Metagenome / Metatranscriptome Family F036260

Basic Information
Family ID	F036260
Family Type	Metagenome / Metatranscriptome
Number of Sequences	170
Average Sequence Length	89 residues
Representative Sequence	MRALVVTSNPATAASEPDSPASALNDLGCEVVAVGYDIDQLPEDIELQRPSVVVVDAGAHLEVGRAAIRRVREVGSLADVPVLLCVEVS
Number of Associated Samples	153
Number of Associated Scaffolds	170

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	58.97 %
% of genes near scaffold ends (potentially truncated)	90.59 %
% of genes from short scaffolds (< 2000 bps)	88.82 %
Associated GOLD sequencing projects	146
AlphaFold2 3D model prediction	No

Most Common Taxonomy
Group	Unclassified (56.471 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.235 % of family members)
Environment Ontology (ENVO)	Unclassified (30.588 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (39.412 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 28.09% β-sheet: 22.47% Coil/Unstructured: 49.44%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 170 Family Scaffolds
PF06689	zf-C4_ClpX	41.18
PF07724	AAA_2	17.06
PF00310	GATase_2	10.59
PF10431	ClpB_D2-small	3.53
PF01258	zf-dskA_traR	1.18
PF04898	Glu_syn_central	1.18
PF13500	AAA_26	0.59
PF00072	Response_reg	0.59
PF00106	adh_short	0.59
PF02954	HTH_8	0.59
PF00160	Pro_isomerase	0.59
PF00069	Pkinase	0.59

COG ID	Name	Functional Category	% Frequency in 170 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.35
COG1734	RNA polymerase-binding transcription factor DksA	Transcription [K]	1.18
COG0652	Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family	Posttranslational modification, protein turnover, chaperones [O]	0.59

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
All Organisms	root	All Organisms	43.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
cellular organisms	root	All Organisms → cellular organisms	43.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	41.76 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	35.29 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.76 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.59 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	34.71 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1.76 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	34.71 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	1.76 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.59 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	18.82 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	15.29 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.76 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.59 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.59 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Nannocystineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.76 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.59 %
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Kofleriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.76 %
unclassified Syntrophaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae	0.59 %
Mycobacteroides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	1.76 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Mycobacteroides abscessus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Paraneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Hemiptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Sternorrhyncha	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Coccoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Coccidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.47 %
Haliangium ochraceum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	18.82 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	15.29 %
Rhodococcus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus	1.76 %
Mycobacteroides abscessus subsp. abscessus	subspecies	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	0.59 %
Syntrophaceae bacterium PtaB.Bin038	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	0.59 %
Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	0.59 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.59 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908006\|FWIROz_GJ87FRN02IDA07	Not Available	515	Open in IMG/M
3300001213\|JGIcombinedJ13530_102872081	Not Available	565	Open in IMG/M
3300002568\|C688J35102_117852589	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	510	Open in IMG/M
3300002568\|C688J35102_118759051	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	593	Open in IMG/M
3300004114\|Ga0062593_102217529	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	616	Open in IMG/M
3300004153\|Ga0063455_100363853	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	832	Open in IMG/M
3300004153\|Ga0063455_101447723	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	533	Open in IMG/M
3300004157\|Ga0062590_102802627	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	521	Open in IMG/M
3300004633\|Ga0066395_11038683	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	501	Open in IMG/M
3300004643\|Ga0062591_102427264	Not Available	550	Open in IMG/M
3300005327\|Ga0070658_11094598	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	693	Open in IMG/M
3300005329\|Ga0070683_101994432	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	558	Open in IMG/M
3300005337\|Ga0070682_101276173	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	623	Open in IMG/M
3300005338\|Ga0068868_100158897	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	1865	Open in IMG/M
3300005338\|Ga0068868_102060242	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	542	Open in IMG/M
3300005340\|Ga0070689_102022100	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	527	Open in IMG/M
3300005354\|Ga0070675_101276750	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300005355\|Ga0070671_100938457	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300005356\|Ga0070674_101516756	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	603	Open in IMG/M
3300005434\|Ga0070709_10908534	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	696	Open in IMG/M
3300005434\|Ga0070709_11781019	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	504	Open in IMG/M
3300005437\|Ga0070710_10467607	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	858	Open in IMG/M
