


| Basic Information | |
|---|---|
| Family ID | F035909 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 171 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSKAQKGNKENKKPKGDKNQHKANVSAYKAAQGQGKPASSPFAKKT |
| Number of Associated Samples | 157 |
| Number of Associated Scaffolds | 171 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 56.47 % |
| % of genes near scaffold ends (potentially truncated) | 56.73 % |
| % of genes from short scaffolds (< 2000 bps) | 92.98 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.140 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.941 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.883 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.953 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.76% β-sheet: 0.00% Coil/Unstructured: 93.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 171 Family Scaffolds |
|---|---|---|
| PF01145 | Band_7 | 1.75 |
| PF00313 | CSD | 1.75 |
| PF04545 | Sigma70_r4 | 1.75 |
| PF00118 | Cpn60_TCP1 | 1.17 |
| PF00486 | Trans_reg_C | 1.17 |
| PF14384 | BrnA_antitoxin | 1.17 |
| PF02777 | Sod_Fe_C | 1.17 |
| PF02735 | Ku | 1.17 |
| PF08734 | GYD | 1.17 |
| PF10431 | ClpB_D2-small | 1.17 |
| PF03401 | TctC | 0.58 |
| PF00582 | Usp | 0.58 |
| PF01329 | Pterin_4a | 0.58 |
| PF00534 | Glycos_transf_1 | 0.58 |
| PF01734 | Patatin | 0.58 |
| PF13276 | HTH_21 | 0.58 |
| PF04430 | DUF498 | 0.58 |
| PF00383 | dCMP_cyt_deam_1 | 0.58 |
| PF00903 | Glyoxalase | 0.58 |
| PF00011 | HSP20 | 0.58 |
| PF13701 | DDE_Tnp_1_4 | 0.58 |
| PF01165 | Ribosomal_S21 | 0.58 |
| PF02190 | LON_substr_bdg | 0.58 |
| PF04909 | Amidohydro_2 | 0.58 |
| PF13358 | DDE_3 | 0.58 |
| PF08548 | Peptidase_M10_C | 0.58 |
| PF08241 | Methyltransf_11 | 0.58 |
| PF04321 | RmlD_sub_bind | 0.58 |
| PF01545 | Cation_efflux | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
|---|---|---|---|
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.17 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 1.17 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.17 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.17 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.17 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 1.17 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.17 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.58 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.58 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.58 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.58 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.58 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.58 |
| COG2931 | Ca2+-binding protein, RTX toxin-related | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.58 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.58 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.58 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.58 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.14 % |
| All Organisms | root | All Organisms | 43.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309009|GPKNP_F5JHDJD02G64XO | Not Available | 509 | Open in IMG/M |
| 3300001412|JGI20173J14856_1037666 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300001661|JGI12053J15887_10092301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1650 | Open in IMG/M |
| 3300001867|JGI12627J18819_10046921 | Not Available | 1805 | Open in IMG/M |
| 3300001989|JGI24739J22299_10157219 | Not Available | 671 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101416535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1 | 588 | Open in IMG/M |
| 3300004092|Ga0062389_101825155 | Not Available | 787 | Open in IMG/M |
| 3300004635|Ga0062388_102372274 | Not Available | 555 | Open in IMG/M |
| 3300005338|Ga0068868_101983772 | Not Available | 552 | Open in IMG/M |
| 3300005339|Ga0070660_101178409 | Not Available | 649 | Open in IMG/M |
| 3300005367|Ga0070667_102153364 | Not Available | 525 | Open in IMG/M |
