NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035983

Metagenome / Metatranscriptome Family F035983

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035983
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 42 residues
Representative Sequence LKTHYNEGSKAIYQGINQILNGRSASSVLPSIQSKLNRILR
Number of Associated Samples 149
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.66 %
% of genes from short scaffolds (< 2000 bps) 92.40 %
Associated GOLD sequencing projects 140
AlphaFold2 3D model prediction Yes
3D model pTM-score0.70

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.719 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.298 % of family members)
Environment Ontology (ENVO) Unclassified
(29.240 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.216 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.38%    β-sheet: 0.00%    Coil/Unstructured: 53.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.70
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF00528BPD_transp_1 45.03
PF00005ABC_tran 0.58
PF13416SBP_bac_8 0.58
PF01569PAP2 0.58



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.72 %
UnclassifiedrootN/A12.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig05600All Organisms → cellular organisms → Bacteria910Open in IMG/M
2170459019|G14TP7Y01D9XISAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300000891|JGI10214J12806_11164697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi555Open in IMG/M
3300000891|JGI10214J12806_11713642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1183Open in IMG/M
3300000956|JGI10216J12902_105180745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300000956|JGI10216J12902_105412641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1565Open in IMG/M
3300000956|JGI10216J12902_112185913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus774Open in IMG/M
3300004081|Ga0063454_101647674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300004114|Ga0062593_100209845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1562Open in IMG/M
3300004114|Ga0062593_101307128Not Available769Open in IMG/M
3300004157|Ga0062590_102025542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium598Open in IMG/M
3300004643|Ga0062591_100116418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1774Open in IMG/M
3300004643|Ga0062591_100169492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1555Open in IMG/M
3300005093|Ga0062594_100664932All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300005171|Ga0066677_10081335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1683Open in IMG/M
3300005181|Ga0066678_10109280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1685Open in IMG/M
3300005187|Ga0066675_11025987All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005332|Ga0066388_100600400All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300005332|Ga0066388_103882591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300005337|Ga0070682_100099813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1915Open in IMG/M
3300005338|Ga0068868_101683447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi597Open in IMG/M
3300005344|Ga0070661_100164634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1681Open in IMG/M
3300005356|Ga0070674_101161799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi684Open in IMG/M
3300005364|Ga0070673_102286506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi514Open in IMG/M
3300005434|Ga0070709_10673944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi802Open in IMG/M
3300005435|Ga0070714_100207966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1793Open in IMG/M
3300005439|Ga0070711_100154313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1734Open in IMG/M
3300005440|Ga0070705_101345044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300005444|Ga0070694_101260662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus621Open in IMG/M
3300005456|Ga0070678_102096673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi536Open in IMG/M