3300005441\|Ga0070700_100957124	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	701	Open in IMG/M
3300005459\|Ga0068867_101718854	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	589	Open in IMG/M
3300005466\|Ga0070685_10400257	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	951	Open in IMG/M
3300005539\|Ga0068853_100134799	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	2213	Open in IMG/M
3300005548\|Ga0070665_101891608	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	603	Open in IMG/M
3300005598\|Ga0066706_11192294	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	578	Open in IMG/M
3300005614\|Ga0068856_101950733	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	598	Open in IMG/M
3300005615\|Ga0070702_101671619	Not Available	529	Open in IMG/M
3300005616\|Ga0068852_101986089	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	604	Open in IMG/M
3300005617\|Ga0068859_101363783	Not Available	782	Open in IMG/M
3300005719\|Ga0068861_100203181	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	1664	Open in IMG/M
3300005764\|Ga0066903_100204696	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	2960	Open in IMG/M
3300005842\|Ga0068858_100831061	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	902	Open in IMG/M
3300005843\|Ga0068860_100158636	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	2180	Open in IMG/M
3300006028\|Ga0070717_11217479	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	685	Open in IMG/M
3300006354\|Ga0075021_10757664	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	626	Open in IMG/M
3300006358\|Ga0068871_101988452	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	553	Open in IMG/M
3300006853\|Ga0075420_100993354	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	722	Open in IMG/M
3300009093\|Ga0105240_11506681	Not Available	705	Open in IMG/M
3300009098\|Ga0105245_10997190	Not Available	882	Open in IMG/M
3300009147\|Ga0114129_13078840	Not Available	546	Open in IMG/M
3300009545\|Ga0105237_11215586	Not Available	760	Open in IMG/M
3300009545\|Ga0105237_11803557	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	619	Open in IMG/M
3300009551\|Ga0105238_10676775	Not Available	1043	Open in IMG/M
3300009792\|Ga0126374_11861367	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	505	Open in IMG/M
3300010037\|Ga0126304_10800295	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300010362\|Ga0126377_10537649	Not Available	1206	Open in IMG/M
3300010362\|Ga0126377_13620129	Not Available	500	Open in IMG/M
3300010366\|Ga0126379_10927368	Not Available	974	Open in IMG/M
3300010366\|Ga0126379_11604461	Not Available	756	Open in IMG/M
3300010371\|Ga0134125_10818008	Not Available	1025	Open in IMG/M
3300010398\|Ga0126383_12043444	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	660	Open in IMG/M
3300010398\|Ga0126383_12499638	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	601	Open in IMG/M
3300010400\|Ga0134122_11152568	Not Available	772	Open in IMG/M
3300010400\|Ga0134122_12048447	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	612	Open in IMG/M
3300010401\|Ga0134121_11416623	Not Available	706	Open in IMG/M
3300011270\|Ga0137391_10265429	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19	1486	Open in IMG/M
3300011399\|Ga0137466_1064443	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	581	Open in IMG/M
3300011441\|Ga0137452_1283432	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	555	Open in IMG/M
3300011443\|Ga0137457_1018686	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1790	Open in IMG/M
3300012204\|Ga0137374_10049246	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum	4360	Open in IMG/M
3300012205\|Ga0137362_10567234	Not Available	980	Open in IMG/M
3300012350\|Ga0137372_10596707	Not Available	810	Open in IMG/M
3300012353\|Ga0137367_10368546	Not Available	1021	Open in IMG/M
3300012354\|Ga0137366_10231169	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus	1375	Open in IMG/M
3300012358\|Ga0137368_10208665	Not Available	1382	Open in IMG/M
3300012532\|Ga0137373_11224337	Not Available	528	Open in IMG/M
3300012901\|Ga0157288_10096152	Not Available	796	Open in IMG/M
3300012916\|Ga0157310_10090091	Not Available	968	Open in IMG/M
3300012944\|Ga0137410_10699097	Not Available	845	Open in IMG/M
3300012961\|Ga0164302_11147759	Not Available	617	Open in IMG/M
3300012988\|Ga0164306_10430830	Not Available	998	Open in IMG/M
3300012988\|Ga0164306_10775191	Not Available	770	Open in IMG/M
3300013296\|Ga0157374_12135135	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	587	Open in IMG/M
3300013297\|Ga0157378_11449603	Not Available	730	Open in IMG/M
3300013307\|Ga0157372_11753402	Not Available	714	Open in IMG/M
3300013832\|Ga0120132_1052288	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	793	Open in IMG/M
3300014745\|Ga0157377_10414403	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus	921	Open in IMG/M
3300014876\|Ga0180064_1057678	Not Available	785	Open in IMG/M
3300014968\|Ga0157379_11820116	Not Available	599	Open in IMG/M
3300014969\|Ga0157376_10961193	Not Available	875	Open in IMG/M
3300015242\|Ga0137412_11110905	Not Available	559	Open in IMG/M
3300015371\|Ga0132258_12544346	Not Available	1280	Open in IMG/M
3300015374\|Ga0132255_102166921	Not Available	847	Open in IMG/M
3300015374\|Ga0132255_105770397	Not Available	524	Open in IMG/M
3300016319\|Ga0182033_11404654	Not Available	629	Open in IMG/M
3300016371\|Ga0182034_11025932	Not Available	713	Open in IMG/M
3300018482\|Ga0066669_11188234	Not Available	688	Open in IMG/M
3300020070\|Ga0206356_10743919	Not Available	517	Open in IMG/M
3300021180\|Ga0210396_11529569	Not Available	547	Open in IMG/M
3300021384\|Ga0213876_10331871	Not Available	809	Open in IMG/M
3300021401\|Ga0210393_10357493	Not Available	1189	Open in IMG/M
3300021404\|Ga0210389_11475310	Not Available	517	Open in IMG/M
3300022756\|Ga0222622_10652448	Not Available	762	Open in IMG/M
3300022756\|Ga0222622_11005893	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	612	Open in IMG/M
3300025911\|Ga0207654_10679803	Not Available	738	Open in IMG/M
3300025916\|Ga0207663_11673556	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	512	Open in IMG/M
3300025924\|Ga0207694_10540098	Not Available	978	Open in IMG/M
3300025926\|Ga0207659_10929398	Not Available	748	Open in IMG/M
3300025929\|Ga0207664_10282115	Not Available	1458	Open in IMG/M
