NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036464

Metagenome / Metatranscriptome Family F036464

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036464
Family Type Metagenome / Metatranscriptome
Number of Sequences 170
Average Sequence Length 157 residues
Representative Sequence MAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Number of Associated Samples 104
Number of Associated Scaffolds 170

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 25.29 %
% of genes near scaffold ends (potentially truncated) 70.59 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.235 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(80.000 % of family members)
Environment Ontology (ENVO) Unclassified
(50.588 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(99.412 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.91%    β-sheet: 4.55%    Coil/Unstructured: 54.55%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 170 Family Scaffolds
PF00366Ribosomal_S17 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 170 Family Scaffolds
COG0186Ribosomal protein S17Translation, ribosomal structure and biogenesis [J] 0.59

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.24 %
UnclassifiedrootN/A1.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004104|Ga0058891_1062429All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff534Open in IMG/M
3300030526|Ga0210267_1123118All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff583Open in IMG/M
3300030528|Ga0210277_10385016All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff567Open in IMG/M
3300030528|Ga0210277_10465004All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff533Open in IMG/M
3300030528|Ga0210277_11024965All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff513Open in IMG/M
3300030529|Ga0210284_1014455All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff541Open in IMG/M
3300030529|Ga0210284_1107115All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff507Open in IMG/M
3300030530|Ga0210264_1199045All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff606Open in IMG/M
3300030535|Ga0210285_1341251Not Available513Open in IMG/M
3300030536|Ga0210266_1074694All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff553Open in IMG/M
3300030536|Ga0210266_1129276All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff610Open in IMG/M
3300030536|Ga0210266_1153302All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff534Open in IMG/M
3300030539|Ga0210281_1172053All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff786Open in IMG/M
3300030540|Ga0247649_1080586All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff544Open in IMG/M
3300030540|Ga0247649_1110116All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff509Open in IMG/M
3300030542|Ga0210249_1269658All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff575Open in IMG/M
3300030545|Ga0210271_10225670All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff634Open in IMG/M
3300030546|Ga0247646_1244282All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff534Open in IMG/M
3300030546|Ga0247646_1288485All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff503Open in IMG/M
3300030547|Ga0247656_1142759All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff592Open in IMG/M
3300030548|Ga0210252_10592855All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff511Open in IMG/M
3300030549|Ga0210257_10446829All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff591Open in IMG/M
3300030549|Ga0210257_10631073All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff525Open in IMG/M
3300030550|Ga0247631_1139954All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff566Open in IMG/M
3300030550|Ga0247631_1160748All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff549Open in IMG/M
3300030550|Ga0247631_1178188All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff536Open in IMG/M
3300030551|Ga0247638_1143032All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff575Open in IMG/M
3300030552|Ga0247654_1072258All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff676Open in IMG/M
3300030552|Ga0247654_1162740All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff549Open in IMG/M
3300030553|Ga0247645_1130571All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff613Open in IMG/M
3300030553|Ga0247645_1135396All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff607Open in IMG/M
3300030554|Ga0247640_1209953All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff503Open in IMG/M
3300030555|Ga0247618_1139577All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff554Open in IMG/M
3300030565|Ga0247635_1196612All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff604Open in IMG/M
3300030565|Ga0247635_1263659All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff547Open in IMG/M
3300030566|Ga0257186_1091076All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff617Open in IMG/M
3300030571|Ga0247652_1210479All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff515Open in IMG/M
3300030572|Ga0210258_10441493All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff520Open in IMG/M
3300030574|Ga0247648_1158212All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff560Open in IMG/M
3300030575|Ga0210288_1239921All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff526Open in IMG/M
3300030577|Ga0210260_10274179All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff588Open in IMG/M
3300030578|Ga0210275_10208530All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff632Open in IMG/M
3300030578|Ga0210275_10406576All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff500Open in IMG/M
3300030579|Ga0247633_10211273All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff583Open in IMG/M
3300030579|Ga0247633_10234581All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff566Open in IMG/M
3300030581|Ga0210270_1433643All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff585Open in IMG/M
3300030581|Ga0210270_1863329All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff666Open in IMG/M
3300030583|Ga0210262_1066959All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff773Open in IMG/M
3300030584|Ga0247658_1082899All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff606Open in IMG/M