| 3300005471|Ga0070698_102088325 | Not Available | 520 | Open in IMG/M |
| 3300005529|Ga0070741_10012310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 15499 | Open in IMG/M |
| 3300005554|Ga0066661_10728048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
| 3300005718|Ga0068866_10273131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300005764|Ga0066903_103126367 | Not Available | 896 | Open in IMG/M |
| 3300005921|Ga0070766_10530744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 785 | Open in IMG/M |
| 3300005938|Ga0066795_10123497 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006038|Ga0075365_10900057 | Not Available | 624 | Open in IMG/M |
| 3300006050|Ga0075028_100256236 | Not Available | 962 | Open in IMG/M |
| 3300006057|Ga0075026_101056937 | Not Available | 508 | Open in IMG/M |
| 3300006059|Ga0075017_100582085 | Not Available | 854 | Open in IMG/M |
| 3300006162|Ga0075030_100167855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1773 | Open in IMG/M |
| 3300006173|Ga0070716_100865216 | Not Available | 705 | Open in IMG/M |
| 3300006176|Ga0070765_100867925 | Not Available | 853 | Open in IMG/M |
| 3300006605|Ga0074057_11766949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 629 | Open in IMG/M |
| 3300006871|Ga0075434_101563175 | Not Available | 668 | Open in IMG/M |
| 3300006893|Ga0073928_11167208 | Not Available | 520 | Open in IMG/M |
| 3300006904|Ga0075424_102547293 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006950|Ga0075524_10073815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1437 | Open in IMG/M |
| 3300007819|Ga0104322_117565 | Not Available | 1220 | Open in IMG/M |
| 3300009088|Ga0099830_10646773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 869 | Open in IMG/M |
| 3300009089|Ga0099828_11605777 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
| 3300009137|Ga0066709_101969821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300009162|Ga0075423_13040999 | Not Available | 514 | Open in IMG/M |
| 3300009174|Ga0105241_10309642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1358 | Open in IMG/M |
| 3300009518|Ga0116128_1217504 | Not Available | 534 | Open in IMG/M |
| 3300009521|Ga0116222_1306447 | Not Available | 686 | Open in IMG/M |
| 3300009522|Ga0116218_1236160 | Not Available | 822 | Open in IMG/M |
| 3300009522|Ga0116218_1283925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300009645|Ga0116106_1118421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 853 | Open in IMG/M |
| 3300009649|Ga0105855_1145460 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300009662|Ga0105856_1078814 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300009683|Ga0116224_10358639 | Not Available | 693 | Open in IMG/M |
| 3300009698|Ga0116216_10230529 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300009698|Ga0116216_10420462 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 810 | Open in IMG/M |
| 3300010043|Ga0126380_12051007 | Not Available | 525 | Open in IMG/M |
| 3300010371|Ga0134125_10388354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1548 | Open in IMG/M |
| 3300010379|Ga0136449_103722411 | Not Available | 575 | Open in IMG/M |
| 3300010396|Ga0134126_11191578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 846 | Open in IMG/M |
| 3300010396|Ga0134126_11295743 | Not Available | 807 | Open in IMG/M |
| 3300010400|Ga0134122_12062828 | Not Available | 610 | Open in IMG/M |
| 3300011120|Ga0150983_13359843 | Not Available | 658 | Open in IMG/M |
| 3300011269|Ga0137392_10052918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3062 | Open in IMG/M |
| 3300011269|Ga0137392_10932010 | Not Available | 714 | Open in IMG/M |
| 3300011271|Ga0137393_11044071 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 695 | Open in IMG/M |
| 3300011418|Ga0153954_1011256 | Not Available | 2635 | Open in IMG/M |
| 3300012019|Ga0120139_1020072 | Not Available | 1531 | Open in IMG/M |
| 3300012180|Ga0153974_1104717 | Not Available | 644 | Open in IMG/M |
