Basic Information | |
---|---|
Family ID | F036482 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 170 |
Average Sequence Length | 47 residues |
Representative Sequence | VFASAGFSDVTITDRFDCFAGTTKERTARRYGVVGVNLSARRDA |
Number of Associated Samples | 140 |
Number of Associated Scaffolds | 170 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 76.92 % |
% of genes near scaffold ends (potentially truncated) | 28.82 % |
% of genes from short scaffolds (< 2000 bps) | 77.65 % |
Associated GOLD sequencing projects | 130 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.61 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.471 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.823 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.176 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.647 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.72% β-sheet: 25.00% Coil/Unstructured: 65.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 170 Family Scaffolds |
---|---|---|
PF13847 | Methyltransf_31 | 31.76 |
PF08241 | Methyltransf_11 | 17.06 |
PF13649 | Methyltransf_25 | 5.88 |
PF02635 | DrsE | 4.12 |
PF00753 | Lactamase_B | 4.12 |
PF07690 | MFS_1 | 4.12 |
PF12847 | Methyltransf_18 | 2.94 |
PF01152 | Bac_globin | 2.94 |
PF01206 | TusA | 2.35 |
PF14534 | DUF4440 | 1.18 |
PF03602 | Cons_hypoth95 | 0.59 |
PF12704 | MacB_PCD | 0.59 |
PF02687 | FtsX | 0.59 |
PF03466 | LysR_substrate | 0.59 |
PF00126 | HTH_1 | 0.59 |
PF12833 | HTH_18 | 0.59 |
PF00702 | Hydrolase | 0.59 |
PF03795 | YCII | 0.59 |
PF03551 | PadR | 0.59 |
PF13489 | Methyltransf_23 | 0.59 |
PF08281 | Sigma70_r4_2 | 0.59 |
PF04055 | Radical_SAM | 0.59 |
PF12680 | SnoaL_2 | 0.59 |
PF01738 | DLH | 0.59 |
PF13177 | DNA_pol3_delta2 | 0.59 |
PF00271 | Helicase_C | 0.59 |
PF12779 | WXXGXW | 0.59 |
PF12146 | Hydrolase_4 | 0.59 |
PF00005 | ABC_tran | 0.59 |
PF14742 | GDE_N_bis | 0.59 |
PF05175 | MTS | 0.59 |
PF00403 | HMA | 0.59 |
PF05974 | DUF892 | 0.59 |
PF02656 | DUF202 | 0.59 |
PF13181 | TPR_8 | 0.59 |
PF14499 | DUF4437 | 0.59 |
PF01022 | HTH_5 | 0.59 |
COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
---|---|---|---|
COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 2.94 |
COG0425 | Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 2.35 |
COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.59 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.59 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.59 |
COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.59 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.59 |
COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.59 |
COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.59 |
COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.59 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.47 % |
Unclassified | root | N/A | 13.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000363|ICChiseqgaiiFebDRAFT_11296895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 1011 | Open in IMG/M |
3300000890|JGI11643J12802_12051450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1284 | Open in IMG/M |
3300000956|JGI10216J12902_101588951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Gordoniaceae → Gordonia → Gordonia rhizosphera | 1168 | Open in IMG/M |
3300000956|JGI10216J12902_116460634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1003 | Open in IMG/M |
3300001431|F14TB_100730381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1409 | Open in IMG/M |
3300002122|C687J26623_10039507 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300002911|JGI25390J43892_10150096 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300003312|P12013IDBA_1000365 | All Organisms → cellular organisms → Bacteria | 31645 | Open in IMG/M |
3300003312|P12013IDBA_1074575 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 669 | Open in IMG/M |
3300003324|soilH2_10176492 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
3300003990|Ga0055455_10020702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1610 | Open in IMG/M |
3300003999|Ga0055469_10291274 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300004114|Ga0062593_101048797 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300004157|Ga0062590_102705000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300004463|Ga0063356_102816533 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300004463|Ga0063356_103156034 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300004479|Ga0062595_100817678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