3300030585|Ga0247639_1195563All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff600Open in IMG/M
3300030586|Ga0265393_1149240All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff580Open in IMG/M
3300030588|Ga0210283_1434243All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff572Open in IMG/M
3300030589|Ga0210255_10737455All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff580Open in IMG/M
3300030589|Ga0210255_10764026All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff546Open in IMG/M
3300030589|Ga0210255_10818761All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff619Open in IMG/M
3300030590|Ga0247643_1163399All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff538Open in IMG/M
3300030593|Ga0210263_1194513All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff525Open in IMG/M
3300030594|Ga0210280_1139961All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff570Open in IMG/M
3300030595|Ga0210276_11125531All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff531Open in IMG/M
3300030600|Ga0247659_1135069All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff592Open in IMG/M
3300030600|Ga0247659_1163523All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff561Open in IMG/M
3300030602|Ga0210254_10242504All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff593Open in IMG/M
3300030604|Ga0247637_1079195All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff686Open in IMG/M
3300030607|Ga0247615_10266498All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff595Open in IMG/M
3300030608|Ga0247651_10290746Not Available539Open in IMG/M
3300030608|Ga0247651_10298445All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff534Open in IMG/M
3300030608|Ga0247651_10351738All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff504Open in IMG/M
3300030622|Ga0265391_10303339All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff532Open in IMG/M
3300030623|Ga0265392_1090478All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff686Open in IMG/M
3300030624|Ga0210251_10095750All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff640Open in IMG/M
3300030625|Ga0210259_10687802All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff523Open in IMG/M
3300030626|Ga0210291_10775627All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff593Open in IMG/M
3300030626|Ga0210291_11280846All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff553Open in IMG/M
3300030627|Ga0210269_10226485All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff620Open in IMG/M
3300030628|Ga0247629_10243144All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff635Open in IMG/M
3300030630|Ga0210282_10255876All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff597Open in IMG/M
3300030630|Ga0210282_10315032All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff557Open in IMG/M
3300030634|Ga0247636_10272963All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff565Open in IMG/M
3300030682|Ga0247622_1168618All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff539Open in IMG/M
3300030683|Ga0247621_1116715All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff624Open in IMG/M
3300030684|Ga0247617_1125243All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff528Open in IMG/M
3300030684|Ga0247617_1130710All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff522Open in IMG/M
3300030738|Ga0265462_11800683All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff587Open in IMG/M
3300030738|Ga0265462_12368288All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff527Open in IMG/M
3300030738|Ga0265462_12388149All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff525Open in IMG/M
3300030740|Ga0265460_12862223All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff518Open in IMG/M
3300030741|Ga0265459_12672923All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff618Open in IMG/M
3300030741|Ga0265459_13180880All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff574Open in IMG/M
3300030743|Ga0265461_11879723All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff675Open in IMG/M
3300030743|Ga0265461_12054681All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff654Open in IMG/M
3300030743|Ga0265461_12288609All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff629Open in IMG/M
3300030743|Ga0265461_12397379All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff618Open in IMG/M
3300030743|Ga0265461_13137802All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff556Open in IMG/M
3300030743|Ga0265461_13997877All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff502Open in IMG/M
3300030758|Ga0138305_1195619All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff645Open in IMG/M
3300030777|Ga0075402_12504134All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff837Open in IMG/M
3300030779|Ga0075378_11053508All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff511Open in IMG/M
3300030790|Ga0138304_1482647All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff549Open in IMG/M
3300030839|Ga0073999_11175074All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff527Open in IMG/M
3300030841|Ga0075384_10042238All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff508Open in IMG/M
3300030842|Ga0075404_10024512All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff641Open in IMG/M
3300030842|Ga0075404_11429788Not Available584Open in IMG/M
3300030848|Ga0075388_10039389All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff719Open in IMG/M
3300030850|Ga0075387_11745851All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff584Open in IMG/M
3300030852|Ga0075389_10542889All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff545Open in IMG/M
3300030853|Ga0075372_11353555All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff578Open in IMG/M
3300030854|Ga0075385_10045053All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff533Open in IMG/M
3300030855|Ga0075374_11388372All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff578Open in IMG/M
3300030917|Ga0075382_11689158All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff502Open in IMG/M
3300030922|Ga0138300_1425343All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff635Open in IMG/M