| 3300012181|Ga0153922_1136139 | Not Available | 570 | Open in IMG/M |
| 3300012189|Ga0137388_10770758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 892 | Open in IMG/M |
| 3300012202|Ga0137363_10278117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1368 | Open in IMG/M |
| 3300012203|Ga0137399_10621873 | Not Available | 908 | Open in IMG/M |
| 3300012212|Ga0150985_100194489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1770 | Open in IMG/M |
| 3300012212|Ga0150985_114385560 | Not Available | 624 | Open in IMG/M |
| 3300012356|Ga0137371_11214658 | Not Available | 562 | Open in IMG/M |
| 3300012362|Ga0137361_10269986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1553 | Open in IMG/M |
| 3300012469|Ga0150984_103223396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 999 | Open in IMG/M |
| 3300012469|Ga0150984_115558609 | Not Available | 600 | Open in IMG/M |
| 3300012924|Ga0137413_11195366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300012944|Ga0137410_10990397 | Not Available | 715 | Open in IMG/M |
| 3300012960|Ga0164301_10610475 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012960|Ga0164301_10760379 | Not Available | 736 | Open in IMG/M |
| 3300012985|Ga0164308_10473830 | Not Available | 1041 | Open in IMG/M |
| 3300012989|Ga0164305_10172612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1492 | Open in IMG/M |
| 3300012989|Ga0164305_10313245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1165 | Open in IMG/M |
| 3300013102|Ga0157371_10530713 | Not Available | 871 | Open in IMG/M |
| 3300013306|Ga0163162_10697252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1137 | Open in IMG/M |
| 3300014054|Ga0120135_1094900 | Not Available | 527 | Open in IMG/M |
| 3300014159|Ga0181530_10127228 | Not Available | 1482 | Open in IMG/M |
| 3300014159|Ga0181530_10490018 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300014325|Ga0163163_12821919 | Not Available | 542 | Open in IMG/M |
| 3300014489|Ga0182018_10106627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1637 | Open in IMG/M |
| 3300014495|Ga0182015_10777989 | Not Available | 602 | Open in IMG/M |
| 3300014657|Ga0181522_10102271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1655 | Open in IMG/M |
| 3300015077|Ga0173483_10635744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300015371|Ga0132258_10186065 | All Organisms → cellular organisms → Bacteria | 5025 | Open in IMG/M |
| 3300015372|Ga0132256_101451700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 797 | Open in IMG/M |
| 3300015373|Ga0132257_101120154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 994 | Open in IMG/M |
| 3300016270|Ga0182036_11082557 | Not Available | 663 | Open in IMG/M |
| 3300016270|Ga0182036_11426471 | Not Available | 580 | Open in IMG/M |
| 3300016341|Ga0182035_11417087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 624 | Open in IMG/M |
| 3300016387|Ga0182040_10746401 | Not Available | 803 | Open in IMG/M |
| 3300017792|Ga0163161_10252913 | Not Available | 1374 | Open in IMG/M |
| 3300017938|Ga0187854_10092381 | Not Available | 1430 | Open in IMG/M |
| 3300017970|Ga0187783_10097184 | Not Available | 2171 | Open in IMG/M |
| 3300018025|Ga0187885_10310599 | Not Available | 713 | Open in IMG/M |
| 3300018025|Ga0187885_10369826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300018035|Ga0187875_10245735 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300018040|Ga0187862_10813043 | Not Available | 541 | Open in IMG/M |
| 3300018071|Ga0184618_10380206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300018074|Ga0184640_10554243 | Not Available | 501 | Open in IMG/M |
| 3300018075|Ga0184632_10137718 | Not Available | 1076 | Open in IMG/M |
| 3300018081|Ga0184625_10128526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1319 | Open in IMG/M |
| 3300018433|Ga0066667_11693974 | Not Available | 567 | Open in IMG/M |
| 3300018468|Ga0066662_10944918 | Not Available | 850 | Open in IMG/M |
