandAKTMAPIARPWQAAIDTTYNVDQPPAYSFGVGNDGTATFSGGGLHEITSQIRDDMLRIDNPPAYFNLSMNVVQPGHGAGAGGLIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYARSGKYALLTTR
Ga0182031_109719213300019787BogDRPALRVVNPKTMAPSTRRWQAAIDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0182031_109719323300019787BogPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0182031_114367213300019787BogRELLGPGSANSCTIVLRVVNPKTMAPSTRRWQAAIDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0182031_119161613300019787BogGPFVGPGSANSCTIVLRVVNPKTMAPSTRRWQAAIDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0182031_143243723300019787BogMAPINRKFQVAIDTTYNQDDPTPPSYVFGVGADGTSTYSGGGLHEITSQVHNGALRIDNPPAYFNLSVNIPTPNRGAGIGLVYRQCFAPVTNLYYVVKDPEDVGKGADFLFAKSGKYAAV
Ga0182028_109516123300019788FenHYVFGVGADGTSTYSGGGLHEITNQIHNGTLRIDNPPAYFMFGVNIPTPHRGADVGLIYRQCFAPVTMLYYVVKDPDNPANGGDWLYAKAGKFATAPAP
Ga0182028_125081113300019788FenTYDQNSPTPPHYVFGVGADGTSTYSGGGLHEITNQIHNGTLRIDNPPAYFMFGVNIPTPHRGADVGLIYRQCFAPVTMLYYVVKDPDNPANGGDWLYAKAGKFATAPAP
Ga0210385_1038223513300021402SoilDQSNPPHYTFGVATDGTTSFSGGGVHEITDQVHNGVFRIDNPPAYFMLGVYFPTPNRGGDVNLVYRQCFGPVTNLYFVAKDPTNPDDGWDWLYAKSGKYSAPPAQ
Ga0210398_1058794023300021477SoilMAPLNRHYQAAIDTTYDQNNPPHYTFGVATDGTTSFSGGGVHEITDQVHNGVFRIDNPPAYFMLGVYFPTPNRGGDVGLVYRQCFGPVTNLYFVAKDPTNPDDGWDWLYAKSGKYAAPPA
Ga0210402_1123732013300021478SoilAAIDTTYNVESPPAYSFGVGNDGTATFSGGGLHEITSQIQNNMLRIDNPPGYFNLSVNVVQPGHGAGVGLIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYAKSGKYASVPAR
Ga0224526_100572243300022872SoilVAAKTMAPSTRKWQAAIDTTYNQDAPTPPHYEFGTGRDGTSTFKGGGIHEITSQIHNDMLRIDNPPAYFNLALNVIQPGHGTGIGLVYRQCFAPVTMLYYVMKDPNDIGAGADYLYAKAGKFAAVPTH
Ga0224557_101247553300023101SoilAAKTMAPINRKFQAAIDTTYDQNNPTPPHYEFGVGNDGTSTYSGGGLHEITNQIHNGMLRIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPVTMLYYVVKDPANPADGGDWLYAKSGKYAVPPTQ
Ga0208323_107053013300025439PeatlandRVVAAKTMAPINRKFQAAIDTTYDQNNPTPPHYVFGVGNDGTSTYSGGGLHEITDQIHNGMLRIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPVTMLYDVIKDPSNPADGGDWLYAKSGEYAVPPSQ
Ga0208819_107994013300025498PeatlandSIVVRVVAAKTMAPINRKFQAAIDTTYDQNNPTPPHYVFGVGNDGTSTYSGGGLHEITDQIHNGMLRIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPVTMLYDVIKDPSNPADGGDWLYAKSGEYAVPPSQ
Ga0208717_101976723300025574Arctic Peat SoilMAPLNRHYQAAIDTTYDQNNPTHYEFGEATDGTTSFSGGGVHEITDQVHHGALRIDNPPAYFMLGLYFPTPHRGGDVGLVYRQCFGPVTNLYFVAKDPSNPDNDWDWLYAKSGKYATPPA