3300025936\|Ga0207670_11759867	Not Available	527	Open in IMG/M
3300026023\|Ga0207677_10427457	Not Available	1130	Open in IMG/M
3300026041\|Ga0207639_11920400	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	553	Open in IMG/M
3300026075\|Ga0207708_11298979	Not Available	637	Open in IMG/M
3300026116\|Ga0207674_10716640	Not Available	966	Open in IMG/M
3300026501\|Ga0256806_1049595	Not Available	760	Open in IMG/M
3300026944\|Ga0207570_1019355	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	538	Open in IMG/M
3300027884\|Ga0209275_10227633	Not Available	1016	Open in IMG/M
3300027905\|Ga0209415_10371650	All Organisms → cellular organisms → Bacteria	1175	Open in IMG/M
3300028563\|Ga0265319_1140816	Not Available	748	Open in IMG/M
3300028876\|Ga0307286_10211797	Not Available	705	Open in IMG/M
3300029987\|Ga0311334_10917746	Not Available	725	Open in IMG/M
3300030002\|Ga0311350_10848682	Not Available	818	Open in IMG/M
3300030838\|Ga0311335_10632143	Not Available	750	Open in IMG/M
3300030988\|Ga0308183_1062927	Not Available	774	Open in IMG/M
3300031232\|Ga0302323_101243249	Not Available	833	Open in IMG/M
3300031232\|Ga0302323_102143165	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	636	Open in IMG/M
3300031240\|Ga0265320_10429402	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	583	Open in IMG/M
3300031344\|Ga0265316_10466282	Not Available	905	Open in IMG/M
3300031544\|Ga0318534_10716500	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	565	Open in IMG/M
3300031562\|Ga0310886_10256208	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus	982	Open in IMG/M
3300031595\|Ga0265313_10120927	Not Available	1142	Open in IMG/M
3300031595\|Ga0265313_10146241	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus	1013	Open in IMG/M
3300031679\|Ga0318561_10418313	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
3300031724\|Ga0318500_10472085	Not Available	629	Open in IMG/M
3300031726\|Ga0302321_100632159	Not Available	1195	Open in IMG/M
3300031751\|Ga0318494_10947948	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	505	Open in IMG/M
3300031753\|Ga0307477_10437101	All Organisms → cellular organisms → Bacteria	894	Open in IMG/M
3300031754\|Ga0307475_10108928	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2170	Open in IMG/M
3300031896\|Ga0318551_10425856	Not Available	757	Open in IMG/M
3300031902\|Ga0302322_100274829	All Organisms → cellular organisms → Bacteria	1881	Open in IMG/M
3300031902\|Ga0302322_101123030	Not Available	951	Open in IMG/M
3300031910\|Ga0306923_11581412	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	682	Open in IMG/M
3300031912\|Ga0306921_12186728	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	584	Open in IMG/M
3300031938\|Ga0308175_102666824	Not Available	559	Open in IMG/M
3300031938\|Ga0308175_103238098	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	505	Open in IMG/M
3300031940\|Ga0310901_10574823	Not Available	513	Open in IMG/M
3300031942\|Ga0310916_10361862	All Organisms → cellular organisms → Bacteria	1233	Open in IMG/M
3300031954\|Ga0306926_13002275	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	504	Open in IMG/M
3300031981\|Ga0318531_10059992	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1630	Open in IMG/M
3300031996\|Ga0308176_12173005	Not Available	593	Open in IMG/M
3300032001\|Ga0306922_10886445	All Organisms → cellular organisms → Bacteria	927	Open in IMG/M
3300032009\|Ga0318563_10668201	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	559	Open in IMG/M
3300032039\|Ga0318559_10480210	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	580	Open in IMG/M
3300032060\|Ga0318505_10253995	Not Available	828	Open in IMG/M
3300032066\|Ga0318514_10483752	Not Available	658	Open in IMG/M
3300032074\|Ga0308173_10624750	Not Available	978	Open in IMG/M
3300032163\|Ga0315281_11527960	Not Available	653	Open in IMG/M
3300032897\|Ga0335071_11989545	Not Available	524	Open in IMG/M
3300033004\|Ga0335084_10432533	Not Available	1354	Open in IMG/M
3300033407\|Ga0214472_11219890	Not Available	655	Open in IMG/M
3300033480\|Ga0316620_11861252	Not Available	597	Open in IMG/M
3300034161\|Ga0370513_114608	Not Available	666	Open in IMG/M
3300034170\|Ga0370487_0169896	Not Available	718	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	71.76%
Host-Associated	Host-Associated	28.24%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	65.29%
Plants	Host-Associated → Plants	28.24%
Aquatic	Environmental → Aquatic	6.47%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.06%
Rhizosphere	Host-Associated → Plants → Rhizosphere	17.65%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.41%
Peat	Environmental → Terrestrial → Peat	8.24%
Sediment	Environmental → Aquatic → Sediment	4.12%
Freshwater	Environmental → Aquatic → Freshwater	1.76%
Roots	Host-Associated → Plants → Roots	1.18%
Marine	Environmental → Aquatic → Marine	0.59%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	40.00%
Loam	Environmental → Terrestrial → Soil → Loam	12.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.82%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.82%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	8.24%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.65%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.71%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.12%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.76%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.18%