3300030923|Ga0138296_1001958All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff550Open in IMG/M
3300030923|Ga0138296_1324934All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff516Open in IMG/M
3300030923|Ga0138296_1736974All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff566Open in IMG/M
3300030933|Ga0074039_10978795All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff604Open in IMG/M
3300030934|Ga0075391_11419181All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff501Open in IMG/M
3300030936|Ga0138306_1123322All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff511Open in IMG/M
3300030937|Ga0138302_1385274All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff566Open in IMG/M
3300030937|Ga0138302_1583952All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff524Open in IMG/M
3300030937|Ga0138302_1816628All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff655Open in IMG/M
3300030938|Ga0138299_10743979All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff636Open in IMG/M
3300030939|Ga0138303_1283319All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff543Open in IMG/M
3300030939|Ga0138303_1289168All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff564Open in IMG/M
3300030939|Ga0138303_1302663All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff606Open in IMG/M
3300030939|Ga0138303_1318131All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff524Open in IMG/M
3300030945|Ga0075373_11217528All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff556Open in IMG/M
3300030946|Ga0075379_10048586All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff571Open in IMG/M
3300030947|Ga0075390_10024025All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff559Open in IMG/M
3300030950|Ga0074034_11036217All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff524Open in IMG/M
3300030962|Ga0138297_1552701All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff606Open in IMG/M
3300030962|Ga0138297_1587426All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff516Open in IMG/M
3300030970|Ga0075381_11192789All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff579Open in IMG/M
3300030971|Ga0075375_12141173All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff538Open in IMG/M
3300030973|Ga0075395_10058973All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff543Open in IMG/M
3300031015|Ga0138298_1668552All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff620Open in IMG/M
3300031015|Ga0138298_1728352All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff648Open in IMG/M
3300031022|Ga0138301_1530905All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff609Open in IMG/M
3300031023|Ga0073998_11514982All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff559Open in IMG/M
3300031030|Ga0074030_10769285All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff532Open in IMG/M
3300031057|Ga0170834_100016039All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff581Open in IMG/M
3300031057|Ga0170834_101355419All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff624Open in IMG/M
3300031057|Ga0170834_111281601All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff575Open in IMG/M
3300031057|Ga0170834_113801671All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff568Open in IMG/M
3300031122|Ga0170822_11244783All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff579Open in IMG/M
3300031122|Ga0170822_17160860All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff639Open in IMG/M
3300031128|Ga0170823_11032345All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff619Open in IMG/M
3300031128|Ga0170823_12043399All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff545Open in IMG/M
3300031128|Ga0170823_12984790All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff587Open in IMG/M
3300031128|Ga0170823_13423707All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff614Open in IMG/M
3300031231|Ga0170824_100535055All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff549Open in IMG/M
3300031231|Ga0170824_103518376All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff573Open in IMG/M
3300031231|Ga0170824_110322721All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff531Open in IMG/M
3300031231|Ga0170824_121624786All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff585Open in IMG/M
3300031231|Ga0170824_122570227All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff532Open in IMG/M
3300031446|Ga0170820_11490788All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff603Open in IMG/M
3300031446|Ga0170820_11540565All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff524Open in IMG/M
3300031446|Ga0170820_13358538All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff574Open in IMG/M
3300031446|Ga0170820_15952202All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff577Open in IMG/M
3300031446|Ga0170820_16009429All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff566Open in IMG/M
3300031469|Ga0170819_13232933All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff585Open in IMG/M
3300031469|Ga0170819_14149510All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff594Open in IMG/M
3300031469|Ga0170819_17018008All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff578Open in IMG/M
3300031469|Ga0170819_17711369All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff544Open in IMG/M
3300031474|Ga0170818_104159904All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea533Open in IMG/M
3300031474|Ga0170818_105724121All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff559Open in IMG/M
3300031474|Ga0170818_106583140All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff509Open in IMG/M
3300032756|Ga0315742_11434334All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff732Open in IMG/M
3300032756|Ga0315742_12407019All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff598Open in IMG/M
3300032756|Ga0315742_12523551All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff586Open in IMG/M
3300032756|Ga0315742_12767805All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff563Open in IMG/M
3300032756|Ga0315742_13101607All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff536Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil80.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil18.82%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.59%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030526Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030530Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030536Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030539Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030540Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030542Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR003SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030546Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030547Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030548Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030550Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030552Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030553Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030554Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030555Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030565Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030566Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP2-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030571Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030574Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030577Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030581Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030583Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030584Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030585Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030588Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030590Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030593Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030600Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030604Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030607Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030608Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030623Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030628Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030634Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030682Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030683Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030684Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030758Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030779Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030790Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030839Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030850Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030852Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030853Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030854Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030917Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030922Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030933Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030934Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030936Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030937Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030939Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030946Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030947Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030950Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030962Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030970Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030971Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030973Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031015Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031023Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031030Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058891_106242913300004104Forest SoilLIPIAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFIWCVGAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSIFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV*
Ga0210267_112311813300030526SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPPGILAGAKLMAYSQGRDCAIVNHVGLGFLWCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIVLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210277_1038501613300030528SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKDGAWCALCWLCPTGALAGGKLFSYSQGRECAVVNHVVPFFIPCVNIVSSVALRHNLRVKAQVGTPPMDHSGIAGDAIMVLICGLCAGAQQLRSVDIAAWDWLTEYKTKGIKGYEEPCTFCVDHV
Ga0210277_1046500413300030528SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHIGLGCLWCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210277_1102496513300030528SoilGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGALAGAKLMAYSQGRDCAIVNHVGLQFVWCVAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKIWEPPCTLCIDHV
Ga0210284_101445513300030529SoilGKEAKMAEMLTLDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWICPTNALAGAKLFAYSQNRDCGIVNHIVPHFIPCVNIAAAVAMRHNLRCKLKVGAPPKDTTGIIGDTIMVLLCGLCSFAQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCVDQA
Ga0210284_110711513300030529SoilEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGFLWCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIVLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210264_119904513300030530SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDILLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210285_134125123300030535SoilGPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDILLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210266_107469413300030536SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGALAGAKLMAYSQGRDCAIVNHVGLQFVWCVAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKIWEPPCTLCIDHV
Ga0210266_112927613300030536SoilMAEIFALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAAAKLMAYSQGRDCAIVNHVGLHFIWCVGAPTLRHNLRVRAKVGNPPMETQGLIGDIVMSIFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210266_115330213300030536SoilEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCISAPTLRHNLRVRAKVGNPPMEKNGLMGDILLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210281_117205313300030539SoilWELWKCEPCCGEPCNPTEGAMCCLCWFCPTGILAGAKLASYSQNRDCAIVNHIVPAFIPCVNIASAVGTRHNLRCKAQVGHPPKDTSGIVGDTIMILICGLCAFTQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0247649_108058613300030540SoilGKAGECWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247649_111011613300030540SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210249_126965823300030542SoilAEILALDWGGKAGACWELWKCEPCCVEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDILLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210271_1022567013300030545SoilAKRTKQHKGAETTRNTKDIIQMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHIGLGCLWCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247646_124428213300030546SoilQSATKGAETTLTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247646_128848513300030546SoilCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247656_114275913300030547SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210252_1059285513300030548SoilEMLALDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWICPTNALAGAKLFAYSQNRDCGIVNHIVPHFIPCVNIAAAVAMRHNLRCKLKVGAPPKDTTGIIGDTIMVLLCGLCSFAQELRSVDKATWDWLNEYNTKGMPKTFEEPRIFCVDQA
Ga0210257_1044682913300030549SoilRKKKKGEKGKEAKMAEMLALDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWICPTNALAGAKLFAYSQNRDCGIVNHIVPHFIPCVNIAAAVAMRHNLRCKLKVGAPPKDTTGIIGDTIMVLLCGLCSFAQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCVDQA
Ga0210257_1063107323300030549SoilGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDILLSLFCGLCAGTQELRSVDKSAWDWVAEYNEEGIKFWEPPCTLCIDHV
Ga0247631_113995413300030550SoilAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247631_116074813300030550SoilEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWICPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247631_117818813300030550SoilEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247638_114303213300030551SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247654_107225813300030552SoilTQSATKGAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247654_116274013300030552SoilIRMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247645_113057113300030553SoilLALDWGGKAGACWELWKWEPCCGEPCNPTEGAMCFLCWVCPTGVLAGAKLASYAENRDCAIVNHIVPFFIPCVNIAAAVGLRHNLRCRAQVGLPPKDTSGILGDTIMVLFCGLCSMAQELRSVDKSTWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0247645_113539613300030553SoilETTQTSATKGAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247640_120995313300030554SoilWELWKCEPCCGEPCNPKEGAMCALCWLCPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247618_113957713300030555SoilRMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247635_119661223300030565SoilATKGAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTL
Ga0247635_126365913300030565SoilPTPSAPKGAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0257186_109107613300030566Host-AssociatedMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLNCVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247652_121047913300030571SoilAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0210258_1044149313300030572SoilMAEILALDWGGKAGACWELWKCEPCCGVPCNPKDGAWCALCWLCPTGALAGGKLFSYSQGRECAVVNHVVPFFIPCVNIVSSVALRHNLRVKAQVGTPPMDHSGIAGDAIMVLICGLCAGAQQLRSVDIAAWDWLTEYKTKGIKGYEEP
Ga0247648_115821213300030574SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210288_123992113300030575SoilKEAKMAEMLALDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWICPTNALAGAKLFAYSQNRDCGIVNHIVPHFIPCVNIAAAVAMRHNLRCKLKVGAPPKDTTGIIGDTIMVLLCGLCSFAQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCVDQA
Ga0210260_1027417913300030577SoilNTKDIIQMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGALAGAKLMAYSQGRDCAIVNHVGLQFVWCVAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKIWEPPCTLCIDHV
Ga0210275_1020853023300030578SoilMAELLAMDWGGKAGACWELWKWEPCCGEPCNPTEGAMCFICWVCPTGVLAGAKLAAYAENRDCAIVNHIVPFFIPCVNIAAAVGLRHNLRCRAQVGLPPKDTSGIIGDTIMVLLCGLCSMAQELRSVDKSTWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0210275_1040657613300030578SoilLALDWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECTIVNHVVPFFVPCVNLAAGISLRHNLRVKAQVGSPPMDTSGIAGDAIMVLLCGLCAGAQELRSVDKAAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0247633_1021127313300030579SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWICPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247633_1023458113300030579SoilMAELLALDWGGKAGACWELWKWEPCCGEPCNPTEGAMCFLCWVCPTGVLAGAKLASYAENRDCAIVNHIVPFFIPCVNIAAAVGLRHNLRCRAQVGLPPKDTSGILGDTIMVLFCGLCSMAQELRSVDKSTWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0210270_143364313300030581SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGFLWCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIVLSLVCGLCAGTQERRSADQSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210270_186332913300030581SoilANQKSSDLILKEESAKRTKQHKGAETTRNTKDIIQMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGALAGAKLMAYSQGRDCAIVNHVGLQFVWCVAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKIWEPPCTLCIDHV
Ga0210262_106695913300030583SoilMAEILALDWGGKAGACWKLWKCEPCCGEPCNPKDGAWCALCWLCPTGALAGGKLFSYSQGRECAVVNHVVPFFIPCVNIVSSVALRHNLRVKAQVGTPPMDHSGIAGDAIMVLICGLCAGAQQLRSVDIAAWDWLTEYKTKGIKGYEEPCTFCVDHV
Ga0247658_108289913300030584SoilQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247639_119556313300030585SoilATKGAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0265393_114924013300030586SoilQMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGALAGAKLMAYSQGRDCAIVNHVGLQFVWCVAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKIWEPPCTLCIDHV
Ga0210283_143424323300030588SoilEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHIGLGCLWCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210255_1073745513300030589SoilMAEILALDWGGKAGACLELWKCEPCCGEPCNPKEGAMCALCWLCPTGALAGAKLMAYSQGRDCAIVNHVGLQFVWCVAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKIWEPPCTLCIDHV
Ga0210255_1076402613300030589SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGFLWCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIVLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210255_1081876113300030589SoilMAEMLALDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWICPTNALAGAKLFAYSQNRDCGIVNHIVPHFIPCVNIAAAVAMRHNLRCKLKVGAPPKDTTGIIGDTIMVLLCGLCSFAQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCVDQA
Ga0247643_116339923300030590SoilAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210263_119451323300030593SoilEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGALAGAKLMAYSQGRDCAIVNHVGLQFVWCVAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKIWEPPCTLCIDHV
Ga0210280_113996113300030594SoilAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDILLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210276_1112553113300030595SoilGNREPKQENHRMAEILALDWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECAIVNHVVPFFVPCVNLAAGISLRHNLRVKAQVGSPPMDTSGIAGDAIMVLLCGLCAGAQELRSVDKAAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0247659_113506913300030600SoilMADILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247659_116352313300030600SoilSFSHRGNHHTSPQQKESKQPLTLLGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTSILAGAKLMAYSQGRDCAIVNHVLLGFIGCVAAPTLRHNLRVRAKVGNPPMEKNGLIGDVILSLFCSLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0210254_1024250413300030602SoilQMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247637_107919513300030604SoilARKQNHKADLKEKVESTMAELLAMDWGGKAGACWELWKWEPCCGEPCNPTEGAMCFLCWVCPTSVLAGGKLASYAENRDCAIVNHIVPFFIPCVNIAAAVGLRHNLRCRAQVGLPPKDTSGIIGDTIMVLFCGLCSMAQELRSVDKSTWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0247615_1026649813300030607SoilATKGAETTRTPKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247651_1029074613300030608SoilGEPCNPKEGAMCAVCSICPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247651_1029844513300030608SoilMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVLLGFIGCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247651_1035173813300030608SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTL
Ga0265391_1030333913300030622SoilMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPIEKNGLIGDILLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0265392_109047813300030623SoilAKRTKQHKGAETTRNTKDIIQMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGALAGAKLMAYSQGRDCAIVNHVGLQFVWCVAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAGAQELRSVDKSAWDWVAEYNEKGIKIWEPPCTLCIDHV
Ga0210251_1009575013300030624SoilMAEILVLDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDILLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0210259_1068780213300030625SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKDGAWCALCWLCPTGALAGGKLFSYSQGRECAVVNHVVPFFIPCVNIVSSVALRHNLRVKAQVGTPPMDHSGIAGDAIMVLICGLCAGAQQLRSVDIAAWDWLTEYKTKGIKGYEEPCTFCV
Ga0210291_1077562713300030626SoilPTHTSATKGAETTQTHKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0210291_1128084613300030626SoilEKGKEAKMAEMLALDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWICPTNALAGAKLFAYSQNRDCGIVNHIVPHFIPCVNIAAAVAMRHNLRCKLKVGAPPKDTTGIIGDTIMVLLCGLCSFAQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCVDQA
Ga0210269_1022648523300030627SoilMEILTPDRGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDILLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0247629_1024314413300030628SoilMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0210282_1025587613300030630SoilQRKKKKGEKGKEAKMAEMLALDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWICPTNALAGAKLFAYSQNRDCGIVNHIVPHFIPCVNIAAAVAMRHNLRCKLKVGAPPKDTTGIIGDTIMVLLCGLCSFAQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCVDQA
Ga0210282_1031503223300030630SoilIKSPMAEILALDWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECAIVNHVVPFFVPCVNIAASISLRHNLRVKAQVGSPPMDTSGIVGDAVMVLICGLCAGAQELRSVDKSAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0247636_1027296313300030634SoilAGACWEVTKLEPCCGDPFNINDAVKCIACWYCCAPCSASKLYSNTLEQDCAIVNHVLLGFIGCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247622_116861813300030682SoilTQSPTKGAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247621_111671513300030683SoilMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVLLQFLGCIAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247617_112524323300030684SoilMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0247617_113071013300030684SoilCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVLLGFIGCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0265462_1180068313300030738SoilMAEILALDWGGKAGACWELWKCEPCCGEPCTPAEAAWCALCWLCPTGALAGGKLFSYSQGRECAIVNHVVPFFVPCVNIAASISLRHNLRVKAQVGSPPMDTSGIVGDAVMVLICGLCAGAQELRSVDKSAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0265462_1236828813300030738SoilQMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAELMAYSQGRDCAIVNHVGLGFLWCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIVLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0265462_1238814913300030738SoilMCCLCWVCPTGVLAGAKLYSYSQNRDCAIVNHIVPYFIPCVNLASAVSLRHNLRCKAQVGSPPKDTSGIVGDTIMVLICGLCAFGQELRSVDKSTWDWLNEYNTKGVPKTFEEPCIFCIDHV
Ga0265460_1286222313300030740SoilDREKSEKMAEILALDWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECTIVNHVVPFFVPCVNLAAGISLRHNLRVKAQVGSPPMDTSGIAGDAIMVLLCGLCAGAQELRSVDKAAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0265459_1267292313300030741SoilMAEILALDWGGKAGACWELWKCEPCCGEPCSPAEGAWCALCWLCPTGALAGGKLFSYSQGRECAIVNHVVPFFVPCVNIAASISLRHNLRVKAQVGAPPMDTTGIVGDAVLVLLCGLCAGAQELRSVDKAAWDWVTEYNTKGIKGFEEPCTFCIDHV
Ga0265459_1318088013300030741SoilMAEILALDWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECAIVNHVVPFFVPCVNIAASISLRHNLRVKAQVGSPPMDTSGIVGDAVMVLICGLCAGAQELRSVDKSAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0265461_1187972313300030743SoilMAEILALDWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECAIVNHVVPFFVPCVNLAAGISLRHNLRVKAQVGSPPMDTSGIAGDAIMVLLCGLCAGAQELRSVDKAAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0265461_1205468113300030743SoilMAELLALDWGGKAGACWELWKFEPCCGEPCNPKEGVMCFLCWVCPTGVLAGAKLYSYSQNRDCTIVNHIVPYFIPCVNLASAVSLRHNLRCKAQVGSPPKDTSGIVGDTIMVLICGLCAFGQELRSVDKSTWDWLNEYNTKGVPKTFEEPCIFCIDHV
Ga0265461_1228860913300030743SoilMAEMLAMDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWICPTGVLAGAKLYAYSQNRDCGIVNHIVPQFIPCVNFAVAVATRHNLRCKLKVGAPPKDTTGIIGDTILMIFCGLCAFAQELRSVDKSTWDWLNEYNTKGMPKTFEEPCIFCVDQA