3300004643|Ga0062591_102335843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300005175|Ga0066673_10419084 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300005294|Ga0065705_10062985 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300005294|Ga0065705_10862903 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300005294|Ga0065705_10932340 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005295|Ga0065707_10145401 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
3300005329|Ga0070683_100811252 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300005332|Ga0066388_100106753 | All Organisms → cellular organisms → Bacteria | 3282 | Open in IMG/M |
3300005332|Ga0066388_100708976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1612 | Open in IMG/M |
3300005336|Ga0070680_100208348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1649 | Open in IMG/M |
3300005365|Ga0070688_100674232 | Not Available | 798 | Open in IMG/M |
3300005441|Ga0070700_101830776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300005445|Ga0070708_100363124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1365 | Open in IMG/M |
3300005467|Ga0070706_100578878 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300005468|Ga0070707_100932373 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300005471|Ga0070698_100319221 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
3300005471|Ga0070698_100971612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
3300005518|Ga0070699_100033999 | All Organisms → cellular organisms → Bacteria | 4406 | Open in IMG/M |
3300005535|Ga0070684_100816164 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300005546|Ga0070696_101055277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
3300005553|Ga0066695_10095431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1819 | Open in IMG/M |
3300005618|Ga0068864_100774070 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300005618|Ga0068864_100938208 | Not Available | 856 | Open in IMG/M |
3300005713|Ga0066905_100038247 | All Organisms → cellular organisms → Bacteria | 2814 | Open in IMG/M |
3300005764|Ga0066903_102175884 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300005833|Ga0074472_11477275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1722 | Open in IMG/M |
3300005843|Ga0068860_100248230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1732 | Open in IMG/M |
3300006034|Ga0066656_10890236 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300006038|Ga0075365_10082653 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
3300006581|Ga0074048_13476454 | Not Available | 1165 | Open in IMG/M |
3300006797|Ga0066659_10222248 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
3300006844|Ga0075428_100180208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2287 | Open in IMG/M |
3300006845|Ga0075421_101072506 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300006845|Ga0075421_101161441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
3300006846|Ga0075430_100569101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 935 | Open in IMG/M |
3300006853|Ga0075420_101794400 | Not Available | 525 | Open in IMG/M |
3300006854|Ga0075425_100000577 | All Organisms → cellular organisms → Bacteria | 34535 | Open in IMG/M |
3300006854|Ga0075425_100965244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 973 | Open in IMG/M |
3300006854|Ga0075425_102163631 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300006865|Ga0073934_10434226 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300006871|Ga0075434_101307318 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300006903|Ga0075426_10027409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4082 | Open in IMG/M |
3300006903|Ga0075426_10089654 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
3300006914|Ga0075436_100189855 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
3300006930|Ga0079303_10469416 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300007004|Ga0079218_13419402 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300009012|Ga0066710_100393143 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
3300009012|Ga0066710_102105433 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300009012|Ga0066710_102899654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300009038|Ga0099829_10986415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
3300009053|Ga0105095_10000462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19694 | Open in IMG/M |