| 3300018468|Ga0066662_12547621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 540 | Open in IMG/M |
| 3300018481|Ga0190271_12649642 | Not Available | 601 | Open in IMG/M |
| 3300019249|Ga0184648_1119225 | Not Available | 787 | Open in IMG/M |
| 3300020582|Ga0210395_10019078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5043 | Open in IMG/M |
| 3300020583|Ga0210401_10100801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2713 | Open in IMG/M |
| 3300021171|Ga0210405_11146160 | Not Available | 579 | Open in IMG/M |
| 3300021180|Ga0210396_11297630 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300021401|Ga0210393_10086035 | Not Available | 2494 | Open in IMG/M |
| 3300021402|Ga0210385_11562745 | Not Available | 503 | Open in IMG/M |
| 3300021403|Ga0210397_10386417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1044 | Open in IMG/M |
| 3300021404|Ga0210389_10589959 | Not Available | 873 | Open in IMG/M |
| 3300021406|Ga0210386_10979898 | Not Available | 722 | Open in IMG/M |
| 3300021432|Ga0210384_10987492 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
| 3300022530|Ga0242658_1086057 | Not Available | 731 | Open in IMG/M |
| 3300022726|Ga0242654_10216575 | Not Available | 672 | Open in IMG/M |
| 3300025625|Ga0208219_1022117 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300025650|Ga0209385_1146114 | Not Available | 707 | Open in IMG/M |
| 3300025911|Ga0207654_10389962 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300025918|Ga0207662_10132424 | Not Available | 1573 | Open in IMG/M |
| 3300025923|Ga0207681_10313310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1245 | Open in IMG/M |
| 3300025929|Ga0207664_11077558 | Not Available | 719 | Open in IMG/M |
| 3300025933|Ga0207706_10442382 | Not Available | 1125 | Open in IMG/M |
| 3300025961|Ga0207712_10503407 | Not Available | 1036 | Open in IMG/M |
| 3300025965|Ga0210090_1049568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300026035|Ga0207703_11327522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 692 | Open in IMG/M |
| 3300026041|Ga0207639_10505157 | Not Available | 1105 | Open in IMG/M |
| 3300026271|Ga0209880_1044617 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300026329|Ga0209375_1152777 | Not Available | 969 | Open in IMG/M |
| 3300026489|Ga0257160_1078753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 586 | Open in IMG/M |
| 3300027432|Ga0209421_1136965 | Not Available | 505 | Open in IMG/M |
| 3300027570|Ga0208043_1195077 | Not Available | 513 | Open in IMG/M |
| 3300027651|Ga0209217_1036179 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300027729|Ga0209248_10067351 | Not Available | 1090 | Open in IMG/M |
| 3300027846|Ga0209180_10221768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1089 | Open in IMG/M |
| 3300027882|Ga0209590_10434910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
| 3300027894|Ga0209068_10379006 | Not Available | 804 | Open in IMG/M |
| 3300027895|Ga0209624_10045031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2819 | Open in IMG/M |
| 3300027895|Ga0209624_10264724 | Not Available | 1143 | Open in IMG/M |
| 3300027898|Ga0209067_10904435 | Not Available | 519 | Open in IMG/M |
| 3300028380|Ga0268265_10824284 | Not Available | 906 | Open in IMG/M |
| 3300028380|Ga0268265_11243378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300028768|Ga0307280_10228614 | Not Available | 664 | Open in IMG/M |
| 3300028807|Ga0307305_10246401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300030902|Ga0308202_1156148 | Not Available | 511 | Open in IMG/M |
| 3300030916|Ga0075386_12195604 | Not Available | 539 | Open in IMG/M |
| 3300031091|Ga0308201_10326729 | Not Available | 555 | Open in IMG/M |
| 3300031093|Ga0308197_10256847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 624 | Open in IMG/M |
| 3300031094|Ga0308199_1040481 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300031099|Ga0308181_1093324 | Not Available | 640 | Open in IMG/M |