Ga0265461_1239737913300030743SoilPMAEILALDWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECAIVNHVVPFFVPCVNIAASISLRHNLRVKAQVGSPPMDTSGIVGDAVMVLICGLCAGAQELRSVDKSAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0265461_1313780213300030743SoilIQMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGFLWCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIVLSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0265461_1399787713300030743SoilLDWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECTIVNHVVPFFVPCVNLAAGISLRHNLRVKAQVGSPPMDTSGIAGDAIMVLLCGLCAGAQELRSVDKAAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0138305_119561913300030758SoilTHTSATKGAETTQTHKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075402_1250413413300030777SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNAKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGCVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0075378_1105350813300030779SoilETTQTHKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0138304_148264713300030790SoilALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLNCVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0073999_1117507413300030839SoilMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMEKNGLIGDIILSLVCGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075384_1004223813300030841SoilTHTSATKGAETTQTHKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMEKNGLCGDILLSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCT
Ga0075404_1002451223300030842SoilKAAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075404_1142978823300030842SoilKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTIRHNLRVRAKVGNPPMETHGLVGDVILSLVCGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075388_1003938913300030848SoilHRSATKAAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVLLSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075387_1174585123300030850SoilAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVLLSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075389_1054288913300030852SoilEMLAMDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWLCPTSALAGAKLYAYSQNRDCGIVNHIVPQFIPCVNIVAAVAIRHNLRCKLKVGAPPKDTTGIIGDTILTLLCGLCAFTQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCIDQA
Ga0075372_1135355513300030853SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAFCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0075385_1004505313300030854SoilATKAAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075374_1138837223300030855SoilGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTIRHNLRVRAKVGNPPMEKNGLCGDILLSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075382_1168915813300030917SoilAETTQTHKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVLLSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0138300_142534313300030922SoilHTSATKGAETTQTHKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0138296_100195823300030923SoilEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTIRHNLRVRAKVGNPPMEKNGLAGDIILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0138296_132493413300030923SoilATKESKQPKLKGFIRMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAFCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0138296_173697413300030923SoilGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0074039_1097879513300030933SoilRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075391_1141918113300030934SoilMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGCVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0138306_112332213300030936SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAICWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFIWCVGAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSVFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0138302_138527413300030937SoilGKARKETKQSDSEEKVEKMAELLAMDWGGKAGACWELWKWEPCCGEPCNPTEGAMCFICWVCPTGVLAGAKLAAYAENRDCAIVNHIVPFFIPCVNIAAAVGLRHNLRCRAQVGLPPKDTSGIIGDTIMVLLCGLCSMAQELRSVDKSTWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0138302_158395213300030937SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLNCVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSVFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0138302_181662823300030937SoilMCCLCWVCPTGILAGAKLASYSQNRDCAIVNHIVPAFIPCVNIASAVGTRHNLRCKAQVGHPPKDTSGIVGDTIMVLICGLCAFTQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0138299_1074397923300030938SoilPTHTSATKGAETTQTHKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0138303_128331913300030939SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNAKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGCVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWVSPCTLCIDHV
Ga0138303_128916823300030939SoilRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTIRHNLRVRAKVGNPPMEKNGLAGDIILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0138303_130266323300030939SoilGNPPTKESKQPKLKGFIRMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAFCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0138303_131813113300030939SoilHRSATKAAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075373_1121752813300030945SoilMEILTPDWGGKAGACWELWKCEPCCGEPCNPKEGAFCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0075379_1004858613300030946SoilTTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0075390_1002402513300030947SoilPHRSATKAAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTIRHNLRVRAKVGNPPMEKNGLCGDILLSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0074034_1103621723300030950SoilMCCLCWVCPTGILAGAKLASYSQNRDCAIVNHIVPAFIPCVNIASAVGTRHNLRCKAQVGHPPKDTSGIVGDTIMILICGLCAFTQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0138297_155270113300030962SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLLAYSQGRDCAIVNHVGLQFVGCIGAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0138297_158742613300030962SoilPTHTSATKGAETTQTHKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCI
Ga0075381_1119278913300030970SoilKKEKRRKEKKGKHNMAEMLAMDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWLCPTSALAGAKLYAYSQNRDCGIVNHIVPQFIPCVNIVAAVAIRHNLRCKLKVGAPPKDTTGIIGDTILTLLCGLCAFTQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCIDQA
Ga0075375_1214117313300030971SoilDWGGKAGACWELWKCEPCCGEPCNAKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGCVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0075395_1005897323300030973SoilAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVLLSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0138298_166855223300031015SoilMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTIRHNLRVRAKVGNPPMEKNGLAGDIILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0138298_172835213300031015SoilMAELLALDWGGKAGACWELWKWEPCCGEPCNPKEGVMCFLCWACPTGVLAGAKLYSYSQNRDCTIVNHIVPHFIPCVNIATAVAMRHNLRCKAQVGSPPKDTSGIVGDTIMVLLCGLCAGAQELRSVDKSTWDWLNEYNTKGVPKTFEEPCIFCIDHV