3300009053|Ga0105095_10619369 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300009082|Ga0105099_10579510 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300009093|Ga0105240_10589784 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300009093|Ga0105240_10657345 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300009098|Ga0105245_10610213 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300009148|Ga0105243_10268437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1531 | Open in IMG/M |
3300009176|Ga0105242_10687011 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300009179|Ga0115028_10386243 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300009610|Ga0105340_1001053 | All Organisms → cellular organisms → Bacteria | 12730 | Open in IMG/M |
3300009868|Ga0130016_10007569 | All Organisms → cellular organisms → Bacteria | 18871 | Open in IMG/M |
3300009868|Ga0130016_10870839 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300009873|Ga0131077_11095618 | Not Available | 672 | Open in IMG/M |
3300010047|Ga0126382_12275754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300010304|Ga0134088_10673611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300010336|Ga0134071_10508906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300010359|Ga0126376_12749816 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300010362|Ga0126377_10539615 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300010366|Ga0126379_12073839 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300010366|Ga0126379_12473563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300010397|Ga0134124_10102539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2493 | Open in IMG/M |
3300010398|Ga0126383_10606024 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300010398|Ga0126383_11525041 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300011402|Ga0137356_1001064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4615 | Open in IMG/M |
3300011413|Ga0137333_1037756 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300011423|Ga0137436_1079024 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300011430|Ga0137423_1200349 | Not Available | 598 | Open in IMG/M |
3300011436|Ga0137458_1094235 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300011437|Ga0137429_1128399 | Not Available | 781 | Open in IMG/M |
3300012038|Ga0137431_1086792 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300012172|Ga0137320_1041431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 945 | Open in IMG/M |
3300012204|Ga0137374_10027051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6362 | Open in IMG/M |
3300012350|Ga0137372_10999363 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300012469|Ga0150984_100589047 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300012684|Ga0136614_10263941 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300012917|Ga0137395_10416139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
3300012961|Ga0164302_10562318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
3300012975|Ga0134110_10003605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5661 | Open in IMG/M |
3300012989|Ga0164305_11812233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300013104|Ga0157370_12041983 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300014154|Ga0134075_10359998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300014865|Ga0180078_1024572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 928 | Open in IMG/M |
3300014881|Ga0180094_1155310 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300015356|Ga0134073_10253069 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300015371|Ga0132258_10930494 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
3300017656|Ga0134112_10110424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1038 | Open in IMG/M |
3300017787|Ga0183260_10393009 | Not Available | 923 | Open in IMG/M |
3300018084|Ga0184629_10053750 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
3300018431|Ga0066655_10099166 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
3300025160|Ga0209109_10048072 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
3300025318|Ga0209519_10793069 | Not Available | 501 | Open in IMG/M |
3300025324|Ga0209640_10312988 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300025910|Ga0207684_10376898 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300025913|Ga0207695_10451409 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300025917|Ga0207660_10375806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1142 | Open in IMG/M |