3300005529|Ga0070741_11595485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus535Open in IMG/M
3300005534|Ga0070735_10928834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi510Open in IMG/M
3300005548|Ga0070665_101975873All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005552|Ga0066701_10801686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus561Open in IMG/M
3300005560|Ga0066670_10309576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus961Open in IMG/M
3300005560|Ga0066670_10941942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi526Open in IMG/M
3300005576|Ga0066708_10547113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi746Open in IMG/M
3300005587|Ga0066654_10059994All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300005587|Ga0066654_10226482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus979Open in IMG/M
3300005618|Ga0068864_101798748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300005618|Ga0068864_102061035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi577Open in IMG/M
3300005713|Ga0066905_100044794All Organisms → cellular organisms → Bacteria2657Open in IMG/M
3300005842|Ga0068858_100839854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi897Open in IMG/M
3300006034|Ga0066656_10856172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi582Open in IMG/M
3300006163|Ga0070715_10734589All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300006173|Ga0070716_100927922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi683Open in IMG/M
3300006196|Ga0075422_10369378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi629Open in IMG/M
3300006358|Ga0068871_100514073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1081Open in IMG/M
3300006606|Ga0074062_12744886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi929Open in IMG/M
3300006755|Ga0079222_11351086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus655Open in IMG/M
3300006852|Ga0075433_10545144All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300006881|Ga0068865_100841955All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300009094|Ga0111539_11946959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300009098|Ga0105245_11721245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300009137|Ga0066709_101610131All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300009174|Ga0105241_11455821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300009177|Ga0105248_10475132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1409Open in IMG/M
3300009177|Ga0105248_11395460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium793Open in IMG/M
3300009545|Ga0105237_11184749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300009553|Ga0105249_10535516All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300009792|Ga0126374_11077177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium636Open in IMG/M
3300010040|Ga0126308_10485415All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300010043|Ga0126380_10053557All Organisms → cellular organisms → Bacteria2195Open in IMG/M
3300010105|Ga0127470_1019739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium719Open in IMG/M
3300010303|Ga0134082_10345431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300010304|Ga0134088_10680328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300010329|Ga0134111_10127834Not Available993Open in IMG/M
3300010337|Ga0134062_10692844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300010360|Ga0126372_11012424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium843Open in IMG/M
3300010371|Ga0134125_12116919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi612Open in IMG/M
3300010399|Ga0134127_10058127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3229Open in IMG/M
3300010401|Ga0134121_10888107All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300010403|Ga0134123_12600731Not Available573Open in IMG/M