Ga0208849_1000142343300025664Arctic Peat SoilVVHAVAAKTMAPLNRHYQAAIDTNYDQNNPPHYEFGVATDGTTTFSGGGAHEITDQVHNGALRIDNPAAYFMLGLYFPTTHRGGDVGLVYRQCFGPVTNLYFVAKDPSNPDNDWDWLYAKSGKYAARPAQ
Ga0255351_100615043300026456SoilPTPPHYEFGTGRDGTSTFKGGGIHEITSQIHNDMLRIDNPPAYFNLALNVIQPGHGTGIGLVYRQCFAPVTMLYYVMKDPNDIGAGADYLYAKAGKFAAVPTH
Ga0209169_1003624413300027879SoilYDCQELIREQLIDYIRTIVVHAVASKTMVPLNRHYQAAIDTTYDQGSPPHYTFGVATDGTTSFSGGGVHEITDQVHNGVLSIDNPPAYFMLGVYFPMPNRGGDVGLVYRQCFGPVTNLYFVAKDPTNPDDGWDWLYAKSGKYSASPTQ
Ga0209006_1022945313300027908Forest SoilDQGSPPHYTFGVATDGTTSFSGGGVHEITDQVHNGVLSIDNPPAYFMLGVYFPMPNRGGDVGLVYRQCFGPVTNLYFVAKDPTNPDDGWDWLYAKSGKYSASPTQ
Ga0209006_1062424623300027908Forest SoilFGVATDGTTSFSGGGVHEITDQVHNGVFSIDNPPAYFMLGVYFPTPNRGGDVGLVYRQCFGPVTNLYFVAKDPANPDDGWDWLYAKSGKYAASPAP
Ga0255348_100653113300028268SoilKNSCSIALHVVHAGTMAPLGRKFQVAIDTTYNQDAPNPPSYQFGVGNDGTSTYKGGGLHEITNQIRNGMLRIDNPPAYFNLSMNIVAPGHGAGIGLVYRQCFAPVTNLYYIVKDPDDLSKGADFLYAKSGKYAPAPSK
Ga0255348_104001313300028268SoilDSPTPPHYEFGSGTDGTSTFAGAGLHEITSQIHSDILRIDNPPAYFNLSTNFIQPGRGAGIGLIYRQCFAPTTMLYFVLKDPNDPGAGGDFLYAKSGKYSTVPTR
Ga0302151_1021988023300028562BogQAAIDTSFDEAHPPAYTFGVGDDGTSTFSGGHIHEITSQIHNDMLRIDNPPINFNLALNVKQPHRGTADTEIYRKCFAPVTMLYYVMKDPTDIGAGADFLYAKAGKYAAVPTH
Ga0302145_1009571023300028565BogYTFGVGKDGTSTYSGGGLHEITSQVHNGILRIDNPPAYFNLSVNIPTPNHGAGVGLVYRQCFAPVTNLYYVVKDPADMSKGADFLFAKSGKYAAAH
Ga0302152_1028626613300028572BogTMAPINRKFQVAIDTTYNQNNPTPPSYTFGVGKDGTSTYSGGGLHEITSQVRNGILRIDNPPAYFNLSVNIPTPNQGAGVGLVYRQCFAPVTNLYYVVKDPADMSKGADFLFAKSGKYAAAH
Ga0302267_1012273533300028745BogKYQAAIDTTYNQDAPTPRHYEFGVGNDGTSTYAGGGLHEISNQVHDGMLRLDNPPAYFMFGVNIPTPNRGADVGLIYRQCFAPVTMLYYVIKDPSNPADCGDWLYAKAGKYASVPAR
Ga0302267_1019669323300028745BogSANSCTIVLRVVNPKTMAPSMRRWQAAIDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0302233_1011317323300028746PalsaAKTMAPVTRRWQFAIDTTYNQDDPNPPHYEFGVGNDGTSTFSGGHIHELTSQIHNDMLRIDNPPAYFNTAMNVVQPGHGTGTGLIYRQCFAPVTMLYYVLKDPADIGKGADWLYAKAGKYAAVPAH
Ga0302219_1039336623300028747PalsaRVVAAKTMAPVTRPWQFAIDTTFNQDHPSPYTFGVGNDGTSTFSGGSIHEISNQIHNDMLRIDNPPATFYKAMNVKQPGRGTEAGMIYRQCFAPVTMLYYVMKDPADIGKGADWLYAKAGKYAALPAH
Ga0302219_1040636913300028747PalsaGVGDDGTATFSGGAIHEITNQLRNGMLRVDNPPPYFTFTVNVPTPHEGAAGGYIYRQCFAPVTNLYYILKDPSDPAKGTDFLYAKSGKYAAAPAH
Ga0302156_1005093313300028748BogAIDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0302156_1049608413300028748BogPTPPQYVFGVGRDGTSTYAGGGLHEITNQVRDGVLRIDNPPAYFMLGVNIPTPNEGANVGLIYRQCFAPVTVLYDIIKDPSDPGKGADWLYAKAGKYATAPAH