3300025917|Ga0207660_10687138 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300025935|Ga0207709_11280468 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300025942|Ga0207689_10056143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3240 | Open in IMG/M |
3300025944|Ga0207661_10735491 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300025960|Ga0207651_11134096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
3300026116|Ga0207674_10991807 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300026317|Ga0209154_1321251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300027533|Ga0208185_1050284 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300027713|Ga0209286_1002053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6462 | Open in IMG/M |
3300027866|Ga0209813_10232699 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300027886|Ga0209486_10784756 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300027886|Ga0209486_10945752 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300027890|Ga0209496_10343303 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300028041|Ga0247719_1105080 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300028381|Ga0268264_10372704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1365 | Open in IMG/M |
3300028828|Ga0307312_11008183 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300031228|Ga0299914_10497313 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300031228|Ga0299914_10555492 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300031228|Ga0299914_10679543 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300031229|Ga0299913_10346322 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
3300031562|Ga0310886_10006530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4051 | Open in IMG/M |
3300031576|Ga0247727_10825366 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300031716|Ga0310813_10430409 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300031716|Ga0310813_10486712 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300031911|Ga0307412_11042137 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300031965|Ga0326597_11326553 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300032002|Ga0307416_102853521 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300032075|Ga0310890_10780602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 755 | Open in IMG/M |
3300032163|Ga0315281_10014984 | All Organisms → cellular organisms → Bacteria | 10414 | Open in IMG/M |
3300033480|Ga0316620_10574935 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300033486|Ga0316624_10809069 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300034115|Ga0364945_0001338 | All Organisms → cellular organisms → Bacteria | 6837 | Open in IMG/M |
3300034115|Ga0364945_0260439 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300034150|Ga0364933_137593 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.82% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.12% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.53% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.53% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.53% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.35% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.35% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.76% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.76% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.76% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.18% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.18% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.18% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil | 1.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.18% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.18% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.18% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.18% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.18% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.18% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.18% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.59% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.59% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.59% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.59% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.59% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.59% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.59% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.59% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.59% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.59% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300003312 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P1 sample | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300027533 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes) | Environmental | Open in IMG/M |