Ga0138301_153090513300031022SoilTQKCNKSSRNNPTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0073998_1151498213300031023SoilKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0074030_1076928513300031030SoilKKKIKSHMAEILALDWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECAIVNHVVPFIVPCVNLAASISLRHNLRVKAQVGSPPMDTSGIVGDAIMVLICGLCAGAQELRSVDKSAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0170834_10001603913300031057Forest SoilMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTIRHNLRVRAKVGNPPMETHGLVGDVILSLVCGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0170834_10135541923300031057Forest SoilVWGGKAGEATKESKQPKLKGFIRMAEILALDWGGKAGACWELWKWEPCCGEPCNPKEGAFCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPQMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0170834_11128160113300031057Forest SoilKKGKHNMAEMLAMDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWLCPTSALAGAKLYAYSQNRDCGIVNHIVPQFIPCVNIVAAVAIRHNLRCKLKVGAPPKDTTGIIGDTILTLLCGLCAFTQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCIDQA
Ga0170834_11380167123300031057Forest SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLNLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEFPCTLCIDYV
Ga0170822_1124478313300031122Forest SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNAKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGFIGCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0170822_1716086013300031122Forest SoilSKKRKPTHTSATKGAETTQTHKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0170823_1103234523300031128Forest SoilMAEMLAMDWGGKAGACWELWKCEPCCGEPCNPAEGAMCAVCWLCPTSALAGAKLYAYSQNRDCGIVNHIVPQFIPCVNIVAAVAIRHNLRCKLKVGAPPKDTTGIIGDTILTLLCGLCAFTQELRSVDKATWDWLNEYNTKGMPKTFEEPCIFCIDQA
Ga0170823_1204339923300031128Forest SoilALDWGGKAGACWELWKCEPCCGEPCNAKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGFIGCVAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0170823_1298479013300031128Forest SoilAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0170823_1342370723300031128Forest SoilVWGGKAGEATKESKQPKLKGFIRMAEILALDWGGKAGACWELWKWEPCCGEPCNPKEGAFCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0170824_10053505513300031231Forest SoilALDWGGKAGACWELWKCEPCCGEPCNAKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGCVGCIAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0170824_10351837613300031231Forest SoilGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWLGEYQEKGIKVWEPPCTLCIDHV
Ga0170824_11032272113300031231Forest SoilQKEPKQPKPTGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWICPTGVLAGAKLLAYSQGRDCHIVNHVAFQFISCVSAPTMRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCSLAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0170824_12162478623300031231Forest SoilETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTIRHNLRVRAKVGNPPMEKNGLAGDIILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0170824_12257022713300031231Forest SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLNLVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0170820_1149078813300031446Forest SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLNCVGCIAAPTLRHNLRVRAKVGNPPREKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0170820_1154056513300031446Forest SoilTKGAETTQTLKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0170820_1335853813300031446Forest SoilGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTIRHNLRVRAKVGNPPMEKNGLAGDIILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0170820_1595220223300031446Forest SoilPKLKGFIRMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAFCAVCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0170820_1600942913300031446Forest SoilGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCVAAPTIRHNLRVRAKVGNPPMETHGLLGDVLLSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0170819_1323293313300031469Forest SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWLCPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWLGEYQEKGIKVWEPPCTLCIDHV
Ga0170819_1414951023300031469Forest SoilLALDWGGKAGAFWELWKWEPCCGEPCNPTEGAMCFLCWVCPTGVLAGAKLASYAENRDCAIVNHIVPFFIPCVNIAAAVGLRHNLRCRAQVGLPPKDTSGIIGDTIMVLFCGLCSMAQELRSVDKSTWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0170819_1701800813300031469Forest SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWICPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0170819_1771136913300031469Forest SoilQRGNPHRSATKAAETTQTLKGFIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWICPTGVLAGAKLLAYSQGRDCHIVNHVAFQFISCVSAPTMRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCSLAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0170818_10415990423300031474Forest SoilELWKWEPCCGEPCNPTEGAMCFLCWVCPTGVLAGGKLASYAENRDCAIVNHIVPFFIPCVNIAAAVGLRHNLRCRAQVGLPPKDTSGIIGDTIMVLFCGLCSMAQELRSVDKSTWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0170818_10572412113300031474Forest SoilGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTIRHNLRVRAKVGNPPMEKNGLAGDIILSLICGLCAFTQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDVV
Ga0170818_10658314013300031474Forest SoilIRMAEILALDWGGKAGACWELWKCEPCCGEPCNPKEGAMCAVCWICPTGILAGAKLMAYSQGRDCAIVNHVGLQFVSCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHF
Ga0315742_1143433413300032756Forest SoilTKGAETTQTHKGYIRMAEILAMDWGGKAGACWELWKCEPCCGEPCNPKEGAMCALCWICPTGVLAGAKLMAYSQGRDCAIVNHVALQFVGCIAAPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGAQELRSVDKSAWDWVAEYNEKGIKVWEPPCTLCIDHV
Ga0315742_1240701913300032756Forest SoilMAEILALDWGGKAGACWELWKCEPCCGEPCNAKEGAMCALCWLCPTGILAGAKLMAYSQGRDCAIVNHVGLGCVGCIAGPTLRHNLRVRAKVGNPPMEKNGLIGDIILSLFCGLCAGTQELRSVDKSAWDWVAEYNEKGIKFWEPPCTLCIDHV
Ga0315742_1252355113300032756Forest SoilREPKPGESERIQQGEKREETEFDKEKKKIKSHMAEILALDWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECAIVNHVVPFIVPCVNLAASISLRHNLRVKAQVGSPPMDTSGIVGDAIMVLICGLCAGAQELRSVDKSAWDWVTEYNTKGIKGFEEPCTFCVDHV
Ga0315742_1276780523300032756Forest SoilAELLAMDWGGKAGACWELWKWEPCCGEPCNPTEGAMCFICWVCPTGVLAGAKLAAYAENRDCAIVNHIVPFFIPCVNIAAAVGLRHNLRCRAQVGLPPKDTSGIIGDTIMVLLCGLCSMAQELRSVDKSTWDWLNEYNTKGMPKTFEEPCIFCIDHV
Ga0315742_1310160713300032756Forest SoilWGGKAGACWELWKCEPCCGEPCTPAEGAWCALCWLCPTGALAGGKLFSYSQGRECAIVNHVVPFFVPCVNLAASISLRHNLRVKAQVGSPPMDTTGIVGDAIMVLICGLCAGAQELRSVDKAAWDWVTEYNTKGIKGFEEPCTLCVDHV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.