Lake	Environmental → Aquatic → Freshwater → Lake	0.59%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.59%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.59%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.59%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.82%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	12.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.82%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.82%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.24%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	8.24%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.65%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.12%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.53%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.94%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.35%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	2.35%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.76%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.76%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.18%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.59%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.59%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.59%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.59%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.59%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.59%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.59%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.59%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.24%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	6.47%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	5.29%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.12%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.12%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.53%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	3.53%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.94%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.35%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.35%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	2.35%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.35%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.35%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.35%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.76%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.76%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	1.76%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.76%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.18%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.18%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.18%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	1.18%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.18%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.18%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.18%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.18%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.59%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.59%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.59%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.59%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.59%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.59%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	0.59%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.59%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.59%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.59%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.59%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.59%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.59%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.59%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.59%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.59%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.59%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908006	Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300009029	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011399	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2	Environmental	Open in IMG/M
3300011441	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2	Environmental	Open in IMG/M
3300011443	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental	Open in IMG/M
3300012916	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013832	Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M	Environmental	Open in IMG/M
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014839	Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014876	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300018030	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300024238	Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T50	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026381	Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T-25	Environmental	Open in IMG/M
3300026501	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR4	Environmental	Open in IMG/M
3300026944	Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes)	Environmental	Open in IMG/M
3300027884	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)	Environmental	Open in IMG/M
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental	Open in IMG/M
3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Host-Associated	Open in IMG/M
3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Host-Associated	Open in IMG/M
3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Host-Associated	Open in IMG/M
3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Host-Associated	Open in IMG/M
3300028876	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030002	II_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030838	I_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030988	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Host-Associated	Open in IMG/M
3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Host-Associated	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Host-Associated	Open in IMG/M
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental	Open in IMG/M
3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Host-Associated	Open in IMG/M
3300031724	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031751	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental	Open in IMG/M
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031918	III_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031940	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300031981	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032060	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18	Environmental	Open in IMG/M
3300032066	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033407	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033890	Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-M	Environmental	Open in IMG/M
3300034161	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_18	Environmental	Open in IMG/M
3300034170	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F036260

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign