NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F035950

Metagenome Family F035950

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035950
Family Type Metagenome
Number of Sequences 171
Average Sequence Length 46 residues
Representative Sequence IAAYKEPWYGEYDTKAVAIVHNIIRGGTTVPKGLKELAALQKSLA
Number of Associated Samples 142
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.42 %
% of genes from short scaffolds (< 2000 bps) 94.15 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.450 % of family members)
Environment Ontology (ENVO) Unclassified
(29.825 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.123 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.95%    β-sheet: 0.00%    Coil/Unstructured: 52.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF00528BPD_transp_1 41.52
PF04338DUF481 0.58
PF00583Acetyltransf_1 0.58
PF08308PEGA 0.58
PF01039Carboxyl_trans 0.58
PF00069Pkinase 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.34
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.58
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.58
COG3137Putative salt-induced outer membrane protein YdiYCell wall/membrane/envelope biogenesis [M] 0.58
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.58

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c1132383All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300000890|JGI11643J12802_12071318All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300000891|JGI10214J12806_11084919All Organisms → cellular organisms → Bacteria2480Open in IMG/M
3300000955|JGI1027J12803_100974566All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300002907|JGI25613J43889_10063836All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300004268|Ga0066398_10028960All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300004479|Ga0062595_101749507All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005093|Ga0062594_100575528All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300005177|Ga0066690_10046965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2613Open in IMG/M
3300005186|Ga0066676_10099248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1764Open in IMG/M
3300005332|Ga0066388_103681672All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300005332|Ga0066388_104338739All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300005434|Ga0070709_10759881All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005440|Ga0070705_100235687All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300005444|Ga0070694_100540360All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300005444|Ga0070694_101103895All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005444|Ga0070694_101359259All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300005445|Ga0070708_100179483All Organisms → cellular organisms → Bacteria1978Open in IMG/M
3300005445|Ga0070708_100217215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus roseus1792Open in IMG/M
3300005445|Ga0070708_100398644All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300005445|Ga0070708_100619041All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300005445|Ga0070708_100953890All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300005451|Ga0066681_10032935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2748Open in IMG/M
3300005467|Ga0070706_102085073All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005540|Ga0066697_10283527All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300005545|Ga0070695_100602284All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300005546|Ga0070696_101269539All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300005549|Ga0070704_100320001All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300005555|Ga0066692_10604713All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300005577|Ga0068857_100749788All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300005617|Ga0068859_100770591All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300005713|Ga0066905_100383807All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300005713|Ga0066905_100765425All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300005719|Ga0068861_101115869All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300005764|Ga0066903_108257849All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005841|Ga0068863_102076563All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300005843|Ga0068860_100420704All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300006031|Ga0066651_10580151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria595Open in IMG/M