Ga0302202_1000837413300028762BogVAIDTTYDQDSPTPPSYIFGVRPDGTSTYSGGGLHEITSQVRNGSLRIDNPPAYFNLSVNIPTPNRGAGIGLVYRQCFAPVTNLYYVVNDPEDMSKGADFLYAKSGKYAAVP
Ga0302202_1028983323300028762BogAPPAYTFGVGDDGTSTFSGGGIHEITSQIHNDLLRIDDPPAYFNLAMNVLQPHHGTGDGLVYRQCFAPVTMLYYVLKDASDPGQGGDYLYAKAGKYAAVPSR
Ga0302234_1042195423300028773PalsaTMAPVTRRWQLAIDTTYNQDDPNPPHYEFGVGNDGTSTFSGGHIHELTSQIHNDMLRIDNPPAYFNTAMNVVQPGHGTGTGLIYRQCFAPVTMLYYVLKDPADIGKGADWLYAKAGKYAAVPAH
Ga0302266_1016789523300028779BogGSKNSCSILVHVVAAKTMAPLNRHFQAAIDTTYNQDSPTAPHYTFGVGEDGTSTYSGGGLHEITNQIKNYTLLIDHPPAYFNFGINVPSPHYGASAGLIYRQCFAPVTNLYYIVKDPTTPGAGGDYLYAKSGKYATPPSH
Ga0302189_1005788523300028788BogTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0302189_1039925213300028788BogPVTRKWQAAIDTTYNVDHPSPYTFGVGDDGTSTFSGGGIHEITSQIHNDMLRIDAPPAYFNLAMNVLQPHHGTGDGLIYRQCFAPVTMLYYVLKDPSDPGQGGDYLYAKGGKYAAVPTH
Ga0302157_1032696823300028813BogNATPPSYTFGVGKDGTSTYSGGGLHEITSQVRNGILRIDNPPTYFNLSVNIPTPNHGAGVGLVYRQCFAPVTNLYYVVKDPADMSKGADFLFAKSGKYAAAH
Ga0302199_103428713300028860BogNPTPPSYTFGVGKDGTSTYSGGGLHEITSQVHNGILRIDNPPAYFNLSVNIPTPNHGAGVGLVYRQCFAPVTNLYYVVKDPADMSKGADFLFAKSGKYAAAH
Ga0302199_113846023300028860BogMAPSTRRWQAAIDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPA
Ga0302199_117510813300028860BogNPPAYTFGVGDDGTSTFSGGHIHEITSQIHNDMLRIDNPPQAFNLALNVMQPHRGTADTTIYRQCFAPVTMLYYIMKDPTDIGAGADFLYAKAGKNAAAPAH
Ga0302278_1002887713300028866BogYDQDSPTPPSYIFGVRPDGTSTYSGGGLHEITSQVHNGTLRIDNPPAYFNLSVNIPTPNRGAGIGLVYRQCFAPVTNLYYVVNDPEDMSKGADFLYAKSGKYAAVP
Ga0302278_1047470113300028866BogASYGPGSANSCSIVVKVVAAKTMAPLNRHYQAAIDTTYDQNATPPPHYEFGVGNDGTSTYAGGGLHEITSQVHNGELRIDNPPAYFMFGINIPTPNRGADVGLIYRQCFAPVTTLYYVVKDPANPGDGGDYLYAKAGKYAGAH
Ga0302197_1016053613300028873BogTYNQDAPTPPHYEFGTGRDGTSTFKGGGIHEITSQIHNDMLRIDNPPAYFNLALNVIQPGHGTGIGLVYRQCFAPVTMLYYVMKDPNDIGAGADYLYAKAGKFAAVPTH
Ga0302154_1037981513300028882BogSCSIIIRVVAAKTMAPVTRAWQAAIDTSFDEAHPPAYTFGVGDDGTSTFSGGHIHEITSQIHNDMLRIDNPPINFNLALNVKQPHRGTADTEIYRKCFAPVTMLYYVMKDPTDIGAGADFLYAKAGKYAAVPTH
Ga0311368_1113613323300029882PalsaHPPPYTFGVGDDGTATFSGGAIHEITNQVRNGMLRVDNPPPYFTFTVNVPTPHEGAAGGYIYRQCFAPVTNLYYILKDPSDPAKGTDFLYAKSGKYAAAPAH
Ga0311327_1075378113300029883BogPGSKNSCSIVVRVVAAKTMAPVTRRWQFAIDTTYNQDDPNPPHYEFGVGNDGASTFSGGHIHEITSQIHNDMLRIDNPPAYFNVAMNVVQPGHGAATGFIYRQCFAPVTMLYYVLKDPNDPGQGADWLYAKSGKYAAVPAH
Ga0311327_1083504413300029883BogGVGEDGTSTYSGGGLHEITNQIKNYTLLIDHPPAYFNFGINVPSPHYGASAGLIYRQCFAPVTNLYYIVKDPTTPGAGGDYLYAKSGKYATPPSH
Ga0311341_1026464913300029908BogNATPPPHYEFGVGNDGTSTYAGGGLHEITNQVHNGELRIDNPPAYFMFGINIPTPNRGADVGLIYRQCFAPVTTLYYVVKDPANPGDGGDYLYAKAGKYAGAH
Ga0311341_1048215613300029908BogAIDTTYDQNNATPPSYTFGVGKDGTSTYSGGGLHEITSQVRNGILRIDNPPTYFNLSVNIPTPNHGAGVGLVYRQCFAPVTNLYYVVKDPADMSKGADFLFAKSGKYAAAH
Ga0311341_1074028423300029908BogMAPVTRAWQAAIDTSFDEAHPPAYTFGVGDDGTSTFSGGHIHEITSQIHNDMLRIDNPPINFNLALNVKQPHRGTADTEIYRKCFAPVTMLYYVMKDPTDIGAGADFLYAKAGKYAAVPT
Ga0311361_1032885723300029911BogNAKTMAPINRKWQAAIDTTYNQDSPTPPHYEFGSGTDGTSTFAGAGLHEITSQIHSDILRIDNPPAYFNLSTNFIQPGRGAGIGLIYRQCFAPTTMLYFVLKDPNDPGAGGDFLYAKSGKYSTVPTR
Ga0311361_1066267423300029911BogWQAAIDTTYNVDAPPAYTFGVGDDGTSTFSGGGIHEITSQIHNDLLRIDNPPAYFNLAMNVLQPHHGTGDGLVYRQCFAPVTMLYYVLKDASDPGQGGDYLYAKAGKYAAVPSR
Ga0311361_1133964113300029911BogTATYSGGGLHEITSQIRNFTLRIDNPPPYFTFGINIPTPHRGADAGLIYRQCFAPVTNLYYVIKDPANPADGGDYLYAKSGKYAAAK
Ga0311361_1150591613300029911BogPINRKFQAAIDTTYNQDAPTPPQYVFGVGRDGTSTYAGGGLHEITNQVRDGVLRIDNPPAYFMLGVNIPTPNEGANVGLIYRQCFAPVTVLYDIIKDPSDPGKGADWLYAKAGKYATAPA
Ga0311362_1019328333300029913BogAAGPGSKNSCSIIIRVVAAKTMAPVTRRWQAAIDTTVNGATTPPYTFGVGDDGTAAFSGGGIHEVTSQIHNDMLRIDNPPDHFDLALNVVQPHRGTADTLIYRQCFAPVTMLYYIMKDPTDIGAGADFLYAKAGKNAAAPAH
Ga0311362_1117497113300029913BogPLNRHFQAAIDTTYNQDDPHPPGYTFGVGNDGTSTYAGGGLHEITNQIKNFTLRLDNPPAYFNFGINIPTPHYGASAGLIYRQCFAPVTNLYYIVRDPANPGNTSDYLYAKSGKYATPPS
Ga0311359_1004694113300029914BogVVAAKTMAPITRRWQVAIDTTYNVDSPPAYQFGVGNDGTATFSGGGLHEITSQIRNDMVRVDNPPAYFNLSVNVVQPGNGAGSGLIYRQCFGPVTMLYYILKDPNDPGQGGDFLYAKSGKYASVPAR
Ga0311359_1013076133300029914BogMAPVTRRWQFAIDTTYNQDDPNPPHYEFGVGNDGASTFSGGHIHEITSQIHNDMLRIDNPPAYFNVAMNVVQPGHGAATGFIYRQCFAPVTMLYYVLKDPNDPGQGADWLYAKSGKYAAVPAH
Ga0302148_101588913300029916BogAPINRKFQVAIDTTYNQNNPTPPSYTFGVGKDGTSTYSGGGLHEITSQVRNGILRIDNPPTYFNLSVNIPTPNHGAGVGLVYRQCFAPVTNLYYVVKDPADMSKGADFLFAKSGKYAAAH
Ga0311326_1032844623300029917BogIDTTYNVDSPPAYQFGVGNDGTATFSGGGLHEITSQIRNDMVRVDNPPAYFNLSVNVVQPGNGAGSGLIYRQCFGPVTMLYYILKDPNDPGQGGDFLYAKSGKYASVPAR
Ga0302142_110107013300029920BogNRKFQVAIDTTYDQNNATPPSYTFGVGKDGTSTYSGGGLHEITSQVRNGILRIDNPPTYFNLSVNIPTPNHGAGVGLVYRQCFAPVTNLYYVVKDPADMSKGADFLFAKSGKYAAAH
Ga0302142_115729213300029920BogSIVIRVVAAKTMAPVTRRWQAAIDTTYNQDNPTPPHYEFGTGRDGSSTFAGGGIHEITSQIHNDMLRIDNPPAYFNLATNVVQPGHGTGIGLVYRQCFAPVTMLYYVMKDPNDIGAGADFLYAKAGKYAAVPTH
Ga0311363_1069681723300029922FenRKWQAAIDTTYNQDSPTPPHYEFGSGTDGTSTFAGAGLHEITSQIHSDILRIDNPPAYFNLSTNFIQPGRGAGIGLIYRQCFAPTTMLYFVLKDPNDPGAGGDFLYAKSGKYSTVPTR
Ga0311328_1036341313300029939BogFQAAIDTTYNQDSPTAPHYTFGVGEDGTSTYSGGGLHEITNQIKNYTLLIDHPPAYFNFGINVPSPHYGASAGLIYRQCFAPVTNLYYIVKDPTTPGAGGDYLYAKSGKYATPPSH
Ga0311330_1107840713300029945BogVLHVVAAKTMAPINRKFQVAIDTTYNQNNPTPPSYTFGVGKDGTSTYSGGGLHEITSQVRNGILRIDNPPAYFNLSVNIPTPNQGAGVGLVYRQCFAPVTNLYYVVKDPADMSKGADFLFAKSGKYAAAH
Ga0311371_1017360443300029951PalsaASGPQNSCTVVVRVVQAKTMAPVTKKFQIAIDTSFNVKSPSPYTFGVGLDGTATYSGGGVHEVTNFVHNGMLSIPNPPPYFMLGVNIPTPHIGADLNLIYRQCFAPITVLYRLVNDVNDPQKGGDWLWAKAGKYATVPAAH
Ga0311346_1059630123300029952BogCSIVIRVVAAKTMAPVSRKWQAAIDTTYNVDAPPAYTFGVGDDGTSTFSGGGIHEITSQIHNDLLRIDNPPAYFNLAMNVLQPHHGTGDGLVYRQCFAPVTMLYYVLKDASDPGQGGDYLYAKAGKYAAVPSR
Ga0311343_1011428653300029953BogPGSKNSCSIVIRVVAAKTMAPVTRRWQAAIDTTYNQDNPTPPHYEFGTGRDGSSTFAGGGIHEITSQIHNDMLRIDNPPAYFNLATNVVQPGHGTGIGLVYRQCFAPVTMLYYVMKDPNDIGAGADFLYAKAGKYAAVPTH
Ga0311343_1142838013300029953BogTMAPVTRKWQAAIDTTYNVDHPSPYTFGVGDDGTSTFSGGGIHEITSQIHNDMLRIDAPPAYFNLAMNVLQPHHGTGDGLIYRQCFAPVTMLYYVLKDPSDPGQGGDYLYAKGGKYAAVPTH
Ga0311331_1050388513300029954BogNSCSILVHVVAAKTMAPLNRHFQAAIDTTYNQDSPTAPHYTFGVGEDGTSTYSGGGLHEITNQIKNYTLLIDHPPAYFNFGINVPSPHYGASAGLIYRQCFAPVTNLYYIVKDPTTPGAGGDYLYAKSGKYATPPSH
Ga0311342_1057067713300029955BogGPGSKNSCSIIIRVVAAKTMAPVTRRWQAAIDTTVNGATTPPYTFGVGDDGTAAFSGGGIHEVTSQIHNDMLRIDNPPDHFDLALNVVQPHRGTADTLIYRQCFAPVTMLYYIMKDPTDIGAGADFLYAKAGKNAAAPAH
Ga0311342_1108341023300029955BogPGSKAGCSIALHVVHAGTMAPLNRRYQVAIDTTYNQDAPNPPHYEFGSGTDGTSTFKGGGLHEITSQIRNGVLRIDHPPAYFNLSTNIVQPGRGAGIGLIYRQCFAPVTNLYYIVKDPDDLSKGADFLYAKSGKYAAQ
Ga0311342_1111931813300029955BogNSCSILVRVVGAKTMAPINRKFQGAIDTTYNQDAPTPPHYVFGVGNDGTSTYAGGGLHEITNQVHDGMLRIDNPPAYFNFGINIPTPNHGADVGLIYRQCFAPVTMLYYILKDPNNPADGGDWLYAKAGKYAAVPTH
Ga0302150_1023436623300029956BogSCSIVVRVVAAKTMAPLNRHYQAAIDTTYDQNATPPPHYEFGVGNDGTSTYAGGGLHEITSQVHNGELRIDNPPAYFMFGINIPTPNRGADVGLIYRQCFAPVTTLYYVVKDPANPGDGGDYLYAKAGKYAGAH
Ga0311332_1149482623300029984FenFQVAIDTTYDQESPNPPSYEFGVGDDGTATFKGGGIHEITSQIHNGILRIDNPPAYFNLSLNIVKPGSGAGMGLIYRQCFAPQTVLLYIVKDPANPGAGGDWLYAKSGKYSTVPAH
Ga0302190_1008206923300029988BogPPSYTFGVGKDGTSTYSGGGLHEITSQVHNGILRIDNPPAYFNLSVNIPTPNHGAGVGLVYRQCFAPVTNLYYVVKDPADMSKGADFLFAKSGKYAAAH