3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300028041 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-E_D | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiFebDRAFT_112968953 | 3300000363 | Soil | ALLEAELVGVFESAGFTSVRILDRFDCFAGTRKERTAKRYGVVGVNLTATRS* |
JGI11643J12802_120514502 | 3300000890 | Soil | IGVFQSAGFNDVAITHRFDCFAGTTKERTARRYGVVGVNVSAIRGTV* |
JGI10216J12902_1015889514 | 3300000956 | Soil | GALLEAEMIGVFQSAGFASVAITHRYECFVGTTKERTARRYGVVGVNLAAVRGA* |
JGI10216J12902_1047999721 | 3300000956 | Soil | IAGALLEAELVAAFAEGGFEDVRITQRFDCFAATSKERTARRYGVMGVNLSAIRR* |
JGI10216J12902_1164606342 | 3300000956 | Soil | VAFESAGFTQTTITARFDCFAGTTKERTARRYGVVGVNLSAIRSAVDG* |
F14TB_1007303811 | 3300001431 | Soil | VFTPAGFRDVALTSRFDCFAGTTKERTARRYGVVGVNLSAVRITT* |
C687J26623_100395073 | 3300002122 | Soil | MIEAFRSAGFDDPRIVARFDCFAGTSKERTARRYGVMGVNLLAIRAR* |
JGI25390J43892_101500962 | 3300002911 | Grasslands Soil | VFASAGFSDVAITSRFDCFAGTTKERTARRYGVVGVNLCATKSALR* |
P12013IDBA_10003659 | 3300003312 | Ore Pile And Mine Drainage Contaminated Soil | VLAGAGFARIEFGARFDCFAGTTKERTARKYGVLGVNVSAMKA* |
P12013IDBA_10745752 | 3300003312 | Ore Pile And Mine Drainage Contaminated Soil | LPAAELAEVLTQAGFSDVRFHDRFDCFGGTSKERTARKYGVIGINISAMRSGG* |
soilH2_101764922 | 3300003324 | Sugarcane Root And Bulk Soil | MIEVFQNADFDQVAITHRYDCFEGTPKERTARRYGVIGVNLSAVKAGK* |
Ga0055455_100207022 | 3300003990 | Natural And Restored Wetlands | VFASAGFRDVAITQRFDCFAGTTKERTARRFGVAGVNLSAVRSA* |
Ga0055469_102912742 | 3300003999 | Natural And Restored Wetlands | MIEAFEAEGFSARIETRFDCFGGTTKERTARRYGVVGVNVLA |
Ga0062593_1010487972 | 3300004114 | Soil | MIAVFQSAGFASVAITHRYDCFVGTSKERTARRYGVVGMNVSAVRGA* |
Ga0062590_1027050001 | 3300004157 | Soil | MIDVFSAAGFRDVVITHRYDCFVGTTKERTAKRYGVIGVNVSATRS* |
Ga0063356_1028165332 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIGVFQSAGFASVAITHRYECFVGTTKERTARRYGVVGVNVS |
Ga0063356_1031560342 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIGVFQSAGFENVAITHRFDCFAGTSKERTARRYGVVGVNVSAIRGTV* |
Ga0062595_1008176781 | 3300004479 | Soil | AELVAAFAGAGFTDVRITERFDCFEATSKERTARRYGVSGVNLSAIRSR* |
Ga0062591_1023358432 | 3300004643 | Soil | MIDVFNAAGFRDVEITHRYDCFVGTTKERTAKKYGVIGVNVSATRM* |
Ga0066673_104190841 | 3300005175 | Soil | LTAAGFRDLQITHQYECFKGTTKERTAQKFGVIGVNVSGVRA* |
Ga0065705_100629852 | 3300005294 | Switchgrass Rhizosphere | VDTFAAAGFRDVHIVARFDCFAGTSKERTARRYGVGGVNLVATRT* |
Ga0065705_108629032 | 3300005294 | Switchgrass Rhizosphere | TFAAAGFRDVHIVARFDCFAGTSKERIARRYGVGGMNLVATRTERMPVVRR* |
Ga0065705_109323402 | 3300005294 | Switchgrass Rhizosphere | MISVFQSSGFTSVAITHRYECFVGTTKERTARRYGVVGVNVSAVRGM* |
Ga0065707_101454012 | 3300005295 | Switchgrass Rhizosphere | VSAFQSSGFEDVSITHHFDCFVGTTKERTARRYGVVGVNLSAIRSVR* |
Ga0070683_1008112522 | 3300005329 | Corn Rhizosphere | LLEAELVGVFTSAGFSSVAITERFDSFAGTTKERTARRYGVVGANLSAVRPAA* |
Ga0066388_1001067532 | 3300005332 | Tropical Forest Soil | MVHALTAAGFEDVRIVGRFDCFAGTTKERTARQFGVYGVNFSALRS* |
Ga0066388_1007089762 | 3300005332 | Tropical Forest Soil | VFTSAGFDDVAITQRFDCFVGTTKERTARRYGVVGVNLSATKTRP* |
Ga0070680_1002083483 | 3300005336 | Corn Rhizosphere | MMDVFTAAGFRDVRITHRYNCFAGTTKERTAQRYGVIGANVSAIRELA* |
Ga0070688_1006742322 | 3300005365 | Switchgrass Rhizosphere | MISVFQSSGFTSVTITHRYECFVGTTKERTARRYGVVGVNVSAVRGI* |
Ga0070700_1018307761 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAFRSSGFERVELTHRFDCFAGTTKERTARRYGVVGVNLSAIRSAASGRERK* |
Ga0070708_1003631243 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VFASAGFTRPRIVARFDCFAGTSKERTARKYGVVGVNLAAAR* |
Ga0070706_1005788782 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VFASAGFSDVTITDRFDCFAGTTKERTARRYGVVGVNLSARRDA* |
Ga0070707_1009323732 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VFASVGFSDVAITSRFDCFAGTTKERTARRYGVVGVNLAAMKSVAALTL* |
Ga0070698_1003192211 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAFAEAGFEDVRITQRFDCFAATSKERTARRYGVIGVNLSAIRR* |
Ga0070698_1009716121 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LEAELIDVFASAGFSDVTITARFDCFAGTTKERTARRYGVVGVNLSARKDA* |
Ga0070698_1011011222 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RLIAGALLEAELVAAFEEAGFADVRITERFDCFGGTSKETTARRYGVTGANLSAIRK* |
Ga0070699_1000339994 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDVFASAGFGSLAITHRFDCFAGTSKERTARRYGVIGVNLSGVRSAV* |