| 3300031114|Ga0308187_10041879 | Not Available | 1219 | Open in IMG/M |
| 3300031231|Ga0170824_115416068 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031718|Ga0307474_10661404 | Not Available | 825 | Open in IMG/M |
| 3300031744|Ga0306918_11398895 | Not Available | 536 | Open in IMG/M |
| 3300031795|Ga0318557_10121494 | Not Available | 1168 | Open in IMG/M |
| 3300031879|Ga0306919_11321541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300031890|Ga0306925_10788425 | Not Available | 987 | Open in IMG/M |
| 3300031910|Ga0306923_10039604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5141 | Open in IMG/M |
| 3300031946|Ga0310910_11149109 | Not Available | 603 | Open in IMG/M |
| 3300031947|Ga0310909_10603217 | Not Available | 917 | Open in IMG/M |
| 3300031954|Ga0306926_11594172 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 749 | Open in IMG/M |
| 3300032122|Ga0310895_10450228 | Not Available | 639 | Open in IMG/M |
| 3300032163|Ga0315281_11506678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300032261|Ga0306920_100106564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4151 | Open in IMG/M |
| 3300032895|Ga0335074_11173976 | Not Available | 651 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.77% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.43% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.34% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.34% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.75% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.75% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.75% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.17% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.17% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.17% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.17% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.17% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.17% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.17% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.58% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.58% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.58% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001412 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011418 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG | Host-Associated | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKNP_03346850 | 2070309009 | Soil | MSKAQKGIRKKEPKADKNQPKTHVSAYKAAQGQGKPSFNPFARKT |
| JGI20173J14856_10376661 | 3300001412 | Arctic Peat Soil | NKENKKPKADKNQSEANVSAYKAAQGQGKPASSPFAKKT*R* |
| JGI12053J15887_100923013 | 3300001661 | Forest Soil | MSKAQKGNKENKKXKADKTQXKANVSAYKAAQGQGKPASSPFAKKT* |
| JGI12627J18819_100469212 | 3300001867 | Forest Soil | MSKGQKNNRESMKPKGDKNRIKRLSAYKAAQSQAKPANSQFGKKT* |
| JGI24739J22299_101572191 | 3300001989 | Corn Rhizosphere | MSKAQKGNKENKKPKADKXQSKANVSAYRTAQDQGKPXSSPFAKKR* |
| JGIcombinedJ26739_1014165351 | 3300002245 | Forest Soil | MSKGQKSNKENMKPKADKNRIKNVSAYKVAQSHAKPVNNRLGKKT* |
| Ga0062389_1018251552 | 3300004092 | Bog Forest Soil | MSKGQKGNRESMKPKGDKNRIKRLSAYKAAQSQGKPANSQFGKKT* |
| Ga0062388_1023722742 | 3300004635 | Bog Forest Soil | MSKAQKGNKENKKPKADRNRSKANVSAYKAAQIQGKPASSQFAKKT* |
| Ga0068868_1019837722 | 3300005338 | Miscanthus Rhizosphere | LSPTKRIAMSKGQKGNKENKKAKADKNGVKNVSAYKAAQSLGKPAGSQFGKKT* |
| Ga0070660_1011784091 | 3300005339 | Corn Rhizosphere | MSKAQKGNKENRKPKADKNRVKSVSAYKAAQSLGRPASSQFGKKT* |
| Ga0070667_1021533641 | 3300005367 | Switchgrass Rhizosphere | KGNKENRKPKADKNRVKSVSAYKAAQSLGRPASSQFGKKT* |
| Ga0070698_1020883251 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKVQKGNKENKKPKADKNRVRGVSAYKVAQSQGKPASSRFG |
| Ga0070741_1001231012 | 3300005529 | Surface Soil | MAKGNDKKPKADKNRAKVAVSAYKIAQAAGKAPDSPFAKKPAR* |
| Ga0066661_107280481 | 3300005554 | Soil | KKKPKADKNQPKTHVSAYKAAQGQGKPSFNPFARKT* |
| Ga0068866_102731313 | 3300005718 | Miscanthus Rhizosphere | TKRIAMSKGQNGNKEKAKADKNRVKNVSAYKAAQSLGKPAGSQFEKKT* |