3300006034|Ga0066656_10136578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus1523Open in IMG/M
3300006046|Ga0066652_101897691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria535Open in IMG/M
3300006049|Ga0075417_10749960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus504Open in IMG/M
3300006169|Ga0082029_1721157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus541Open in IMG/M
3300006791|Ga0066653_10575679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria571Open in IMG/M
3300006800|Ga0066660_10186147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus1571Open in IMG/M
3300006806|Ga0079220_10289613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus1005Open in IMG/M
3300006844|Ga0075428_100889229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus945Open in IMG/M
3300006845|Ga0075421_101156565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria866Open in IMG/M
3300006852|Ga0075433_10008203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8323Open in IMG/M
3300006853|Ga0075420_100585042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus964Open in IMG/M
3300006854|Ga0075425_100216765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2201Open in IMG/M
3300006871|Ga0075434_100697160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1033Open in IMG/M
3300006871|Ga0075434_101026355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus838Open in IMG/M
3300006880|Ga0075429_100651087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus923Open in IMG/M
3300006880|Ga0075429_102013506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus500Open in IMG/M
3300006894|Ga0079215_10366988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus832Open in IMG/M
3300006904|Ga0075424_100891931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus949Open in IMG/M
3300006904|Ga0075424_101618612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus686Open in IMG/M
3300006931|Ga0097620_101234148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus823Open in IMG/M
3300006969|Ga0075419_10936494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria627Open in IMG/M
3300007076|Ga0075435_100329457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp.1307Open in IMG/M
3300007076|Ga0075435_100542493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus1007Open in IMG/M
3300009088|Ga0099830_10947276All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300009089|Ga0099828_11059780All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300009090|Ga0099827_10314567All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300009090|Ga0099827_10867494All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium782Open in IMG/M
3300009092|Ga0105250_10542284All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium533Open in IMG/M
3300009098|Ga0105245_10861608All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300009100|Ga0075418_10316694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp.1664Open in IMG/M
3300009137|Ga0066709_103613619All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300009147|Ga0114129_10489141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp.1609Open in IMG/M
3300009148|Ga0105243_12608217All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300009162|Ga0075423_12210488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli598Open in IMG/M
3300009177|Ga0105248_11404347All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300009553|Ga0105249_10471873All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300009553|Ga0105249_12750072All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300009792|Ga0126374_10162705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp.1368Open in IMG/M
3300009792|Ga0126374_10691308All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300010043|Ga0126380_10488777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli941Open in IMG/M
3300010043|Ga0126380_11575569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli585Open in IMG/M
3300010046|Ga0126384_11965718All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300010046|Ga0126384_12212088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli529Open in IMG/M
3300010047|Ga0126382_11208065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli678Open in IMG/M
3300010320|Ga0134109_10325357All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300010321|Ga0134067_10270252All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300010360|Ga0126372_11598887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli690Open in IMG/M
3300010360|Ga0126372_11780996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli659Open in IMG/M
3300010362|Ga0126377_10178523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → unclassified Nitratireductor → Nitratireductor sp.2018Open in IMG/M
3300010362|Ga0126377_12092659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli642Open in IMG/M
3300010362|Ga0126377_13125439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli535Open in IMG/M
3300010391|Ga0136847_12092741All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300010398|Ga0126383_10745594All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300011270|Ga0137391_11149063All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300012179|Ga0137334_1127575All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300012189|Ga0137388_10633895All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300012204|Ga0137374_10740162All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300012204|Ga0137374_11124987All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300012209|Ga0137379_10640760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli969Open in IMG/M
3300012210|Ga0137378_11659907All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300012353|Ga0137367_10028056All Organisms → cellular organisms → Bacteria → Proteobacteria4356Open in IMG/M
3300012361|Ga0137360_10044034All Organisms → cellular organisms → Bacteria3181Open in IMG/M
3300012362|Ga0137361_11630989All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300012582|Ga0137358_10639279All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300012917|Ga0137395_10489847All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300012918|Ga0137396_10288001All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300012929|Ga0137404_12190569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli517Open in IMG/M
3300013306|Ga0163162_10545475All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300013307|Ga0157372_13373106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli508Open in IMG/M
3300015264|Ga0137403_10231690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli1765Open in IMG/M
3300015373|Ga0132257_102516558All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300017997|Ga0184610_1158968All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300018058|Ga0187766_10344356All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300018060|Ga0187765_10674928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli676Open in IMG/M
3300018068|Ga0184636_1164435All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300018075|Ga0184632_10493378All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300018422|Ga0190265_11592794All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300018482|Ga0066669_10048360All Organisms → cellular organisms → Bacteria2668Open in IMG/M
3300019377|Ga0190264_10742088All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300019882|Ga0193713_1174110All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300019883|Ga0193725_1043563All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300020170|Ga0179594_10163782All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300021051|Ga0206224_1037249All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300021478|Ga0210402_11252149All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300022756|Ga0222622_10625514All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300023057|Ga0247797_1017531All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300023072|Ga0247799_1003917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli2063Open in IMG/M
3300025885|Ga0207653_10111547All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300025922|Ga0207646_11125143All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300025922|Ga0207646_11148729All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300025922|Ga0207646_11479686All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300025923|Ga0207681_10446411All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300025935|Ga0207709_10340327All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300025938|Ga0207704_11082506All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300026075|Ga0207708_11243098All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300026116|Ga0207674_11330183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300026309|Ga0209055_1070902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli1454Open in IMG/M
3300026310|Ga0209239_1226037All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300026314|Ga0209268_1109182All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300026316|Ga0209155_1051130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli1605Open in IMG/M
3300026351|Ga0257170_1004630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli1572Open in IMG/M
3300026355|Ga0257149_1045033All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300026446|Ga0257178_1008335All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300026508|Ga0257161_1073246All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300026540|Ga0209376_1301997All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300027646|Ga0209466_1054040All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300027695|Ga0209966_1175851All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300027846|Ga0209180_10076919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli1880Open in IMG/M
3300027846|Ga0209180_10133521All Organisms → cellular organisms → Bacteria1426Open in IMG/M
3300027875|Ga0209283_10626190All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300027875|Ga0209283_10921732All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium527Open in IMG/M
3300027909|Ga0209382_10253527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli1997Open in IMG/M
3300027909|Ga0209382_11275764All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300028814|Ga0307302_10404919All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300028824|Ga0307310_10628241All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300030006|Ga0299907_10674963All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300031152|Ga0307501_10136180All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300031198|Ga0307500_10261691All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300031713|Ga0318496_10415806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli743Open in IMG/M
3300031720|Ga0307469_10289420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli1343Open in IMG/M
3300031720|Ga0307469_10590266All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300031720|Ga0307469_11078977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli753Open in IMG/M
3300031723|Ga0318493_10610913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli608Open in IMG/M
3300031740|Ga0307468_100796628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli805Open in IMG/M
3300031748|Ga0318492_10121313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli1301Open in IMG/M
3300031858|Ga0310892_11018890All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031913|Ga0310891_10141360All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300031945|Ga0310913_11006797All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300032012|Ga0310902_10960582All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300032180|Ga0307471_102168104All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300032180|Ga0307471_103589440All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300034147|Ga0364925_0039999All Organisms → cellular organisms → Bacteria1567Open in IMG/M
3300034151|Ga0364935_0234624All Organisms → cellular organisms → Bacteria596Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.09%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.17%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.17%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.17%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.17%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.58%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.58%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.58%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.58%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.58%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.58%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021051Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026351Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-BEnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300026446Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-BEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_113238312228664022SoilKLLRKQYEKGRVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE
JGI11643J12802_1207131813300000890SoilEPWYGEYDTKAVAIVHNIIRGATAVPKGLKELVALQRSLA*
JGI10214J12806_1108491913300000891SoilYKKGKVIAAYKEPWYGEYDTKAVAIIHNIIRGTTPVPKGLKELTALQKSLV*
JGI1027J12803_10097456623300000955SoilIAAYKEPWYAEYDTKALAIVHDIIRSSATVPTGLKRLAGLQKSLA*
JGI25613J43889_1006383623300002907Grasslands SoilPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA*
Ga0066398_1002896013300004268Tropical Forest SoilEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLASLQKSLA*
Ga0062595_10174950723300004479SoilKGKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLAALQKSLA*
Ga0062594_10057552823300005093SoilAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA*
Ga0066690_1004696553300005177SoilIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQGLKELVKLQKSLE*
Ga0066676_1009924833300005186SoilVIAAYKEPWYSEYDVKAVPIVHNLIRGGMTVPQGLKELVKLQKSLE*
Ga0066388_10368167213300005332Tropical Forest SoilDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA*
Ga0066388_10433873913300005332Tropical Forest SoilQYKKGKVIAAYKEPWYGEYDTKAVAIVQNIIRGATTVPKGLKDLAALQKSLA*
Ga0070709_1075988113300005434Corn, Switchgrass And Miscanthus RhizosphereYKKGKVIGAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLAALQKSLA*
Ga0070705_10023568733300005440Corn, Switchgrass And Miscanthus RhizosphereEPWYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA*
Ga0070694_10054036023300005444Corn, Switchgrass And Miscanthus RhizosphereIAAYKEPWYGEYDTKAVAIVHNIIRGGTTVPKGLKELAALQKSLA*
Ga0070694_10110389523300005444Corn, Switchgrass And Miscanthus RhizosphereAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA*
Ga0070694_10135925913300005444Corn, Switchgrass And Miscanthus RhizosphereEQYKKGKVIAAYKEPWYGEYDTKAVATVQNLIRGTITVPKGLKDLAALQKSLA*
Ga0070708_10017948313300005445Corn, Switchgrass And Miscanthus RhizosphereGLLREQTRKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGAAVPKGLKQLASLQKSLA*
Ga0070708_10021721513300005445Corn, Switchgrass And Miscanthus RhizosphereGLLREQTRKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA*
Ga0070708_10039864413300005445Corn, Switchgrass And Miscanthus RhizosphereYKEPWYSEYDVKAVPIVHNLIRGGMTVPQGLKELVKLQKSLE*
Ga0070708_10061904123300005445Corn, Switchgrass And Miscanthus RhizosphereKVIAAYKEPWYAEYDTKALAIVHDIIRAGVTVPKGLKQLASLQKSLA*
Ga0070708_10095389023300005445Corn, Switchgrass And Miscanthus RhizosphereAYKEPWYGEYDTKAVAIIHNIIRGTTPVPKGLKELTALQKSLV*
Ga0066681_1003293553300005451SoilKLLRKQYEKGRVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQGLKELVKLQKSLE*
Ga0070706_10208507323300005467Corn, Switchgrass And Miscanthus RhizosphereKGKVIAAYKEPWYSEYDTKAVPIVHNIIRGSVTVPQGLKEVVKLQRSLV*
Ga0066697_1028352723300005540SoilKQYEKGRVIAAYKEPWYSEYDVKAVPIVHNLIRGGMTVPQGLKELVKLQKSLE*
Ga0070695_10060228413300005545Corn, Switchgrass And Miscanthus RhizosphereYKEPWYGEYDTKAVATVHNIIRGATSVPKGLKELVALQKSLA*
Ga0070696_10126953923300005546Corn, Switchgrass And Miscanthus RhizosphereFKESWFSEYDTKAIAVVHNIIRGSSTVPKGLKELVALQKSLA*
Ga0070704_10032000123300005549Corn, Switchgrass And Miscanthus RhizosphereYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA*
Ga0066692_1060471323300005555SoilYKEPWYSEYDVKAVPIVHNMIRGGVSVPQGLKELVKLQKSLV*
Ga0068857_10074978813300005577Corn RhizosphereKGRIVSAFKEPWYGEYDSKAIAIVHNVIRGNSPVPKGLKDLVALQKSLA*
Ga0068859_10077059123300005617Switchgrass RhizospherePWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA*
Ga0066905_10038380723300005713Tropical Forest SoilVIAAYKEPWYGEYDTKAVAIVQNIIRGTTAVPKGLKELVALQKSLV*
Ga0066905_10076542523300005713Tropical Forest SoilMLRKQYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLSVPKGLKDLVALQKSLA*
Ga0068861_10111586913300005719Switchgrass RhizosphereYKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE*
Ga0066903_10825784923300005764Tropical Forest SoilFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA*
Ga0068863_10207656323300005841Switchgrass RhizospherePWYSEYDTKAVPIAHNIIRGAITVPQGLKEMTKLQRSLA*
Ga0068860_10042070413300005843Switchgrass RhizosphereQYKKGKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLAALQKSLA*
Ga0066651_1058015113300006031SoilSTKGKVIGAYKEPWYAEYDTKALAIVHDIIRGGVTVPKGLKQLASLQKSLA*
Ga0066656_1013657833300006034SoilAYKEPWYSEYDVKAVPIVHNLIRGGMTVPQGLKELVKLQKSLE*
Ga0066652_10189769113300006046SoilPNNAFKEPWFSEWDSKAIAIAHNIIRGTSTVPKGLKELTALHKSLV*
Ga0075417_1074996023300006049Populus RhizosphereEYDTKAVPIVHNMIRGSLTVPKGLKDLVGLQKSLA*
Ga0082029_172115723300006169Termite NestVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLAALQKSLA*
Ga0066653_1057567923300006791SoilAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQGLKELVKLQKSLE*
Ga0066660_1018614733300006800SoilSEYDSKAIAVVHNIIRGTSTVPKGLKELAALQKSLA*
Ga0079220_1028961323300006806Agricultural SoilIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPAGLKELVKLQKSLE*
Ga0075428_10088922923300006844Populus RhizosphereKVIAAYKEPWYGEYDTKAVATVHNMIRGTTAVPKGLKELVALQKSLV*
Ga0075421_10115656523300006845Populus RhizosphereNAFKEPWFSEWDSKAIAIVHNVIRGTSTVPKGLKELTALHKSLV*
Ga0075433_1000820313300006852Populus RhizosphereVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE*
Ga0075420_10058504223300006853Populus RhizosphereFKEPWFSEWDSKAIAIVHNIIRGTSTVPKGLKELAALQKSLV*
Ga0075425_10021676543300006854Populus RhizosphereLRRQYEKGRVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPAGLKELVKLQKSLE*
Ga0075434_10069716013300006871Populus RhizosphereKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA*
Ga0075434_10102635513300006871Populus RhizosphereEKGRVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPAGLKELVKLQKSLE*
Ga0075429_10065108713300006880Populus RhizosphereYKEPWYGEYDTKAVAIVHNIIRGATPVPKGLKDLAALQKSLA*
Ga0075429_10201350613300006880Populus RhizosphereYKEPWYGEYDTKAIPIVQNIIRGTVTVPQGLKDLAKLQKSLA*
Ga0079215_1036698813300006894Agricultural SoilEQYKKGKVIAAYKEPWYGEYDTKAVATVQNMIRGTVTVPKGLKDLVALQKSLA*
Ga0075424_10089193113300006904Populus RhizosphereMLRKQYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA*
Ga0075424_10161861223300006904Populus RhizosphereDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVGLQKSLA*
Ga0097620_10123414823300006931Switchgrass RhizosphereAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLAALQKSLA*
Ga0075419_1093649423300006969Populus RhizosphereAAYKEPWYSEYDTKAVPIVHNMIRGTLPVGQGLKDIVKLQRSLA*
Ga0075435_10032945733300007076Populus RhizosphereEYDVKAVPIVHNMIRGGTTVPAGLKELVKLQKSLE*
Ga0075435_10054249323300007076Populus RhizosphereQYEKGRVIAAYKEPWYSEYDVKAVPIVHNLIRGGMTVPQGLKELVKLQKSLE*
Ga0099830_1094727613300009088Vadose Zone SoilKGRVIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLV*
Ga0099828_1105978013300009089Vadose Zone SoilIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLV*
Ga0099827_1031456723300009090Vadose Zone SoilIAAYKEPWYGEYDTKAVATVQNIIRGVVTVPKGLKELVALQKSLA*
Ga0099827_1086749413300009090Vadose Zone SoilQYKKGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELTALQKSLA*
Ga0105250_1054228423300009092Switchgrass RhizosphereAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA*
Ga0105245_1086160813300009098Miscanthus RhizosphereKGKVIAAYKEPWYGEYDTKAVAIIHNIIRGTTPVPKGLKELTALQKSLV*
Ga0075418_1031669413300009100Populus RhizosphereREQYKKGRTITAFKEPWYAEYDSKAIAVVHNIIRGTSTVPKGLKDLAALQRSVA*
Ga0066709_10361361923300009137Grasslands SoilPWFSEYDSKAIAVVHNIIRGTSTVPKGLKELATLQRSLA*
Ga0114129_1048914133300009147Populus RhizosphereAFKEPWYGEYDSKAIAIVHNVIRGNSPVPKGLKDLVALQKSLA*
Ga0105243_1260821713300009148Miscanthus RhizosphereKKGKVIAAYKEPWYGEYDTKAIAVVHNIIRGSSTVPKGLKELVALQKSLA*
Ga0075423_1221048813300009162Populus RhizosphereIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVGLQKSLA*
Ga0105248_1140434713300009177Switchgrass RhizosphereQYEKGKVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVLAGLKELVKLQKSLE*
Ga0105249_1047187313300009553Switchgrass RhizosphereGKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA*
Ga0105249_1275007223300009553Switchgrass RhizosphereLLRKQYEKGKVIAAYKEPWYSEYDVKAAPIVHNMIRGGTTVPQALKELVKLQKSLE*
Ga0126374_1016270533300009792Tropical Forest SoilSEYDTKAVPIVHNMIRGSLTVPKGLKDLVGLQKSLA*
Ga0126374_1069130813300009792Tropical Forest SoilQYEKGKVIAAYKEPWYGEYDVKAVPVVHNIIRGTATVPQGLKELVKLQKSLA*
Ga0126380_1048877713300010043Tropical Forest SoilAAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKALKDLASLQKSLA*
Ga0126380_1157556913300010043Tropical Forest SoilKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA*
Ga0126384_1196571813300010046Tropical Forest SoilEYDTRAVPMVHDMIRGNTTVAKGLKDLVKLQKSLV*
Ga0126384_1221208823300010046Tropical Forest SoilAKVIAAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA*
Ga0126382_1120806523300010047Tropical Forest SoilAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA*
Ga0134109_1032535713300010320Grasslands SoilKGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA*
Ga0134067_1027025213300010321Grasslands SoilYKEPWYAEYDTKALAIVHDIIRGGVTVPKGLKQLASLQKSLA*
Ga0126372_1159888713300010360Tropical Forest SoilLRKQYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVGLQKSLA*
Ga0126372_1178099623300010360Tropical Forest SoilLLRKQYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA*
Ga0126377_1017852333300010362Tropical Forest SoilYDTKAVPIVHNMIRGSLTVPKGLKDLASLQRSLA*
Ga0126377_1209265923300010362Tropical Forest SoilAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSSTVPKGLKDLVALQKSLA*
Ga0126377_1312543923300010362Tropical Forest SoilNAFKEPWFSEWDSKAIAIVHNIIRGTSAVPKGLKELAALQKSLV*
Ga0136847_1209274113300010391Freshwater SedimentKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKDLTALQKSLA*
Ga0126383_1074559413300010398Tropical Forest SoilKGRVSAAYKEPWYSEYDVKAVPIVHNIIRGGTTVPQGLKELVKLQKSLE*
Ga0137391_1114906323300011270Vadose Zone SoilIAAYKEPWYGEYDTKAVATVHNIIRGATSVPNGLKELVALQKSLA*
Ga0137334_112757523300012179SoilEQYKKGKVIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA*
Ga0137388_1063389513300012189Vadose Zone SoilKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA*
Ga0137374_1074016213300012204Vadose Zone SoilLLREQYKKGKVIAAYKEPWYGEYDTKAVAIAHDIIRGATPVPKGLKDLVALQKSLA*
Ga0137374_1112498713300012204Vadose Zone SoilLLREQYKKGKVIAAYKEPWYGEYDTKAVAIAHDIIRGATPVAKGLKDLVALQKSLA*
Ga0137379_1064076013300012209Vadose Zone SoilKKGRPNNAFKEPWFSEWDSKAIAIAHNIIRGTSTVPKGLNELQALYKALV*
Ga0137378_1165990713300012210Vadose Zone SoilEYDSKAIAIVHNIIRGTSTVPKGLKELTALQKSLA*
Ga0137367_1002805663300012353Vadose Zone SoilAYKEPWYGEYDTKAVAIAHDIIRGATPVAKGLKDLVALQKSLA*
Ga0137360_1004403453300012361Vadose Zone SoilREQYKKGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA*
Ga0137361_1163098913300012362Vadose Zone SoilKEPWYAEYDTKALAIVHDIIRSGATVPKGLKQLASLQKSLA*
Ga0137358_1063927913300012582Vadose Zone SoilYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE*
Ga0137395_1048984723300012917Vadose Zone SoilESWFSEYDTKCIPIVHNIIRGSSTVPKGLKELVALQKSLV*
Ga0137396_1028800113300012918Vadose Zone SoilKGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELTALQKSLA*
Ga0137404_1219056913300012929Vadose Zone SoilQYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA*
Ga0163162_1054547523300013306Switchgrass RhizosphereKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA*
Ga0157372_1337310613300013307Corn RhizosphereDKAKVIAAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVALQKSLA*
Ga0137403_1023169033300015264Vadose Zone SoilAAFKEPWYGEYDTRAVAIVHDIIRGAATVPKGLKDLAALQKSLV*
Ga0132257_10251655823300015373Arabidopsis RhizosphereVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA*
Ga0184610_115896813300017997Groundwater SedimentYGEYDTKAVATVHNIIRGTTTVPKGLKELTSLQKSLV
Ga0187766_1034435613300018058Tropical PeatlandKEPWYSEYDVKAVPIVHNIIRGGTTVPQGLKELVKLQKSLE
Ga0187765_1067492823300018060Tropical PeatlandLRKQYDKAKVIAAFKESWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLVSLQKSVA
Ga0184636_116443513300018068Groundwater SedimentGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA
Ga0184632_1049337813300018075Groundwater SedimentAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKDLVALQKSLA
Ga0190265_1159279413300018422SoilKKGKVIAAYKEPWYGEYDTKAVAIVHNIIRGATPVPKGLKDLAALQKSLA
Ga0066669_1004836043300018482Grasslands SoilIGAYKEPWYAEYDTKALAIVHDIIRGGVTVPKGLKQLASLQKSLA
Ga0190264_1074208823300019377SoilREQYKKGKVIAAYKEPWYGEYDTKAVAIVHNMIRGATPVPKGLKDLASLQKSLA
Ga0193713_117411023300019882SoilSEYDTKAIAIVHNIIRGSSTVPKGLKELVALQKSLV
Ga0193725_104356323300019883SoilSWFSEYDTKAIAVVHNIIRGSSTVPKGLKELVALQKSLA
Ga0179594_1016378213300020170Vadose Zone SoilKEPWYSEYDVKAVPIVHNIIRGGVTVPQGLKELVKLQKSLE
Ga0206224_103724923300021051Deep Subsurface SedimentEQYKKGKVIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA
Ga0210402_1125214913300021478SoilLREQYKKGRVIAAYKEPWYGEYDAKAVATVHNIIRGTTTVPKGLKDLVALQKSLA
Ga0222622_1062551423300022756Groundwater SedimentQYKKGKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA
Ga0247797_101753113300023057SoilKKGRVIAAYKEPWYGEYDTKAVAIVHNIIRGGTTVPKGLKELAALQKSLA
Ga0247799_100391733300023072SoilRVIAAYKEPWYGEYDTKAVAIVHNIIRGGTTVPKGLKELAALQKSLA
Ga0207653_1011154713300025885Corn, Switchgrass And Miscanthus RhizosphereKKGKVIAAYKEPWYAEYDTKALAIVHDIIRAGVTVPKGLKQLASLQKSLA
Ga0207646_1112514323300025922Corn, Switchgrass And Miscanthus RhizosphereKEPWYGEYDTKAVAIIHNIIRGTTPVPKGLKELTALQKSLV
Ga0207646_1114872913300025922Corn, Switchgrass And Miscanthus RhizosphereRKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGAAVPKGLKQLASLQKSLA
Ga0207646_1147968613300025922Corn, Switchgrass And Miscanthus RhizosphereIAAYKEPWYGEYDTKAVATVQNLIRGTITVPKGLKDLAALQKSLA
Ga0207681_1044641123300025923Switchgrass RhizosphereESWFSEYDTKAIAVVHNIIRGSSTVPKGLKELVALQKSLA
Ga0207709_1034032713300025935Miscanthus RhizosphereEYDTKAIAVVHNIIRGSSTVPKGLKELVALQKSLA
Ga0207704_1108250613300025938Miscanthus RhizosphereKGKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA
Ga0207708_1124309813300026075Corn, Switchgrass And Miscanthus RhizosphereIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE
Ga0207674_1133018313300026116Corn RhizosphereEYDTKAVPIVHNIIRGSVTVPQGLKEVVKLQRSLA
Ga0209055_107090213300026309SoilGAYKEPWYAEYDTKALAIVHDIIRGGVTVPKGLKQLASLQKSLA
Ga0209239_122603723300026310Grasslands SoilAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA
Ga0209268_110918213300026314SoilPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA
Ga0209155_105113013300026316SoilSEWDSKAIAIVHNIIRGTSTVPKGLKELAALQKSLA
Ga0257170_100463013300026351SoilEYDTKCIPIVHNIIRGSSTVPKGLKELVALQKSLV
Ga0257149_104503323300026355SoilIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPRGLKELVALQKSLA
Ga0257178_100833523300026446SoilTRKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA
Ga0257161_107324613300026508SoilYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA
Ga0209376_130199723300026540SoilWFSEWDSKAIAIVHNIIRGTTTVPKGLKELAALQKSLA
Ga0209466_105404023300027646Tropical Forest SoilYDKAKVIDAFKEPWYAEYDTKAVPIVHNMIRGSLTVPRGLKELASLQKSLT
Ga0209966_117585123300027695Arabidopsis Thaliana RhizosphereEPWYGEYDTKAVAIVHNIIRGVTAVPKGLKELVALQRSLA
Ga0209180_1007691933300027846Vadose Zone SoilGKVIGAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLAALQKSLA
Ga0209180_1013352113300027846Vadose Zone SoilYKKGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELVALQKSLA
Ga0209283_1062619013300027875Vadose Zone SoilIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLV
Ga0209283_1092173223300027875Vadose Zone SoilKKGKVIAAYKEPWYGEYDTKAVATVQNIIRGVTTVPKGLKELTALQKSLA
Ga0209382_1025352713300027909Populus RhizospherePWYAEYDTKALAVVHDIIRGGATVPRGLKQLTSLQKSLL
Ga0209382_1127576423300027909Populus RhizospherePWYGEYDSKAVAIVHNVIRGNSPVPKGLKDLVALQKSLA
Ga0307302_1040491913300028814SoilIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA
Ga0307310_1062824123300028824SoilEQYKKGRVIAAYKEPWYGEYDTKAVATVHNIIRGTTTVPKGLKDLVALQKSLA
Ga0299907_1067496323300030006SoilFSEWDSKAIAIVHNIIRGTSTVPRGLKELTALYKSLV
Ga0307501_1013618023300031152SoilKVIAAYKEPWYGEYDTKAVATVQNMIRGTITVPKGLKDLVALQKSLA
Ga0307500_1026169113300031198SoilAYKEPWYGEYDTKAIAIVQNIIRGSLTVPQGLKDLAKLQKSLA
Ga0318496_1041580613300031713SoilVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLAGLQKSLA
Ga0307469_1028942013300031720Hardwood Forest SoilLLREQTRKGKVIAAYKESWYAEYDTKALAIVHDIIRAGVTVPKGLKQLASLQKSLA
Ga0307469_1059026613300031720Hardwood Forest SoilKLLREQYKKGKVIAAYKEPWYGEYDTKAVAIVHNMIRGTTAVPKGLKELTALQKSLV
Ga0307469_1107897713300031720Hardwood Forest SoilKESWFSEYDTKCIPIVHNIIRGSSTVPKGLKELVALQKSLV
Ga0318493_1061091313300031723SoilFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLAGLQKSLA
Ga0307468_10079662823300031740Hardwood Forest SoilFKEPWYSEYDTKAVPIVHNMIRGSLAVPKGLKDLVALQKSLA
Ga0318492_1012131333300031748SoilQYDKAKVIGAFKEPWYSEYDTKAVPIVHNMIRGSLTVPKGLKDLAGLQKSLA
Ga0310892_1101889023300031858SoilVIAAYKEPWYGEYDTKAVAIVHNIIRGGTTVPKGLKELAALQKSLA
Ga0310891_1014136023300031913SoilEKGKVIAAYKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE
Ga0310913_1100679713300031945SoilQYEKGRVIAAYKEPWYSEYDVKAVPIVHNIIRGGTTVPQGLKELVKLQKSLE
Ga0310902_1096058213300032012SoilKEPWYSEYDVKAVPIVHNMIRGGTTVPQALKELVKLQKSLE
Ga0307471_10216810413300032180Hardwood Forest SoilREQIRKGKVIAAYKEPWYAEYDTKALAIVHDIIRGGATVPKGLKQLASLQKSLA
Ga0307471_10358944023300032180Hardwood Forest SoilVIAAYKEPWYGEYDTKAVAVVHDIIRGTTTVPKGLKDLVALQKSLA
Ga0364925_0039999_1402_15663300034147SedimentKTQYTKGKVIAAYKEGWYGEYDTKAIPIVQNIIRGTLTVPQGLKDLAKLQKSLA
Ga0364935_0234624_429_5963300034151SedimentLREQYKKGKVIAAYKEPWYGEYDTKAVAIVHNMIRGATPVPKGLKDLAALQKSLA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.