Ga0302276_1000569293300029992BogCSIILHVVAAKTMAPLNRKFQVAIDTTYDQDSPTPPSYIFGVRPDGTSTYSGGGLHEITSQVHNGTLRIDNPPAYFNLSVNIPTPNRGAGIGLVYRQCFAPVTNLYYVVNDPEDMSKGADFLYAKSGKYAAVP
Ga0311339_1009188333300029999PalsaPVTRRWQLAIDTTYNQDDPNPPHYEFGVGNDGTSTFSGGHIHELTSQIHNDMLRIDNPPAYFNTAMNVVQPGHGTGTGLIYRQCFAPVTMLYYVLKDPADIGKGADWLYAKAGKYAAVPA
Ga0302186_1024550913300030004BogANSCTIVLRVVNPKTMAPSTRRWQAAIDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0302270_1034879013300030011BogPVTRRWQAAIDTTVNGATTPPYTFGVGDDGTAAFSGGGIHEVTSQIHNDMLRIDNPPDHFDLALNVVQPHRGTADTLIYRQCFAPVTMLYYIMKDPTDIGAGADFLYAKAGKNAAAPAH
Ga0302195_1005375123300030051BogIDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0302176_1005311823300030057PalsaMAPINRHFQAAIDTTYDQNSPTPPHYEFGVGEDGTATFSGGGLHEITNQVHNGMLRIDNPPEYFMLSVNVPTPHEGAGSALIYRQCSAPVTNLYYVLKDPSDPGKGTDYLYAKSGKYAAVPAH
Ga0311353_1119730623300030399PalsaGSNNSCSIVIRVVAAKTMAPVTRRWQFAIDTTFNQDNPPHYEFGVGNDGTSTFSGGQIHEITSQIHNDMLRIDNPPAYFYKAMNVIQPNRGTEAGMIYRQCFAPVTMLYYVMKDPTDIGKGADWLYAKAGKYAVVPAH
Ga0302194_1020797423300030506BogDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0302192_1004157713300030507BogRVVNPKTMAPSTRRWQAAIDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0302192_1028534013300030507BogHVVAAKTMAPINRKFQVAIDTTYNQDNPTPPSYTFGVRTDGTSTYSGGGLHEITSQVRNGILRIDNPPAYFNLSVNIPTPNHGAGVGLVYRQCFAPVTNLYYVVQDPGDMSKGADFLFAKSGKYAVAH
Ga0302185_1009082123300030508BogVSAKTMAPINRKFQVAIDTTYNQNNPTPPSYTFGVGKDGTSTYSGGGLHEITSQVRNGILRIDNPPTYFNLSVNIPTPNHGAGVGLVYRQCFAPVTNLYYVVKDPADMSKGADFLFAKSGKYAAAH
Ga0302185_1031550813300030508BogNSCSILVRVVAARTMAPISRKYQAAIDTTYNQDAPTPRHYEFGVGNDGTSTYAGGGLHEISNQVHDGMLRLDNPPAYFMFGVNIPTPNRGADVGLIYRQCFAPVTMLYYVIKDPSNPADCGDWLYAKAGKYASVPAR
Ga0302275_1058486613300030518BogMAPINRKWQAAIDTTYNQDSPTPPHYEFGSGTDGTSTFAGAGLHEITSQIHSDILRIDNPPAYFNLSTNFIQPGRGAGIGLIYRQCFAPTTMLYFVLKDPNDPGAGGDFLYAKSGKYSTVPTR
Ga0302193_1032480923300030519BogDPHPPGYTFGVGNDGTSTYAGGGLHEITNQIKNFTLRLDNPPAYFNFGINIPTPHYGASAGLIYRQCFAPVTNLYYIVRDPANPGNTSDYLYAKSGKYATPPSH
Ga0302193_1036688323300030519BogIDTSFDEAHPPAYTFGVGDDGTSTFSGGHIHEITSQIHNDMLRIDNPPINFNLALNVKQPHRGTADTEIYRKCFAPVTMLYYVMKDPTDIGAGADFLYAKAGKYAAVPTH
Ga0311372_1234812513300030520PalsaAAKTMAPLNRKFQAGIDTTYNQDDPTPPHYVFGVGEDGTSTYAGGGLHEITNQIRNYTIRIDNPPAYFNFGINIPTPHRGASVGLIYRQCFAPVTNLYYVIKDPANPADGGDWLYAKAGKYATTPPH
Ga0311357_1143937613300030524PalsaHYEFGVGEDGTATFSGGGLHEITNQVHNGMLRIDNPPEYFMLSVNVPTPHEGAGSALIYRQCSAPVTNLYYVLKDPSDPGKGTDYLYAKSGKYAAVPAH
Ga0311356_1039739913300030617PalsaGLDGTATYSGGGVHEVTNFVHNGMLSIPNPPPYFMLGVNIPTPHIGADLNLIYRQCFAPITVLYRLVNDVNDPQKGGDWLWAKAGKYATVPAAH
Ga0302316_1018847213300030646PalsaPHYEFGVGNDGTSTFSGGHIHELTSQIHNDMLRIDNPPAYFNTAMNVVQPGHGTGTGLIYRQCFAPVTMLYYVLKDPADIGKGADWLYAKAGKYAAVPAH
Ga0311345_1033351723300030688BogGSKNSCSIVIRVVAAKTMAPVSRKWQAAIDTTYNVDAPPAYTFGVGDDGTSTFSGGGIHEITSQIHNDLLRIDNPPAYFNLAMNVLQPHHGTGDGLVYRQCFAPVTMLYYVLKDASDPGQGGDYLYAKAGKYAAVPSR
Ga0311345_1037950223300030688BogKTMAPVTRAWQAAIDTSFDEAHPPAYTFGVGDDGTSTFSGGHIHEITGQIHNDTLRIDNPPINFNLALNVKQPHRGTADTEIYRKCFAPVTMLYYIMKDPNDIGAGADFLYAKAGKYAVAPTK
Ga0302313_1005956723300030693PalsaWQFAIDTTYNQDDPNPPHYEFGVGNDGTSTFSGGHIHELTSQIHNDMLRIDNPPAYFNTAMNVVQPGHGTGTGLIYRQCFAPVTMLYYVLKDPADIGKGADWLYAKAGKYAAVPAH
Ga0302310_1012544513300030737PalsaVIRVVAAKSMAPITRKWQAAIDTTYNVDHPSPYTFGVGEDGTSTFSGGSIHEITSQIHNDMLRIDNPPVYFNLALNVLQPHHGTGDTLIYRQCFAPVTMLYYILKDPSDPGQGGDYLYAKAGKYAAVPTH
Ga0302180_1006622513300031028PalsaPGSKNSCSIVVRVVAAKTMAPVTRRWQFAIDTTYNQDDPNPPHYEFGVGNDGTSTFSGGHIHELTSQIHNDMLRIDNPPAYFNTAMNVVQPGHGTGTGLIYRQCFAPVTMLYYVLKDPADIGKGADWLYAKAGKYAAVPAH
Ga0302323_10082105023300031232FenSLILRVVQAKTMAPIADKFQVAIDTTYDQESPNPPSYEFGVGDDGTATFKGGGIHEITSQIKNGMLRIDNPPAYFNLSLNIVKPGSGAGVGLIYRQCFAPQTVLLYIVRDPANPGAGGDWLYSKSGKYSTAPAH
Ga0302325_1225287613300031234PalsaTFGVGLDGTATYSGGGVHEVTNFVHNGMLSIPNPPPYFMLGVNIPTPHIGADLNLIYRQCFAPITVLYRLVNDVNDPQKGGDWLWAKAGKYATVPAAH
Ga0302325_1306243513300031234PalsaAKTMAPVTRPWQFAIDTTFNQDHPSPYTFGVGDDGTSTFSGGQIHEISSQIHNDMLRIDNPPAYFYKAMNVKQPHHGTEAGMLYRQCFAPVTMLYYVMKDPADIGKGADWLYAKSGKYAAVPAH
Ga0302324_10210091323300031236PalsaHYEFGVGNDGTATFSGGGLHEITNQIHNGMLRIDHVPSYFNLSMNIPQPNHGAGMALIYRLCVAPVTVLYYVVKDPADPGQGGDWLYAKAGKYAAVPAQ
Ga0302324_10227959323300031236PalsaAAIDTTYDQNNPNPPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIDNPPAYFNFAMNVMQPNHGTAIGMVYRQCFAPVTMLYYVLKDPNDVGAGADWLYAKAGKYAAVPTH
Ga0302318_1004595713300031258BogTTYDQDSPTPPSYIFGVRPDGTSTYSGGGLHEITSQVHNGTLRIDNPPAYFNLSVNIPTPNRGAGIGLVYRQCFAPVTNLYYVVNDPEDMSKGADFLYAKSGKYAAVP
Ga0302187_1001055883300031259BogPHYEYGVGTDGTSTFAGGGLHEITSQIHNDMLRIENPPAYFNLAINVVTPGHGAGTGLVYRKCFAPVTMLYWVLNDPNGADGDMVYAKAGKYAAAPAK
Ga0302140_1013487443300031261BogVVRVVAAKTMAPLNRHYQAAIDTTYDQNATPPPHYEFGVGNDGTSTYAGGGLHEITNQVHNGELRIDNPPAYFMFGINIPTPNRGADVGLIYRQCFAPVTTLYYVVKDPANPGDGGDYLYAKAGKYAGAH
Ga0302140_1090311513300031261BogRKFQGAIDTTYNQDAPTPPHYVFGVGNDGTSTYAGGGLHEITNQIHDGMLRIDNPPAYFNFGINIPTPNHGADVGLIYRQCFAPVTMLYYILKDPNNPADGGDWLYAKAGKYAAVPTH
Ga0302140_1108794813300031261BogVVAAKTMAPVTRRWQAAIDTTYNQDDPNPPHYEFGVGNDGTSSFKGGGLHEITSQIYNDLLRIDNPPAYFNLALNVVQPGHGTGIGLIYRQCFAPVTMLYYVLKDPNDPGAGGDYLYAKAGKYAAVPAH
Ga0310686_11056296813300031708SoilDGTTSFSGGGVHEITDQVHNGVFSIDNPPAYFMLGVYFPTPNRGGDVGLVYRQCFGSVTNLYFVAKDPTNPDDGWDWLYAKSGKYAAPPAQ
Ga0310686_11662862413300031708SoilVAIDTTYNQGNPTPPSYTFGVGNDGTATYSGGGLHEITSQIRNSTLRIDNPPAYFNLSVNIPTPNHGAGIGLVYRQCFAPVTNLYYVVKDPDDMGKGADFLFAKAGKYAAAP
Ga0302319_1131469813300031788BogAKTMAPLNRHFQAAIDTTYNQDSPTAPHYTFGVGEDGTSTYSGGGLHEITNQIKNYTLLIDHPPAYFNFGINVPSPHYGASAGLIYRQCFAPVTNLYYIVKDPTTPGAGGDYLYAKSGKYATPPSH
Ga0302319_1145905423300031788BogNQDAPTPPHYVFGVGDDGTSTYSGGGLREITNQVHNGMLRIDNPPAYFMLGVNIPTPHEGADVGLIYRQCFAPVTVLYDIVKDPSDPGKGNDWLYAKAGKYAAVPAH
Ga0307478_1047395213300031823Hardwood Forest SoilTFGVATDGTTSFSGGGVHEITDQVHNGVFRIDNPPAYFMLGVYFPTPNRGGDVSLVYRQCFGPVTNLYFVAKDPTNPDDGWDWLYAKSGKYAAPPAR
Ga0302315_1039737823300031837PalsaPNPPHYEFGVGNDGTSTFSGGHIHELTSQIHNDMLRIDNPPAYFNTAMNVVQPGHGTGTGLIYRQCFAPVTMLYYVLKDPADIGKGADWLYAKAGKYAAVPAH
Ga0326728_1072091523300033402Peat SoilTYSGGGLHEITNQIHNGTLRIDNPPAYFMFGVNIPTPHRGADVGLIYRHCFAPVTMLYYVVKDPDNPADGGDWLYAKAGKFATAPAP
Ga0334804_089732_470_8113300033818SoilAIDTTYNQDAPTPPHYEFGTGRDGTSTFKGGGIHEITSQIHNDMLRIDNPPAYFNLALNVIQPGHGTGIGLVYRQCFAPVTMLYYVMKDPNDIGAGADYLYAKAGKFAAVPTH
Ga0334804_148112_247_5823300033818SoilDTTYDQNNPTPPHYEFGVGNDGTSTYSGGGLHEITNQIHNGMLRIDNPPAYFMFGVNIPTPNHGADVGLIYRQCFAPVTMLYYVVKDPANPADGGDWLYAKSGKYAVPPTQ
Ga0334840_177549_2_3253300033824SoilNQDSPNPPHYVFGVGNDGTSTYSGGGLHEITNQVHNGMLRIDNPPAYFNLGVNIPTPNHGADVGLIYRQCFAPTTMLYFVVKDPSNPANGGDWLYAKAGKYAALPAH
Ga0334790_064745_7_3783300033887SoilMAPINRHFQAAIDTTYNQDAPTPPHYVFGVGDDGTSTYSGGGLREITNQVHNGMLRIDNPPAYFMLGVNIPTPHEGAATGLIYRQCFAPVTVLYDIVKDPSDPGKGTDWLYAKAGKYAAVPAH
Ga0334811_071437_539_9043300033891SoilMAPITRRWQAAIDTTYNMDSPPAYSFGVGNDGTATFSGGGLHEITSQIHNDMLRLDNPPAYFNLGMNVVQPGHGAGVGLIYRQCFAPVTMLYYVLKDPNDPGQGGDFLYAKSGKYASVPA
Ga0370515_0180749_521_8863300034163Untreated Peat SoilMAPLNRHYQAAIDTTYDQSNPPHYIFGVATDGTTTFSGGGVHEITDQVHNGVLRIDNPPAYFMLGVYFPTPNRGGDVNLVYRQCFGPVTNLYFVAKDPTNPDDGWDWLYAKSGKYAAPPA
Ga0370515_0302945_354_6743300034163Untreated Peat SoilYDQNNPTPPSYTFGVGKDGTATYSGGGLHEITSQVRNGTLRIDNPPAYFNLSVNIPTPNHGAGVGLVYRQCFAPVTNLYYVVKDPNDMGKGADFLFAKSGKYATAH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.