| Ga0066903_1031263672 | 3300005764 | Tropical Forest Soil | MSKAQKSNKENKKPRADKNRVKSVSAYKAAQSLGKPASSQFGKKT* |
| Ga0070766_105307441 | 3300005921 | Soil | GNKENKKPKADKTQTKANVSAYKAAQSQGKPASSPFAKKT* |
| Ga0066795_101234972 | 3300005938 | Soil | MSKAQKGNKENKKPKADKNQSEPNVSAYKAAQGKPASSPFAKKT* |
| Ga0075365_109000571 | 3300006038 | Populus Endosphere | KKPKADKNQPRATISAYRTAQGQGKPASSPFARKKI* |
| Ga0075028_1002562362 | 3300006050 | Watersheds | MSKAQKGNKENRKPKADKDQSKTNVSAYKAAQRLGKPASSPFAKKT* |
| Ga0075026_1010569371 | 3300006057 | Watersheds | MSKAQKGNKENRKPKADKDQSKTNVSAYKAAQRLGKPASSPFAKRT* |
| Ga0075017_1005820851 | 3300006059 | Watersheds | MVFGLSIRRITMSKAQKGNKENRKPKADKDQSKTNVSAYKAAQRLGKPASSPFAKKT* |
| Ga0075030_1001678551 | 3300006162 | Watersheds | GNKENKKPKADKNRVKDVSAYKSAQSQGKPASSRFGKKT* |
| Ga0070716_1008652163 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKGQNGNKEKAKADKNRVKNVSAYKAAQSLGKPA |
| Ga0070765_1008679251 | 3300006176 | Soil | MSKGQKSNRESMKPKGDKNRIKRLSAYKAAQSQGKPANSQFGKKT* |
| Ga0074057_117669493 | 3300006605 | Soil | MSKAQKGNKENKKPKADKNQPRATISAYRSAQGQGKPVEGHGDPER |
| Ga0075434_1015631751 | 3300006871 | Populus Rhizosphere | MSKGQNGNKEKAKADKNRVKNVSAYKAAQSLGKPAGSQFGKKT* |
| Ga0073928_111672082 | 3300006893 | Iron-Sulfur Acid Spring | MSKAQKGNKENRKPKADKNQSKANVSAYKAAQGQGK |
| Ga0075424_1025472932 | 3300006904 | Populus Rhizosphere | MSKSQKGNKENKKPKAVKTQSSTNVSAYKTAQGQGKPTIGPFAKKT* |
| Ga0075524_100738153 | 3300006950 | Arctic Peat Soil | MSKTQKGNKENRKLKADKNQSKANVSAYKAAQGQGKPASSPFAKKT* |
| Ga0104322_1175651 | 3300007819 | Permafrost Soil | MFSIVRIAMSKAQKSNKENRKPKADKNQTKNVSAYKLAQGQGKAASSPFAKKT* |
| Ga0099830_106467733 | 3300009088 | Vadose Zone Soil | MSKARKGNKENKKPKADKDQSKANVSAYKAAQGQGKPAN |
| Ga0099828_116057772 | 3300009089 | Vadose Zone Soil | MSKAQKGNKENKKPKTDKTQTKANVSAYKAAQGQGKPASSPFAKKT* |
| Ga0066709_1019698211 | 3300009137 | Grasslands Soil | KKPKADKNQPKTHVSAYKAAQGQGKPSFNPFARKT* |
| Ga0075423_130409991 | 3300009162 | Populus Rhizosphere | MHMSKVQKSNKENKKPKADKNRVRSVSAYKVAQGQGKPPASSRFGKKS* |
| Ga0105241_103096421 | 3300009174 | Corn Rhizosphere | MSKAQKGNKENKKPKADKSQSRANVSAYRTAQDQGKPVSSPFAKKR* |
| Ga0116128_12175041 | 3300009518 | Peatland | MLSIGRIAMPKAQKSNKENKKPEADKNQTKNLSAYKAAQGQGKPASSPFAKKTGR* |
| Ga0116222_13064473 | 3300009521 | Peatlands Soil | MNMSKGQKGNKENKKPKADKDRVRGVSAYKAAQSQGKPASSRFGKKA* |
| Ga0116218_12361603 | 3300009522 | Peatlands Soil | MNMSKGQKGNKENKKPKADKDRVRGVSAYKAAQSQGKPASSLFGKKT* |
| Ga0116218_12839251 | 3300009522 | Peatlands Soil | KENKKPKADKNQSKANVSAYKAAQGQGKPASSPFAKKT* |
| Ga0116106_11184211 | 3300009645 | Peatland | KPKADKNQSKANVSAYKAAQGQDKPASNPFAKKT* |
| Ga0105855_11454601 | 3300009649 | Permafrost Soil | KKPKADKNQSEANVSAYKAAQGQGKPASSPFAKKT* |
| Ga0105856_10788141 | 3300009662 | Permafrost Soil | MSKAQKGNKENKKQKADKNQSEANMSAYKAAQGQGKPPSSPFAKKT* |
| Ga0116224_103586392 | 3300009683 | Peatlands Soil | KENKKPKADKNQSKANVSAYKAAQGQGKPVSSPFAKKT* |
| Ga0116216_102305291 | 3300009698 | Peatlands Soil | KKPKADKNRVKDVSAYKSAQSQGKPASSRFGKKT* |
| Ga0116216_104204621 | 3300009698 | Peatlands Soil | KGQKGNKENKKPKADKDRVRGVSAYKAAQSQGKPASSRFGKKA* |
| Ga0126380_120510071 | 3300010043 | Tropical Forest Soil | MAKEQRGNRENKKPKADKNRVKSVSAYKAAQSLGKPASSRLGKRDVTR* |
| Ga0134125_103883541 | 3300010371 | Terrestrial Soil | MSKGQNGNKEKAKADKNRVKNVSAYKAAQSLGKPAGSQFEKKT* |
| Ga0136449_1037224111 | 3300010379 | Peatlands Soil | MLLIGRIAMSKAQKSNKEYKKPKADKNQVKNVSAYKAAQGQGKPASSPFAKKP* |
| Ga0134126_111915783 | 3300010396 | Terrestrial Soil | MRMSKIQKSNKENKKPKADKNRVRAISPYKVAQGQGKPASSRF |
| Ga0134126_112957431 | 3300010396 | Terrestrial Soil | MSKAQKGNKENKKPKGDKNRVKSVSAYKAAQSLGKSATSQFGKKT* |
| Ga0134122_120628283 | 3300010400 | Terrestrial Soil | MSKAQKGNKENKKPKADKSQSKANVSAYRTAQDQGKPAS |
| Ga0150983_133598431 | 3300011120 | Forest Soil | NKENKKPKADKNRVKGVSAYKSAQSQGKPASSRFGKKT* |
| Ga0137392_100529181 | 3300011269 | Vadose Zone Soil | PIREADKNQPKTHVSAYKAAQGQGKPSFNPFARKT* |
| Ga0137392_109320102 | 3300011269 | Vadose Zone Soil | MSKSQKGNKGNKKPKADKSQSNANVSAYKAAQGQGKPASSPFAKKT* |