3300011119|Ga0105246_12059537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300012198|Ga0137364_10509825All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300012212|Ga0150985_103278698All Organisms → cellular organisms → Bacteria2606Open in IMG/M
3300012212|Ga0150985_106503354All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300012360|Ga0137375_11207285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300012362|Ga0137361_10603829All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300012469|Ga0150984_100983445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300012481|Ga0157320_1024758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300012501|Ga0157351_1027172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300012532|Ga0137373_10599274Not Available831Open in IMG/M
3300012884|Ga0157300_1056930Not Available630Open in IMG/M
3300012892|Ga0157294_10123052Not Available692Open in IMG/M
3300012895|Ga0157309_10374115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300012906|Ga0157295_10189702All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300012907|Ga0157283_10113015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium747Open in IMG/M
3300012909|Ga0157290_10038788Not Available1168Open in IMG/M
3300012911|Ga0157301_10318827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → Thermobaculum → Thermobaculum terrenum574Open in IMG/M
3300012948|Ga0126375_12031004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300012951|Ga0164300_10607291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300012955|Ga0164298_10137682All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300012958|Ga0164299_10594579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium755Open in IMG/M
3300012960|Ga0164301_11500727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300012961|Ga0164302_11251249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300012972|Ga0134077_10249495All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300012984|Ga0164309_10665969All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300012984|Ga0164309_11634497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300012986|Ga0164304_10329328Not Available1058Open in IMG/M
3300012989|Ga0164305_11681595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300013307|Ga0157372_10580294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1307Open in IMG/M
3300013307|Ga0157372_11894706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium685Open in IMG/M
3300014969|Ga0157376_12321926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300015201|Ga0173478_10463513Not Available625Open in IMG/M
3300015371|Ga0132258_10986739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2128Open in IMG/M
3300015374|Ga0132255_101557946All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300017792|Ga0163161_11681109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300017959|Ga0187779_11285357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300018060|Ga0187765_11329188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300018073|Ga0184624_10179601All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300018482|Ga0066669_10121470All Organisms → cellular organisms → Bacteria1862Open in IMG/M
3300019279|Ga0184642_1182035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300019279|Ga0184642_1655709All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300019356|Ga0173481_10268000All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300021951|Ga0222624_1617671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300022694|Ga0222623_10061198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1453Open in IMG/M
3300022756|Ga0222622_10344973All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300022886|Ga0247746_1033871All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300023264|Ga0247772_1080757Not Available693Open in IMG/M
3300023266|Ga0247789_1034981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi889Open in IMG/M
3300024310|Ga0247681_1030911All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300025908|Ga0207643_10875636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Friedmanniella → Friedmanniella luteola582Open in IMG/M