Ga0070684_1008161643 | 3300005535 | Corn Rhizosphere | MIDVFAAAGFSDVRITQRFDCFVGTTKERTARRYGVIGINLSAKKP* |
Ga0070732_103347252 | 3300005542 | Surface Soil | AGALLEAELVRAFESAGFAHVIITDRFDCFAGTSKESTARRYGVHGVNLSAVHR* |
Ga0070696_1010552773 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | IDVFASAGFTRPRIVARFDCFAGTSKERTARKYGVVGVNLAAAR* |
Ga0066695_100954312 | 3300005553 | Soil | MERLLEAELIDVFASAGFRDVAMTGRFDCSAGTTKERTARRYGVV |
Ga0068864_1007740703 | 3300005618 | Switchgrass Rhizosphere | MISVFQSSGFTSVAITHRYECFVGTTKERTARRYGVVGVNVSAV |
Ga0068864_1009382081 | 3300005618 | Switchgrass Rhizosphere | LEAEMISVFQSSGFTSVTITHRYECFVGTTKERTARRYGVVGVNVSAVRGI* |
Ga0066905_1000382474 | 3300005713 | Tropical Forest Soil | VFTSAGFDEVAITQRFDCFVGTTKERTARRYGVVGVNLSAMKSRP* |
Ga0066903_1021758842 | 3300005764 | Tropical Forest Soil | MAFQSFGFQRVAVTHHFDCFAGTTKEKTARRYGVEGVNLSAVAA* |
Ga0066903_1034221391 | 3300005764 | Tropical Forest Soil | GALLEAELIDVFTSAGFGEVAIARRFDCFVGTVKERTARRFGVIGVNLSALRVERQA* |
Ga0074472_114772753 | 3300005833 | Sediment (Intertidal) | MLGAFESVGFANVRLTHRFDPFGGTTKERTARRYGVIGVNVTATRP* |
Ga0068860_1002482302 | 3300005843 | Switchgrass Rhizosphere | VDAFAAAGFEDVRVVGRFDCFAGTNKERMARRYGVIGVNLSAIRSQRR* |
Ga0081455_109458032 | 3300005937 | Tabebuia Heterophylla Rhizosphere | GALLEAELVAAFASAGFDAPHVVRRFDCFAGTTKERTARRYAVVGVNFLAVRSPER* |
Ga0066656_108902361 | 3300006034 | Soil | VFASAGFTEVAITKRFDCFAGTTKERTARLYGVTGVNLSAVAGNNVWQKFAQFSN* |
Ga0075365_100826535 | 3300006038 | Populus Endosphere | MIDLFNAAGFRDAAITRHFDCFAGTSKERTARRYGVLGVNLLAV* |
Ga0074048_134764542 | 3300006581 | Soil | AFESGGFRAVAITSRFDCFGGTTKERTARRYGVMGVNLSATRSPTA* |
Ga0066659_102222483 | 3300006797 | Soil | VFASAGFCDVAITSRFDCFAGTTNERTARRYGVVGVNLCATKSALR* |
Ga0075428_1001802083 | 3300006844 | Populus Rhizosphere | MIGVFQSAGFASVAITHRYECFAGTTKERTARRYGVVGVNVSAVRGF* |
Ga0075421_1010725061 | 3300006845 | Populus Rhizosphere | MIGVFQSAGFASVAITHRYECFAGTTKERTARRYG |
Ga0075421_1011614413 | 3300006845 | Populus Rhizosphere | LEAELVGVFATAGFSNVRILDQFDCFAGTTKERTANRYGVVGVNLTATRL* |
Ga0075430_1005691012 | 3300006846 | Populus Rhizosphere | MIGVFQSAGFASVAITHRYECFAGTTKERTARRYGVVGVNVSAVRGT* |
Ga0075433_106939041 | 3300006852 | Populus Rhizosphere | VFEAAGFMNVRVLTRFDCFAGTTKERTAKRYGVVGVNLTATRARPEMKAAG* |
Ga0075420_1017944001 | 3300006853 | Populus Rhizosphere | VAAFAEAGFADVRITERFNCFEGTSKERTARRYGVVGVNLAAVRSR* |
Ga0075425_10000057729 | 3300006854 | Populus Rhizosphere | MIEAFENAGFDRVAITHRYDCFEGTTKERTAKRYGVIGVNLSAVKAGK* |
Ga0075425_1009652442 | 3300006854 | Populus Rhizosphere | MIGVFQSAGFTNVAITHRFDCFAGTTKERTARRYGVVGVNVSAVRGGA* |
Ga0075425_1021636311 | 3300006854 | Populus Rhizosphere | MIAVFQSAGFASVAITHRYECFVGTSKERTARRYGVAGVNVSAVRGA |
Ga0073934_104342262 | 3300006865 | Hot Spring Sediment | MIELFRTAGFHEVAITHRYDCFAGTTKERTARRYGVVGVNLSAVRD* |
Ga0075434_1013073182 | 3300006871 | Populus Rhizosphere | VFTSFGFRDVAITQRFDCFVGTTKERTARRYGVVGVNLTATK* |
Ga0075426_100274094 | 3300006903 | Populus Rhizosphere | VFQAAGFRDVAITHRYDCFAGSSKERTARRYGVGGVNLAATRL* |
Ga0075426_100896542 | 3300006903 | Populus Rhizosphere | VFQAAGFRDVAITQRYDCFAGTSKERTARRYGVGGVNLAATRI* |
Ga0075436_1001898555 | 3300006914 | Populus Rhizosphere | RSAGFDDVSITHRYDCFAGTSKERTARRYGVVGVNISASLAR* |
Ga0079303_104694162 | 3300006930 | Deep Subsurface | VAAFADAGFADVRITERFDCFGATSKERTARRYGVVGVNLSAIRTELA |
Ga0079218_134194022 | 3300007004 | Agricultural Soil | IAAFQSAGFVEPRITSRFTCFDGTSKERTARRYGVVGVNFTAMRSQTAR* |
Ga0066710_1003931432 | 3300009012 | Grasslands Soil | VFASAGFTEVAITARFDCFAGTTKERTARRYGVMGVNLSAVAANNIWTTV |
Ga0066710_1021054332 | 3300009012 | Grasslands Soil | VFTSAGFTQVAIGDRYDCFAGTTKEATAKRYGVIGVNLSAVRVQS |
Ga0066710_1028996542 | 3300009012 | Grasslands Soil | MERLLEAELIDVFASAGFSDVAMTGRFDCSAGTTKERTARRYGVV |
Ga0099829_109864152 | 3300009038 | Vadose Zone Soil | LEAELVAAFSEAGFVDVRITDRFDCFGATSKERTARRYGVIGVNLSAIRSR* |
Ga0105095_100004622 | 3300009053 | Freshwater Sediment | MIEAFASAGFSPRIVTRFDCFAGTTKERTARRYGVVGVNVLAIRSR* |
Ga0105095_106193691 | 3300009053 | Freshwater Sediment | MIEAFRSTGFDDPRIVARFECFAGTTKERTARRYGVVGVNFHAVRSR* |
Ga0105099_105795101 | 3300009082 | Freshwater Sediment | MIEAFASAGFSPRIVTRFDCFAGTTKERTARRYGVVGVNVLAIRS |
Ga0105240_105897842 | 3300009093 | Corn Rhizosphere | MIDVFAAAGLTDVRIRQRFDCFVGTTKERTARRYGVIGVNLSAKKP* |
Ga0105240_106573453 | 3300009093 | Corn Rhizosphere | VFQAAGFASVEITHRYDCFAGTTKERTAKRYGVVGVNLSARMPAR* |
Ga0105245_106102132 | 3300009098 | Miscanthus Rhizosphere | VSAFQSSGFEDVRITHHFDCFVGTTKERTARRYGVVGVNLSAIRSVR* |
Ga0105243_102684372 | 3300009148 | Miscanthus Rhizosphere | VAAFRSSGFERVELTHRFDCFAGTTKERTARRYGVVGVNFSAIRSAASGRERK* |
Ga0111538_132853871 | 3300009156 | Populus Rhizosphere | IAGALLEAELIGAFQSAGFEEPRITTRFACFDGTSKERTARRYGVVGVNFTAARSQRG* |
Ga0075423_100034823 | 3300009162 | Populus Rhizosphere | MNVRVLTRFDCFAGTTKERTAKRYGVVGVNLTATRARPEMKAAG* |
Ga0105242_106870112 | 3300009176 | Miscanthus Rhizosphere | VSAFEEAGFTEVCITHRYDCFDATSKERTARRYGVIGVNLSAIRS* |
Ga0115028_103862432 | 3300009179 | Wetland | VAAFADAGFADVRITERFDCFGATSKERTARRYGVVGVNLSAIRTELAGQ* |
Ga0105340_100105313 | 3300009610 | Soil | MIGVFQASGFTSVAITHRFDCFAGTTKERTARRYGVLGVNLSAARGGA* |
Ga0130016_1000756913 | 3300009868 | Wastewater | MLGTFAAGGFHDPRIVGRFDCFAGTSKERTARRYGVVGVNLLARRA* |
Ga0130016_108708391 | 3300009868 | Wastewater | MIDVFEQAGFLQPRIVARFDCFEGTTKERTARRYGVVGVNVLAERP* |
Ga0131077_110956182 | 3300009873 | Wastewater | MIGAFASAGFRPRIVARFDCFAGTSRERTARRYGVVGVNVSAILSR* |
Ga0126382_122757542 | 3300010047 | Tropical Forest Soil | VFTAAGFGDVAITQRFDCFVGTTKERTARRYGVVGVNLSAMKSRP* |
Ga0134088_106736112 | 3300010304 | Grasslands Soil | VFASAGFSDVAITSRFDCFAGTTKERTARRYGVVGVNLCATKRALR* |
Ga0134071_105089062 | 3300010336 | Grasslands Soil | VFVSAGFSDVSITSRFDCFAGTTKERTARRYGVVGVNLCATKRALR* |
Ga0126376_127498161 | 3300010359 | Tropical Forest Soil | MIDLFAGAGFGDVRVTQRFDCFAGTTKERTARRFGAVGVNVSALRLD* |
Ga0126377_105396151 | 3300010362 | Tropical Forest Soil | VFTSAGFDAVAITHRYDSFAGTTKERTARRYGVTGVNLSAVRGGTSSTSGSFR* |
Ga0126379_120738392 | 3300010366 | Tropical Forest Soil | VFKDAGFSGVAITHRFDCFDGTTKVRTARKYRIEGVNLFAIWPGV* |
Ga0126379_124735632 | 3300010366 | Tropical Forest Soil | VFQSAGFDNVAITHRYDCFAGTTKERTARRYGVGGVNLSAVRK* |
Ga0134124_101025392 | 3300010397 | Terrestrial Soil | ELVGVFATAGFTGVRILGQFDCFAGRTKERTAKRYGVVGVNLTATRL* |
Ga0126383_106060242 | 3300010398 | Tropical Forest Soil | VFAAAGFSDVAITSRFDCFTGTSKEPTARRYGVVGVNLSAARTASASAR* |
Ga0126383_115250412 | 3300010398 | Tropical Forest Soil | MIDVFRAAGFQAVTITHRYDCFVGTTKEPTAKKYGVIGVNVSATRI* |
Ga0137356_10010644 | 3300011402 | Soil | MISVFQSAGFARVAITHRYECFVGTTKERTARRYGVVGVNVSAVRGI* |
Ga0137333_10377562 | 3300011413 | Soil | MIGVFQSAGFTNVAITRRFDCFVGTTKERTARKYGVVGVNVSAIRGSV* |
Ga0137436_10790242 | 3300011423 | Soil | VDAFASAGFEDVRVVDRFDCFVGTTKERMARRHGVIGVNLSAFKSQRR* |
Ga0137423_12003491 | 3300011430 | Soil | MIGVFQSAGFANVAITHRYECFVGTTKERTARRYGVVGVNVSAVRGI* |
Ga0137458_10942351 | 3300011436 | Soil | VAAFRSSGFEQVEITQRFDCFAGTTKERTARRYGVGGV |
Ga0137429_11283992 | 3300011437 | Soil | ISVFQSAGFARVAITHRYECFVGTTKERTARRYGVVGVNVSAVRGI* |
Ga0137431_10867922 | 3300012038 | Soil | AAAGFTDVRILDRFDCFSGTTKERTAKRYGVVGVNLTATRS* |
Ga0137320_10414312 | 3300012172 | Soil | MIDAFATAGFYARIVTRFDCFAGTTKERTARRYGVVGVNVLASQSR* |
Ga0137374_100270516 | 3300012204 | Vadose Zone Soil | VFQAAGFRNVAITTRFDCFAGTTKERTARRYGVVGVNLCAMKSATAS* |
Ga0137370_107805171 | 3300012285 | Vadose Zone Soil | GALLEAELIAAFQSNGFEQVAITDHYDCFGGTTKEGTARKYGVVGVNMLAIRSVPL* |
Ga0137372_109993631 | 3300012350 | Vadose Zone Soil | VAAFRSSGFDDVEITQRFDCFAGTTKERTARRYGVIGVNLSAVRAAR* |
Ga0150984_1005890471 | 3300012469 | Avena Fatua Rhizosphere | MVSVFSDAGFGDVAITQRYDCFAATSKERTARRYGVIGVNLTAVNDR |
Ga0137373_108388761 | 3300012532 | Vadose Zone Soil | GALLEAELVDAFASAGFEDVRVVGRFDCFAGTTKERMARRHGVIGVNLSAIRSQRR* |
Ga0136614_102639411 | 3300012684 | Polar Desert Sand | MIDVFQLAGFTRVAITHRFDCFAGTTKEKTARRYGVFGVNVCAVRGNV* |
Ga0137395_104161393 | 3300012917 | Vadose Zone Soil | VAAFAEAGFTDVRITERFDCFEATSKERTARRYGVMGVNLSANRSR* |
Ga0164302_105623181 | 3300012961 | Soil | GALLEAELVSAFVEAGFTDVQVTERLDCFVATSKEKTARRHGVMGVNLSAIRG* |
Ga0134110_100036055 | 3300012975 | Grasslands Soil | VFASAGFCDVAITSRFDCFAGTTKERTARRYGVVGVNLCATKSALR* |
Ga0164305_118122331 | 3300012989 | Soil | EAELVSAFTEAGFTDVRITERFDCFGDTSKERTARRYGVIGVNLSAIRE* |
Ga0157370_120419831 | 3300013104 | Corn Rhizosphere | VFQAAGFASVEITHRYDCFAGTTKERTAKRYGVVGVNLSARMPVR* |
Ga0134075_103599981 | 3300014154 | Grasslands Soil | LIDVFASAGFSDVAITSRFDCFVGTTKERTARRYGVVGVNLRATRTAAAMSA* |
Ga0180078_10245722 | 3300014865 | Soil | MIGVFQSAGFASVAITHRYECFVGTTKERTARRYGVVGVNVSAVRGI* |
Ga0180094_11553102 | 3300014881 | Soil | MLGAFESVGFANVRLTHRFDPFGGTTKERTARRYGVIGVNVTATRPE* |
Ga0134073_102530691 | 3300015356 | Grasslands Soil | VFASAGFSDVAITSRFDCFAGTTKERTARRYGVVGVNLCATKSAL |
Ga0132258_109304944 | 3300015371 | Arabidopsis Rhizosphere | LIEAFQVAGFRDVHIVARFDCFAETTKERTARKYEVIGANLSAHK* |
Ga0134112_101104242 | 3300017656 | Grasslands Soil | VFVSAGFSDVSITSRFDCFAGTTKERTARRYGVVGVNLCATKRALR |
Ga0183260_103930091 | 3300017787 | Polar Desert Sand | MIDVFQLAGFTRVAITHRFDCFAGTTKEKTARRYGVFGVNVCAVRGNV |
Ga0184621_101557591 | 3300018054 | Groundwater Sediment | IAGALLEAELVAAFEDAGFSEVRIAQRFDCFEATSKEKTARRYGVIGVNLSAVRSR |
Ga0184612_104667522 | 3300018078 | Groundwater Sediment | IAGALLEAELVAAFRSSDFEQVDITHRCDCFAGTTKERTARRYHVVGVNLSAVRSR |
Ga0184629_100537503 | 3300018084 | Groundwater Sediment | MIGVFQSAGFASVAITHRYECFVGTTKERTARRYGVVGVNVSAVRGI |
Ga0184629_102944422 | 3300018084 | Groundwater Sediment | ALLEAELVDAFASAGFEDVRVVGRFDCFAGTTKERMARRYGVIGVNLSAFKSQRR |
Ga0066655_100991663 | 3300018431 | Grasslands Soil | VFASAGFSDVAITSRFDCFAGTTKERTARRYGVVGVNLCATKSALR |
Ga0209109_100480723 | 3300025160 | Soil | MIEAFRSAGFDDPRIVARFDCFAGTSKERTARRYGVMGVNLLAIRAR |
Ga0209519_107930691 | 3300025318 | Soil | VGFTDVRITHRFDPFGGTTKERTARKYGVVGVNVVGRKP |
Ga0209640_103129882 | 3300025324 | Soil | VAVFEDAGFSGVTVTHRFDCFAGTSKEKTARRYGVAAVNLSATR |
Ga0207684_103768982 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VFASAGFSDVTITDRFDCFAGTTKERTARRYGVVGVNLSARRDA |
Ga0207695_104514092 | 3300025913 | Corn Rhizosphere | VFQAAGFASVEITHRYDCFAGTTKERTAKRYGVVGVNLSARMPVR |
Ga0207660_103758061 | 3300025917 | Corn Rhizosphere | MDVFTAAGFRDVRITHRYNCFAGTTKERTAQRYGVIGANVSAIRELA |
Ga0207660_106871382 | 3300025917 | Corn Rhizosphere | LIDVFAAAGLSDVRITQRFDCFGGTTKERTARRYGVIGVNLSARKP |
Ga0207709_112804681 | 3300025935 | Miscanthus Rhizosphere | VFASAGFTRPRIVARFDCFAGTSKERTARKYGVVGVNL |
Ga0207689_100561434 | 3300025942 | Miscanthus Rhizosphere | VAAFRSSGFERVELTHRFDCFAGTTKERTARRYGVVGVNLSAIRSAASGRERK |
Ga0207661_107354913 | 3300025944 | Corn Rhizosphere | MIDVFAAAGFSDVRITQRFDCFVGTTKERTARRYGVIGINLSAKKP |
Ga0207651_111340961 | 3300025960 | Switchgrass Rhizosphere | ALLEAELVEAFESGGFRAVAITRRFDCFGGTTKERTARRYGVMGVNLSATRAHG |
Ga0207674_109918072 | 3300026116 | Corn Rhizosphere | MISVFQWSGFTSVAITQRYECFVGTTKERTTRRYGVVGVNVSAVRGA |
Ga0209154_13212511 | 3300026317 | Soil | SAGFSDVAITSRFDCFAGTTKERTARRYGVVGVNLCATKSALR |
Ga0208185_10502842 | 3300027533 | Soil | MIGVFQASGFTSVAITHRFDCFAGTTKERTARRYGVLGVNLSAARGGA |
Ga0209286_10020536 | 3300027713 | Freshwater Sediment | MIEAFASAGFSPRIVTRFDCFAGTTKERTARRYGVVGVNVLAIRSR |
Ga0209813_102326992 | 3300027866 | Populus Endosphere | MIDLFNAAGFRDAAITRHFDCFAGTSKERTARRYGVLGVNLLAV |
Ga0209486_107847561 | 3300027886 | Agricultural Soil | GAFKAAGFVEPRITSRFTCFDGTTKERTARRYGVVGVNFTAVRSQTAR |
Ga0209486_109457522 | 3300027886 | Agricultural Soil | IAAFQSAGFVEPRITSRFTCFDGTSKERTARRYGVVGVNFTAMRSQTAR |
Ga0209496_103433032 | 3300027890 | Wetland | VAAFADAGFADVRITERFDCFGATSKERTARRYGVVGVNLSAIRTELAGQ |
Ga0247719_11050802 | 3300028041 | Soil | MSGAFESAGFKDVGITHRFDPFGGTPKERTARRYGVIGVNLIGFKPPR |
Ga0268264_103727042 | 3300028381 | Switchgrass Rhizosphere | VDAFAAAGFEDVRVVGRFDCFAGTNKERMARRYGVIGVNLSAIRSQRR |
Ga0307312_110081832 | 3300028828 | Soil | LVAAFADAGFTDVRITDRFDCFEATSKEKTARRYGVVGVNLSAVRS |
Ga0299914_104973132 | 3300031228 | Soil | LLEAELVGAFASAGFERVHIAGRFDCFAGTTKERTARRYGVVGVNLSATRA |
Ga0299914_105554922 | 3300031228 | Soil | MCGAFESAGFIDVRITHRFDPFGGTRKERTARKYQVIGVNVAANKRATR |
Ga0299914_106795432 | 3300031228 | Soil | MIGAFQAAGFSPRIVARFDCFAGTTKERTARRYGVVGVNVLAVRPR |
Ga0299913_103463223 | 3300031229 | Soil | VDAFTGAGFEQVRIVERFDCFGGTTKERTARRYGVNGANLLAIRS |
Ga0310886_100065303 | 3300031562 | Soil | VFESAGFTNVRVLDRFDCFAGTTKERTAKRYGVVGVNLAATRP |
Ga0247727_108253661 | 3300031576 | Biofilm | ATAGFDDSRIIARFDCFAATTKERTARRYGVMGVNLLAIRSRQ |
Ga0310813_103713652 | 3300031716 | Soil | VDRLIAGAQQSAELVSAFQSSGFEDVRITHHFDCFVGTTKERTARRYGVVGVNLSAIRSV |
Ga0310813_104304092 | 3300031716 | Soil | MMDVFTAAGFRDVRITHRYNCFAGTTKERTAQRYGVIGANVSAIRELA |
Ga0310813_104867122 | 3300031716 | Soil | MIDVFSAAGFRDVEITHRYDCFVGTTKERTAKKYGVIGVNVSATRM |
Ga0307412_110421372 | 3300031911 | Rhizosphere | MIDVFSAAGFRDVAITHRYDCFVGTAKERTAKKYGVIGVNVFATRI |
Ga0326597_113265532 | 3300031965 | Soil | VAAFRSSGFEQVEITQRFDCFAGTTKERTARRYGVGGVNLSAVRSVR |
Ga0307416_1028535212 | 3300032002 | Rhizosphere | MIDVFRAAGFRDVAVTHRYDCFVGTTKERTAKKYGVIGVNVSATRI |
Ga0310890_107806021 | 3300032075 | Soil | LEAELVGVFESAGFRSVRILDRFDCFAGTTKQRTARRYGVVGVNLTATRS |
Ga0315281_100149847 | 3300032163 | Sediment | MPAVLAARGFTDVRITERFDCFTGTRKERTAHRYGVLGVNIFARKPL |
Ga0316620_105749351 | 3300033480 | Soil | MPAVLAAHGFTGVRITDRFDCFAGTRKERTARRYGVFGANILARKPV |
Ga0316624_108090692 | 3300033486 | Soil | MPAVLAAHGFTDVRITGRFDCFAGTRKERTAHRYGVLGVNIFARKPL |
Ga0364945_0001338_6251_6397 | 3300034115 | Sediment | VDAFASAGFEDVRVVDRFDCFVGTTKERMARRHGVIGVNLSAFKSQRR |
Ga0364945_0260439_2_139 | 3300034115 | Sediment | MISVFQSSGFTSVAITQRYECFVGTTKERTARRYGVVGVNVSAVRG |
Ga0364933_137593_484_627 | 3300034150 | Sediment | MDAFASAGFEDVRVVDRFDCFVGTTKERMARRHGVIGVNLSAFKSQRR |
⦗Top⦘ |