| Ga0137393_110440711 | 3300011271 | Vadose Zone Soil | MSKAQKGNKENNKPKSCKTETKVNVSAYNAAQGQGKPVSSPFAKKT* |
| Ga0153954_10112565 | 3300011418 | Attine Ant Fungus Gardens | MSKAQKGNKEHKKPKADKNHVRTHVSAYKAAQAQAKPASNPFAKKA* |
| Ga0120139_10200721 | 3300012019 | Permafrost | MSKAQKSNKENKKPKADKNQTKNVSAYKTAQGQGKLAGSPFAKKT* |
| Ga0153974_11047171 | 3300012180 | Attine Ant Fungus Gardens | MSKGQKGNKENKKAKGDKNRVKNVSAYKAAQGLGKPASSQLGKKT* |
| Ga0153922_11361391 | 3300012181 | Attine Ant Fungus Gardens | MSKAQKGNKENKKAKADKNRVKSVSAYKAAQSLGKPAISQFGKKT* |
| Ga0137388_107707583 | 3300012189 | Vadose Zone Soil | MSKARKGNKENKKPRANKDQCKDIQSAYKAAHGQGKPANSQYPKKT* |
| Ga0137363_102781172 | 3300012202 | Vadose Zone Soil | MSKAQKGNKEKKKPKADQPKTHVSAYKAAQDPAKPSFNPFAKKT* |
| Ga0137399_106218731 | 3300012203 | Vadose Zone Soil | PIREADKNQPKTHVSAYKAAQSQGKPSFNPFARKT* |
| Ga0150985_1001944895 | 3300012212 | Avena Fatua Rhizosphere | MSKAQKGNKENKKPKGDKNQAKSNVSAYKVAQGQGKPSTNPFARKT* |
| Ga0150985_1143855601 | 3300012212 | Avena Fatua Rhizosphere | MSKAQKGNKENKKPKTDKNQSKSNVSAYKVAQGQGKPSTNPFARKT* |
| Ga0137371_112146581 | 3300012356 | Vadose Zone Soil | MSKGRKGNKENKKPKADKNQSKANVSADKAAQGHVKPASSPFAKKT* |
| Ga0137361_102699861 | 3300012362 | Vadose Zone Soil | NKEKKKPKADKNQPKTHVSAYKAAQDQAKPSFNPFAKKT* |
| Ga0150984_1032233963 | 3300012469 | Avena Fatua Rhizosphere | KPKADKNQPKTHVSAYKAAQGQGKPSFNPFARKT* |
| Ga0150984_1155586092 | 3300012469 | Avena Fatua Rhizosphere | MSKAQKGNKEHKKPKTDKNQSKSNVSAYKVAQGQGKPSTNPFARKT* |
| Ga0137413_111953661 | 3300012924 | Vadose Zone Soil | MSKAQKGNKENKKLKADKTQSKANVSAYKAAQGQGKPASSPFA |
| Ga0137410_109903973 | 3300012944 | Vadose Zone Soil | MSKSQKSNKGNKKPKADKTQSNANVSAYKAAQGQGKPASSPFAK |
| Ga0164301_106104751 | 3300012960 | Soil | MSKAQQGNKEKKQPKAAKNQPKTHVSAYKAAQGQGKPSVNPFARKT* |
| Ga0164301_107603793 | 3300012960 | Soil | MSKAQKGNKENKMPKADKSQPKANVSAYRTAQDQGKPASSPFAKKR* |
| Ga0164308_104738301 | 3300012985 | Soil | MSKAQKGNKERKKPKADKNQPKTHVSAYKAAQIQAKP |
| Ga0164305_101726121 | 3300012989 | Soil | PKADKNQPRATISAYRSAQGQGKPASSPFARKKI* |
| Ga0164305_103132453 | 3300012989 | Soil | MSKPQKGNKETKNPKADKTQTKANVSAYKAAQGQGKPASSPFAKKT* |
| Ga0157371_105307133 | 3300013102 | Corn Rhizosphere | KESKKPKADKNRPQATISAYRSAQGQGKPASSPFARKKI* |
| Ga0163162_106972521 | 3300013306 | Switchgrass Rhizosphere | MSKAQKGNKENKKPKADKSQSKANVSAYRTAQDQGKPA |
| Ga0120135_10949002 | 3300014054 | Permafrost | MSKVQKGNKESKKPKADKNRSNVNVSAYKAAQGQGK |
| Ga0181530_101272284 | 3300014159 | Bog | MLSIGRIAMSKAQKSNKENKKPKADQNQVKNVSAYKAAQGQGKPASSPFAKKTGR* |
| Ga0181530_104900181 | 3300014159 | Bog | MSKAQKGNKENRKPKADKNHSKANVSAYKAAQGQGKPASSP |
| Ga0163163_128219191 | 3300014325 | Switchgrass Rhizosphere | MSKGQKGNKENKKAKADKNRVKNVSAYKAAQSLGKPAGSQFGKKT* |
| Ga0182018_101066271 | 3300014489 | Palsa | RKPKADKNQSKANVSAYKAAQGQGKPASSPFAKKT* |
| Ga0182015_107779892 | 3300014495 | Palsa | ENRKPKADKNQSKANVSAYKAAQGQGKPASSPFAKKT* |
| Ga0181522_101022714 | 3300014657 | Bog | MSKAQKSNKETKKPKADAGKQKAVSAYKSAQTQGKPTTGNPFAKKT* |
| Ga0173483_106357442 | 3300015077 | Soil | AQKGNKENKKPKADKSQSKANVSAYRTAQDHGKPVSSPFAKKR* |
| Ga0132258_1018606510 | 3300015371 | Arabidopsis Rhizosphere | MSKSQKGNKENKKPKAAKNQPSTNVSAYKTAQGQGKPTSSPFAKKT* |
| Ga0132256_1014517002 | 3300015372 | Arabidopsis Rhizosphere | MAKEQRGNRENKKPKADKNRVKSVSAYKATQSLGKPASSRLGKKT* |
| Ga0132257_1011201542 | 3300015373 | Arabidopsis Rhizosphere | MAKEQRGNRENKKPKADKNRVKSVSAYKATQSLGKPANSRLGKKT* |
| Ga0182036_110825572 | 3300016270 | Soil | KENKKPKADKNRAKNVSAYKAAQGQGRPASPFAKKT |
| Ga0182036_114264711 | 3300016270 | Soil | KKKPKADKNQPKTHVSAYKAAQDQAKPSFNPFAKKT |
| Ga0182035_114170871 | 3300016341 | Soil | NKKPKADKNRVKSVSAYKAAQSLAKPASSRFGKKI |
| Ga0182034_112534431 | 3300016371 | Soil | KEHKKPKADKNRPKAKVSAYKTAQAQAKPGSSPFAKKV |
| Ga0182040_107464011 | 3300016387 | Soil | EKKKPKADKNQPKTHVSAYKAAQDQAKPSFNPLAKKT |
| Ga0163161_102529134 | 3300017792 | Switchgrass Rhizosphere | MSKGQKGNKENKKAKADKNGVKNVSAYKAAQSLGKPAGSQFEKKT |