3300025917|Ga0207660_10315033All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300025920|Ga0207649_11231319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300025921|Ga0207652_10134511All Organisms → cellular organisms → Bacteria2207Open in IMG/M
3300025921|Ga0207652_10442838Not Available1171Open in IMG/M
3300025925|Ga0207650_10673778All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300025927|Ga0207687_11592972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300025935|Ga0207709_11066226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi663Open in IMG/M
3300025944|Ga0207661_11579798Not Available600Open in IMG/M
3300026035|Ga0207703_11094619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi765Open in IMG/M
3300026041|Ga0207639_10244312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1562Open in IMG/M
3300026095|Ga0207676_11782862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300026121|Ga0207683_10310837All Organisms → cellular organisms → Bacteria1442Open in IMG/M
3300026121|Ga0207683_11371886All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300026142|Ga0207698_11367111Not Available723Open in IMG/M
3300026142|Ga0207698_11949481Not Available602Open in IMG/M
3300026142|Ga0207698_12087409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300026326|Ga0209801_1059791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1711Open in IMG/M
3300026343|Ga0209159_1061966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1768Open in IMG/M
3300026530|Ga0209807_1109800Not Available1168Open in IMG/M
3300027993|Ga0247749_1005724All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300028380|Ga0268265_10169348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1865Open in IMG/M
3300028380|Ga0268265_11665998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300028713|Ga0307303_10028249Not Available1112Open in IMG/M
3300028715|Ga0307313_10005873All Organisms → cellular organisms → Bacteria2941Open in IMG/M
3300028715|Ga0307313_10054886All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300028720|Ga0307317_10047890All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300028721|Ga0307315_10091642All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300028768|Ga0307280_10023543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1791Open in IMG/M
3300028784|Ga0307282_10049317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1877Open in IMG/M
3300028787|Ga0307323_10170657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium786Open in IMG/M
3300028799|Ga0307284_10023841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1991Open in IMG/M
3300028811|Ga0307292_10060186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → Thermobaculum1437Open in IMG/M
3300028814|Ga0307302_10050910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1927Open in IMG/M
3300028824|Ga0307310_10329046Not Available748Open in IMG/M
3300028828|Ga0307312_10015776All Organisms → cellular organisms → Bacteria4241Open in IMG/M
3300028828|Ga0307312_10062285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2252Open in IMG/M
3300031421|Ga0308194_10118555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium783Open in IMG/M
3300031562|Ga0310886_10075427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1611Open in IMG/M
3300031640|Ga0318555_10775016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300031847|Ga0310907_10218132Not Available921Open in IMG/M
3300031852|Ga0307410_12058414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300031938|Ga0308175_102301192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium604Open in IMG/M
3300031996|Ga0308176_10113136All Organisms → cellular organisms → Bacteria2412Open in IMG/M
3300032829|Ga0335070_10527803All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300033551|Ga0247830_10586052All Organisms → cellular organisms → Bacteria882Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.51%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.34%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.34%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.75%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.17%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.17%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.17%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.17%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.17%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.58%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.58%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.58%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.58%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.58%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.58%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.58%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.58%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010105Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012389Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023264Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_002969902124908016VTRPAKYLKTHYNEGSKDIYQGISQILNGTPAKNVLPGIASKLERLVR
4MG_016335702170459019Switchgrass, Maize And Mischanthus LitterLKTHYNEGSKDIYQGINQILNGTPASSVLPGIQSKLQRLVR
JGI10214J12806_1116469723300000891SoilSNILGAHYNEGSKAIYQGINQILNGRSASSVLPGVQAKLQRILR*
JGI10214J12806_1171364213300000891SoilRPAKFLKTHYNEASKIIYQGINQILNGTPAKSVLPSIQSKLNTLLKK*
JGI10216J12902_10518074523300000956SoilYNEASKVIYQGVNQILNGTPAKNVLPGMQSKLNQIIKQH*
JGI10216J12902_10541264133300000956SoilNEGSKDIYQGISQILNGTPAKTVLPSIASKLQRLVK*
JGI10216J12902_11218591323300000956SoilRPAKFLKTHYNEASKVIYQGVNQILNGTPAKNVLPSVQSKLNQIIK*
C688J35102_11842660013300002568SoilVPRATRPSSALGAKYNEGSKDIYQAISRILNGAKAQSVLPGLQAQLQRLLR*
Ga0063454_10164767423300004081SoilKYNEGSKDIYQAISRILNGASAQSVLPGLQSQLNSLLKK*
Ga0062593_10020984533300004114SoilAKFLKTHYNEASKVIYQGINQILNGTPAKSVLPGVQSKLNQILKAK*
Ga0062593_10130712813300004114SoilTHYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK*
Ga0062590_10202554223300004157SoilRPAKFLKTHYNEASKVIYQGVNQILNGTPAKNVLPGMQSKLNQIIK*
Ga0062591_10011641833300004643SoilRPAKYLKTHYNEGSKDIYQGISQILNGTPAGSVLPSIASKLNALVK*
Ga0062591_10016949213300004643SoilLKTHYNEASKVIYQGINQILNGAPAKSVLPGVQSKLNQILKAK*
Ga0062594_10066493213300005093SoilHYNEASKVIYQGINQILNGTPAKSVLPGMQSKLNQILKQK*
Ga0066677_1008133533300005171SoilAKFLGTHYNEASKVVYQGINQILTGSSSSQVLPQIKSKLQQILKSK*
Ga0066678_1010928013300005181SoilRPSKFLKTHYNEASKAIYQGINQILNGASASSQLPQIKSKLQQILQGA*
Ga0066675_1102598713300005187SoilLGTHYNEGSKDIYQGISQILNGTPAKNVLPSISSKLQRLVK*
Ga0066388_10060040013300005332Tropical Forest SoilKTHYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQIIKQG*
Ga0066388_10388259113300005332Tropical Forest SoilKTHYNEASKVIYQGINQILNGTPAKNVLPGMQSKLNQIIK*
Ga0070682_10009981333300005337Corn RhizosphereAKYLKTHYNEGSKDIYQGISQILNGAPASSVLPGIQSKLEQLVKS*
Ga0068868_10168344723300005338Miscanthus RhizosphereLGSKYNEGSKDIYQAISRILNGSPASSVLPGLQSQLQGLLKK*
Ga0070661_10016463433300005344Corn RhizosphereLKTHYNEGSKAIYQGINQILNGKSANSVLPGIQSQLNRILR*
Ga0070674_10116179913300005356Miscanthus RhizosphereHYNEGSKVIYQGISQILNGASASSVLPSIQSKLQQLVKQ*
Ga0070673_10228650623300005364Switchgrass RhizosphereKFLKTHYNEASKAIYQGINQILNGTPASSVLPGVQSKLNQILKEH*
Ga0070709_1067394413300005434Corn, Switchgrass And Miscanthus RhizosphereVARPSKFLKTHYNEASKAIYQGINQILNGTPASSVLPGIQSKLNQILKEH*
Ga0070714_10020796613300005435Agricultural SoilPSKFLKTHYNEASKAIFQGINQILNGTPAKSVLPSLQSKLNTILKEK*
Ga0070711_10015431333300005439Corn, Switchgrass And Miscanthus RhizosphereKFLKTHYNEASKAIFQGINQILNGTPAKSVLPSLQSKLNTILKEK*
Ga0070705_10134504413300005440Corn, Switchgrass And Miscanthus RhizosphereVTRPAKYLKTHYNEGSKDIYQGISQILNGTPASSVLPSIASKLNALVK*
Ga0070694_10126066223300005444Corn, Switchgrass And Miscanthus RhizosphereAKFLGKNYNEASKVIYQGINQILTGTPASQVLPQIKSRLQQIMK*
Ga0070678_10209667313300005456Miscanthus RhizosphereVLGAKYNEGSKDIYQAISRILNGASAESVLPGLQSQLQALLS*
Ga0070741_1159548513300005529Surface SoilYNEASKVIYQGINQILTGSSASQVLPQIKSRLQQIKK*
Ga0070735_1092883413300005534Surface SoilPANSLKSHYNEGSQAIYQGINQILNGTPASSVLPGIASKLQSLLS*
Ga0070665_10197587333300005548Switchgrass RhizosphereHYNEGSKDIYQGISQILNGKPAKNVLPTVQAQLERIVR*
Ga0066701_1080168613300005552SoilPARFLGTHYNEASKVIYQGINQILNGTPAKNVLPGISSKLNQILKQK*
Ga0066670_1030957613300005560SoilRPAKFLKGKYNAGSKVIYQGVNEILQGQSASRVLPSIKSKLQRLLR*
Ga0066670_1094194213300005560SoilQYNAGSKAIYQGINEILNGQSAKNVLPSIESKLKRLLH*
Ga0066708_1054711323300005576SoilNEGSKAIYQGINQILNGTPAKQVLPGIASKLKRLVG*
Ga0066654_1005999413300005587SoilYNEGSKDIYQGISQILNGTPAKSVLPGIASKLQRLVK*
Ga0066654_1022648223300005587SoilRPAKFLKGKYNAGSKVIYQGINEILQGQSASRVLPSIKSKLQRLLR*
Ga0068864_10179874813300005618Switchgrass RhizosphereKFLKTHYNEASKVIYQGINQILNGTPAKSVLPGMQSKLNQILKQK*
Ga0068864_10206103513300005618Switchgrass RhizosphereYNEGSKDIYQGINQILNGDSADSVLPTIQRKLEQLVQ*
Ga0066905_10004479413300005713Tropical Forest SoilSKVVYQGINQILTGTPASQVLPQVKARLEQILKSK*
Ga0068858_10083985423300005842Switchgrass RhizosphereVTRPANSLKTHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLDRILR*
Ga0066656_1085617223300006034SoilNEASKVIYQGVNQILNGSSAGSVLPSIQSKLNQILKSR*
Ga0070715_1073458923300006163Corn, Switchgrass And Miscanthus RhizosphereHYNEGSKDIYQGISQILNGTPASSVLPRIQSELQRLLR*
Ga0070716_10092792213300006173Corn, Switchgrass And Miscanthus RhizosphereVARPSKFLKTHYNEASKAIYQGINQILNGTPASSVLPGVQSKLNQILKEH*
Ga0075422_1036937823300006196Populus RhizosphereLKTHYNEGSKAIYQGINQILNGRSASSVLPSIQSKLNRILR*
Ga0068871_10051407313300006358Miscanthus RhizosphereLKTHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLDRILR*
Ga0074062_1274488623300006606SoilHYNEGSKAIYQGINQILNGRPASSVLPSIESKLNRILR*
Ga0079222_1135108623300006755Agricultural SoilFGTQYNEASKIIYQGINQILTGSSASQVLPQIKSKLQQIKH*
Ga0075433_1054514423300006852Populus RhizosphereSKAIYQGINQILNGTPASSVLPGIQSKLNQILKEH*
Ga0068865_10084195523300006881Miscanthus RhizosphereTVARVTRPARYLGSHYNEGSKVIYQGISQILNGASASSVLPSIQSKLEQLVK*
Ga0111539_1194695923300009094Populus RhizosphereGPHYNEASKVVYQGINQILTGAPASQVLPQIKSRLEQILKSK*
Ga0105245_1172124513300009098Miscanthus RhizosphereKIIYQGVNQILNGTPAKSVLPSMQSKLNTLLKQK*
Ga0066709_10161013113300009137Grasslands SoilAKFLKTHYNEASKVIYQGVNQILNGRSAKSVLPGIQAKLNQIIKRH*
Ga0105241_1145582113300009174Corn RhizosphereKVIYQGINQILNGTPAKNVLPGIQSKLNQILKQK*
Ga0105248_1047513233300009177Switchgrass RhizosphereHYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK*
Ga0105248_1139546023300009177Switchgrass RhizosphereVLGAKYNEGSKDIYQGISQILNGAPASSVLPGIQSKLEQLVKS*
Ga0105237_1118474933300009545Corn RhizosphereSKVIYQGINQILNGTPAKSVLPGMQSKLNQILKQK*
Ga0105249_1053551613300009553Switchgrass RhizosphereGSKDIYQGISQILNGTPASSVLPSIASKLNALVK*
Ga0126374_1107717723300009792Tropical Forest SoilTRPAKFLGARYNEASKVIYQGINQILTGTPASQVLPQIKSRLQQIMK*
Ga0126308_1048541513300010040Serpentine SoilTRPSKFLKTHYNEGSKDIYQGISQILNGTPANSVLPGVQSKLDRLLR*
Ga0126380_1005355713300010043Tropical Forest SoilNEASKVIYQGINQILNGTPAKSVLPGVQAKLNQILKQK*
Ga0127470_101973923300010105Grasslands SoilTRPAKFLKGKYNAGSKVIYQGVNEILQGQSASRVLPSIKSKLQRLLR*
Ga0134082_1034543113300010303Grasslands SoilSGSKVIYQGVNEILRGTPAKNVLPSIESKLKRLLR*
Ga0134088_1068032813300010304Grasslands SoilNEASKVVYQAINQILTGSSASQVLPQIKSRLEQILKSK*
Ga0134111_1012783413300010329Grasslands SoilEASKVVYQGINQILTGSPASKVLPQIKAKLQQIMK*
Ga0134062_1069284423300010337Grasslands SoilRPAKFLKTHYNEASKVIYQGVNQILNGRSAKSVLPGIQAKLNQIIKRH*
Ga0126372_1101242413300010360Tropical Forest SoilSKAIYQGINQILNGTPASSVLPGVQSKLNQILKEK*
Ga0134125_1211691923300010371Terrestrial SoilPSNILGAHYNEGSKAIYQGINQILNGRSASSVLPGVQAKLQRILR*
Ga0134127_1005812713300010399Terrestrial SoilARVTRPAKYLKTHYNEGSKDIYQGISQILNGTPAGSVLPSVASKLNALIK*
Ga0134121_1088810723300010401Terrestrial SoilKFLKTHYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK*
Ga0134123_1260073113300010403Terrestrial SoilEGSKTIYQGINQILNGRPASSVLPGVQSKLQRILR*
Ga0105246_1205953713300011119Miscanthus RhizosphereLGTHYNEGSKIIYQGISQILNGQDANSVLPSIQSKLDRLVK*
Ga0137364_1050982513300012198Vadose Zone SoilARPSKFLKTHYNEASKAIFQGINQILNGTPAKNVLPGLQSKLNTILKEK*
Ga0150985_10068672733300012212Avena Fatua RhizospherePRATRPSTVLGAKYNEGSKAIYQAVSRILNGASASSVLPGLQSQLQALIK*
Ga0150985_10327869813300012212Avena Fatua RhizosphereKYLKTHYNEGSKDIYQGINQILNGDSADSVLPTIQRKLEQLVQ*
Ga0150985_10650335423300012212Avena Fatua RhizosphereANSLKGKYNEGSKYIYQGISQILNGQSASSVLPSIQSRLQRLLR*
Ga0137375_1120728523300012360Vadose Zone SoilGTHYNEGSKAIYQGINQILNGTPASRVLPSIQSKLERLVK*
Ga0137361_1060382913300012362Vadose Zone SoilYNEASKVIYQGINQILNGTSASSVLPSVQSKLNQILKQG*
Ga0134040_108065713300012389Grasslands SoilPRATRPSSALGSKYNEGSKDIYQAISRILNGASAQSVLPGLQSQLNSLLKK*
Ga0150984_10098344523300012469Avena Fatua RhizosphereGSKDIYQGINQILNGDSADSVLPTIQRKLEQLVQ*
Ga0157320_102475823300012481Arabidopsis RhizosphereLKSHYNEGSKAIYQGINQILNGRSASSVLPGVESKLNRILR*
Ga0157351_102717223300012501Unplanted SoilSKVVYQGINQILTGSSSRQVLPQIKARLEQILKSK*
Ga0137373_1059927413300012532Vadose Zone SoilLKAKYNAGSKDIYQGINQILNGKDAKSVLPSIQSKLQRLIR*
Ga0157300_105693013300012884SoilHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLNRILR*
Ga0157294_1012305213300012892SoilNILGAHYNEGSKAIYQGINQILNGRSASSVLPGVQAKLQRILR*
Ga0157309_1037411523300012895SoilSLKTHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLDRILR*
Ga0157295_1018970233300012906SoilSKAIYQGINQILNGRSASSVLPSIQAKLERIVPR*
Ga0157283_1011301523300012907SoilLGAHYNEGSKAIYQGINQILNGRSASSVLPGVQAKLQRILR*
Ga0157290_1003878813300012909SoilHYNEGSKAIYQGINQILNGRSASSVLPGVESKLNRILR*
Ga0157301_1031882713300012911SoilTRPANSLKTHYNEGSKAIYQGINQILNGRSASSVLPSIQSKLNRILR*
Ga0126375_1203100413300012948Tropical Forest SoilPAKFLGARYNEASKVIYQGINQILTGTPASQVLPQIKSRLQQIMK*
Ga0164300_1060729113300012951SoilTRPARDLKTHYNEGSKAIYQGFSQILNGTPASSVLPSIQSKLDRLAK*
Ga0164298_1013768213300012955SoilKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK*
Ga0164299_1059457923300012958SoilVTRPARYLGTHYNEGSKDIYQGISQILNGQPAKNVLPSIQSKLERLVK*
Ga0164301_1150072723300012960SoilHYNEASKDVYQGINQILTGTPASQVLPQIKQKLQLLLKK*
Ga0164302_1125124923300012961SoilRPSKFLKTHYNEASKAIYQGINQILNGTPASSVLPGVQSKLNQILKEH*
Ga0134077_1024949513300012972Grasslands SoilKYNEGSKDIYQAISRILNGASAQSVLPGLQAQLQRLLK*
Ga0164309_1066596923300012984SoilVARPSKFLKTHYNEASKAIFQGINQILNGTPAKSVLPSLQSKLNTILKEK*
Ga0164309_1163449713300012984SoilVTRPARYLGTHYNEGSKDIYQGISQILNGQPAKNVLPSIQSK
Ga0164304_1032932813300012986SoilARSLKTHYNEGSKAIYQGINQILNGKSANSVLPGIQSQLNRILR*
Ga0164305_1168159513300012989SoilSKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK*
Ga0157372_1058029433300013307Corn RhizosphereYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK*
Ga0157372_1189470623300013307Corn RhizosphereYNEGSKDIYQGISQILNGTPASSVLPSIASKLNALVK*
Ga0157376_1232192613300014969Miscanthus RhizosphereRPSTALGAKYNEGSKDIYQAISRILNGAKAQSVLPGLQAQLQRLLR*
Ga0173478_1046351313300015201SoilEGSKAIYQGINQILNGRSASSVLPGVESKLNRILR*
Ga0132258_1098673943300015371Arabidopsis RhizosphereKTHYNEASKVIYQGINQILNGTPAKSVLPGMQAKLNQIIK*
Ga0132255_10155794613300015374Arabidopsis RhizosphereKTHYNEGSKAIYQGINQILNGRSASSVLPSIQSKLQRILR*
Ga0163161_1168110913300017792Switchgrass RhizospherePARYLGTHYNEGSKIIYQGISQILNGQDANSVLPSIQSKLDRLVK
Ga0187779_1128535723300017959Tropical PeatlandPSSILGVKYNEGSKDIYQAINRILNGASASSVLPGLQSQLQALLKK
Ga0187765_1132918823300018060Tropical PeatlandARVTRPARYLGTHYNEGSKDIYQGISQILNGASASSVLPSIQSKLQQLVK
Ga0184624_1017960113300018073Groundwater SedimentNEASKVVYQGINQILTGSSASQVLPQIKSRLEQILKSK
Ga0066669_1012147033300018482Grasslands SoilLKAKYNSGSKVIYQGINQILRGTPAKNVLPSIESKLKRLLR
Ga0184642_118203523300019279Groundwater SedimentGTHYNEGSKAIYQGISQILNGQKANKVLPSIKAKLERLLR
Ga0184642_165570913300019279Groundwater SedimentTHYNEGSKAIYQGISQILNGQKANKVLPSIKAKLERLLR
Ga0173481_1026800013300019356SoilVTRPAKYLKTHYNEGSKDIYQGVSQILNGTPASSVLPSVASKLNALVK
Ga0222624_161767113300021951Groundwater SedimentSNALGAKYNEGSKIIYQGISQILNGKPAKDVLPTIQAQLERLAK
Ga0222623_1006119833300022694Groundwater SedimentASYNEGSKDIYQGISQILNGTPAKNVLPSIASKLQRLVK
Ga0222622_1034497323300022756Groundwater SedimentKYLKASYNEGSKDIYQGISQILNGTPAKNVLPSIASKLQRLVK
Ga0247746_103387113300022886SoilTHYNEASKVIYQGVNQILNGTPAKNVLPGMQSKLNQIIK
Ga0247772_108075713300023264Plant LitterNEGSKAIYQGINQILNGRPASSVLPSIQSKLNRILR
Ga0247789_103498113300023266SoilTRPANSLKTHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLDRILR
Ga0247681_103091113300024310SoilEASKVIYQGVNQILNGASAKSVLPGMKSKLQQILKSK
Ga0207643_1087563613300025908Miscanthus RhizosphereLKAHYNEGSKDIYQGINQILNGDSADSVLPTIQRKLEQLVQ
Ga0207660_1031503333300025917Corn RhizosphereYNEASKAIYQGINQILNGTPASSVLPGVQSKLNQILKEH
Ga0207649_1123131913300025920Corn RhizosphereAKYLKTHYNEGSKDIYQGISQILNGTPASSVLPSIASKLNALVK
Ga0207652_1013451113300025921Corn RhizosphereNILGAHYNEGSKAIYQGINQILNGRSASSVLPGVQAKLQRILR
Ga0207652_1044283813300025921Corn RhizosphereSLKTHYNEGSKAIYQGINQILNGKSANSVLPGIQSQLNRILR
Ga0207650_1067377813300025925Switchgrass RhizosphereTHYNEGSKAIYQGINQILNGRSASSVLPGIQSKLERILR
Ga0207687_1159297223300025927Miscanthus RhizosphereVTRPARYLGTHYNEGSKVIYQGVSQILNGASASSVLPSIQSKLEQLVK
Ga0207709_1106622623300025935Miscanthus RhizosphereYLKTHYNEGSKAIYQGINQILNGTPAKSVLPSIQSKLQRLLR
Ga0207661_1157979823300025944Corn RhizosphereTHYNEGSKDIYQGISQILNGKPAKNVLPTVQAQLERIVR
Ga0207703_1109461913300026035Switchgrass RhizosphereVTRPANSLKTHYNEGSKAIYQGINQILNGRPASSVLPSIQSKLDRILR
Ga0207639_1024431213300026041Corn RhizosphereTHYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK
Ga0207676_1178286213300026095Switchgrass RhizosphereRPAKYLKAHYNEGSKDIYQGINQILNGDSADSVLPTIQRKLEQLVQ
Ga0207683_1031083713300026121Miscanthus RhizosphereRYLGTHYNEGSKIIYQGISQILNGQDANSVLPSIQSKLDRLVK
Ga0207683_1137188623300026121Miscanthus RhizosphereHYNEGSKDIYQGISQILNGKPAKDVLPTIQAQLDRIVK
Ga0207698_1136711113300026142Corn RhizospherePARDLKTHYNEGSKAIYQGINQILNGRPASSVLPSIESKLNRILR
Ga0207698_1194948123300026142Corn RhizosphereNSLKSHYNEGSKAIYEGINQILNGRSASSVLPGVESKLNRILR
Ga0207698_1208740913300026142Corn RhizosphereARVTRPARYLGTHYNEGSKDIYQGISQILNGTPASSVLPSIASKLNALVK
Ga0209801_105979113300026326SoilRPSKFLKTHYNEASKAIYQGINQILNGASASSQLPQIKSKLQQILQGA
Ga0209159_106196633300026343SoilFLKTHYNEASKVIYQGINQILNGRSAKSVLPGIQAKLNQIIKRH
Ga0209807_110980023300026530SoilYNAGSKVIYQGVNEILQGQSASRVLPSIKSKLQRLLR
Ga0247749_100572413300027993SoilLKTHYNEASKVIYQGVNQILNGTPAKNVLPGMQSKLNQIIK
Ga0268265_1016934833300028380Switchgrass RhizosphereHYNEGSKAIYQGINQILNGRPASSVLPSIESKLNRILR
Ga0268265_1166599823300028380Switchgrass RhizosphereTRPAKFLKTHYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK
Ga0307303_1002824913300028713SoilHYNEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK
Ga0307313_1000587353300028715SoilKYLKTHYNEGSKDIYQGISQILNGTPAGSVLPGVASKLNALVK
Ga0307313_1005488623300028715SoilGAHYNEASKIIYQGVNQILNGTPAKSVLPSMQSKLNTLLKQK
Ga0307317_1004789013300028720SoilEASKVIYQGINQILNGTPAKNVLPGVQSKLNQILKQK
Ga0307315_1009164213300028721SoilGAKYNEGSKAIYQAINRILNGASASSVLPGLQSQLQALLK
Ga0307280_1002354313300028768SoilRATRPSKYLKASYNEGSKDIYQGISQILNGTPAKNVLPSISSKLQRLVK
Ga0307282_1004931733300028784SoilVTRATRPSKYLKASYNEGSKDIYQGISQILNGTPAKNVLPSISSKLQRLVK
Ga0307323_1017065723300028787SoilGKFFGTHYNEASKIVYQGINQILTGSPASSVLPQIKSRLQQIKK
Ga0307284_1002384113300028799SoilTRATRPSKYLKASYNEGSKDIYQGISQILNGTPAKNVLPSISSKLQRLVK
Ga0307292_1006018633300028811SoilTRPAKYLGTHYNEGSKAIYQGISQILNGQKANKVLPSIKAKLERLLR
Ga0307302_1005091033300028814SoilGAHYNEGSKAIYQGISQILNGQKANKVLPSIKAKLERLLR
Ga0307310_1032904613300028824SoilNEGSKAIYQGISQILNGQKANKVLPSIKAKLERLLR
Ga0307312_1001577653300028828SoilYNEASKVVYQGINQILTGSSASQVLPQIKSRLEQILKSK
Ga0307312_1006228543300028828SoilKFFGTHYNEASKIVYQGINQILTGSPASSVLPQIKSRLQQIKK
Ga0308194_1011855523300031421SoilFLKGHYNEGSKIIYQGINQILNGADAKSVLPGIQSRLNRLLK
Ga0310886_1007542713300031562SoilKTHYNEGSKAIYQGINQILNGRPASSVLPSIESKLNRILR
Ga0318555_1077501613300031640SoilGSKDIYQAISRILNGSTAQSVLPGLQSQLNALLKK
Ga0310907_1021813213300031847SoilTHYNEGSKAIYQGINQILNGRPASSVLPSIESKLNRILR
Ga0307410_1205841413300031852RhizosphereKFLKTHYNEASKVVYQGVNQILNGTPAKNVLPGVESKLNRIIK
Ga0308175_10230119223300031938SoilKTHYNEGSKAIYQGINQILNGRSANSVLPGIQSKLNRILR
Ga0308176_1011313643300031996SoilAKFLKTHYNEASKVIYQGVNQILNGTPAKNVLPSMQSKLNQIIK
Ga0335070_1052780323300032829SoilTHYNEGSKDIYQGISQILNGKPAKDVLPTIQSQLEQLVK
Ga0247830_1058605223300033551SoilTHYNEGSKDIYQGISQILNGTPASSVLPSIASKLNALVK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.