| Ga0187854_100923812 | 3300017938 | Peatland | MSKAQKGNKENKKPKADKNQSKANVSAYKAAQGQGKPA |
| Ga0187783_100971842 | 3300017970 | Tropical Peatland | MSKAQKSNKEIKKPKADKNRIKNVSEYKAAQSLGKPAISRFGKKT |
| Ga0187885_103105991 | 3300018025 | Peatland | RKPKADKNQSKANVSAYKAAQGQGKPASNPFAKKTGR |
| Ga0187885_103698261 | 3300018025 | Peatland | MSKAQKSNKENRKPKADKNQSKANVSAYKAAQGQGKPAS |
| Ga0187875_102457352 | 3300018035 | Peatland | MSKVQKRHQENKKPKADKNQSTANVSAYKAAQGQGKPASSPFAKKA |
| Ga0187862_108130431 | 3300018040 | Peatland | KENKKPKADKNQSKANVSAYKAAQGQGKPASSPFAKKT |
| Ga0184618_103802061 | 3300018071 | Groundwater Sediment | MSKAQKGNKENKKPKADKSQSKANVSAYRTAQDQGKP |
| Ga0184640_105542432 | 3300018074 | Groundwater Sediment | MSKAQKGNKENKKPKADKSQSKANVSAYRTAQDQGKPASSPFA |
| Ga0184632_101377182 | 3300018075 | Groundwater Sediment | MSKAQKGNKEKADKNQPKTHVSAYKAAQGQGKPSFNPFARKT |
| Ga0184625_101285261 | 3300018081 | Groundwater Sediment | MSKAQKGNKENKKPKADKSQSKANVSAYRTAQDQGKPASSPF |
| Ga0066667_116939741 | 3300018433 | Grasslands Soil | NKKPKADKNQSKANVSAYKAAQAQGKPASSPFAKKT |
| Ga0066662_109449181 | 3300018468 | Grasslands Soil | KESKKPKADKDQPKANVSAYKAAQGLGKPVSSPFAKKT |
| Ga0066662_125476211 | 3300018468 | Grasslands Soil | MSKAQRGNKENKKPKADKNQSKANVSAYKTAQGQGK |
| Ga0190271_126496421 | 3300018481 | Soil | MSKAQKGNKESKKPKADRSQSIANVSAYKAAQGQGK |
| Ga0184648_11192251 | 3300019249 | Groundwater Sediment | RLSMRIAMSKAQKGNNENKKPKTDKNQSKANVSAYKAAQGQGKPASSPFAKKT |
| Ga0210395_100190782 | 3300020582 | Soil | MSKGQKSNRESMKPKGDKNRIKRLSAYKAAQSQGKPANSQFGKKT |
| Ga0210401_101008014 | 3300020583 | Soil | MSMSKGQKNNRESMKPKGDKNRIKRLSAYKAAQSQGKPANSQFGKKT |
| Ga0210405_111461602 | 3300021171 | Soil | NKENKKPKADKNRVKGVSAYKSAQSQGKPASSRFGKKT |
| Ga0210396_112976301 | 3300021180 | Soil | MSKAQKGNKENKKPKADKNRVKGVSAYKSAQSQGKPAS |
| Ga0210393_100860354 | 3300021401 | Soil | MSKGQKSNKENKKAKADKNRVKNVSAYKAAQGLGKPASSQFGKKT |
| Ga0210385_115627452 | 3300021402 | Soil | SMKPKGDKNRIKRLSAYKAAQSQGKPANSQFGKKT |
| Ga0210397_103864171 | 3300021403 | Soil | SNRESMKPKGDKNRIKRLSAYKAAQSQGKPANSQFGKKT |
| Ga0210389_105899592 | 3300021404 | Soil | MSKTQKGNKENKTPKADKNRSRSMSAYKATQSQGKPASN |
| Ga0210386_109798981 | 3300021406 | Soil | MSKGQKSNKENMKPKADKNRIKNVSAYKVAQSHAKPVNNRLGKKT |
| Ga0210384_109874921 | 3300021432 | Soil | STKQIAMSKAQKGNKENKKAKADKNRVKSVSAYKAAQSLGKPAISQFGKKT |
| Ga0242658_10860573 | 3300022530 | Soil | KGQKSNKENKKAKADKNRVKNVSAYKAAQGLGKPASSQFGKKT |
| Ga0242654_102165751 | 3300022726 | Soil | MSKAQKGNKENKKPKADKNLVKSVSAYKAEQSLGKPAISQFGKKT |
| Ga0208219_10221171 | 3300025625 | Arctic Peat Soil | MSKVQKGNKENKKLKADKNQSTANVSAYKAAQGQGKPASSPFAKKA |
| Ga0209385_11461141 | 3300025650 | Arctic Peat Soil | NKKPKADKNQSNANVSAYKAAQGQGKPASRPFAKKT |
| Ga0207654_103899621 | 3300025911 | Corn Rhizosphere | MSKAQKGNKENKKPKADKSQSRANVSAYRTAQDQGKPVSSPFAKKR |
| Ga0207662_101324242 | 3300025918 | Switchgrass Rhizosphere | MSKAQKGNKENKKPKADKSQSKANVSAYRTAQDQG |
| Ga0207681_103133101 | 3300025923 | Switchgrass Rhizosphere | ELSPTKRISMSKGQKGNKENKKAKADKNGVKNVSAYKAAQSLGKPAGSQFGKKT |
| Ga0207664_110775582 | 3300025929 | Agricultural Soil | AMSKEQKGNKENKKPKADKNRVKSVSAYKAAQSLGRSATSQFGKKT |
| Ga0207706_104423823 | 3300025933 | Corn Rhizosphere | MSKGQNGNKEKAKADKNRVKNVSAYKAAQSLGKPAGSQFEKKT |
| Ga0207712_105034072 | 3300025961 | Switchgrass Rhizosphere | MSKAQKGNKENKKPKADKNQPRATISAYRTAQGQGK |
| Ga0210090_10495682 | 3300025965 | Natural And Restored Wetlands | MSKARKGNKENKKPRADKNQSKANVSAYKAAQGQGKPASSPFAKKT |
| Ga0207703_113275222 | 3300026035 | Switchgrass Rhizosphere | KKPKADKNQSKANVSAYRAAQGQGKPASSPFAKKT |
| Ga0207639_105051572 | 3300026041 | Corn Rhizosphere | MSKAQKGNKENKKPKADKNQPRATISAYRSAQGQGK |
| Ga0209880_10446171 | 3300026271 | Soil | MSKAQKGNKENKKPKADKNQSEPNVSAYKAAQGKPASSPFAKKT |
| Ga0209375_11527771 | 3300026329 | Soil | KKPKADKNQPKTHVSAYKAAQSQGKPSFNAFARKT |
| Ga0257160_10787532 | 3300026489 | Soil | MSKAQKGNKENKKPKADKTQTKANVSAYKAAQGQGK |
| Ga0209421_11369651 | 3300027432 | Forest Soil | ENKKPKADKNQAKTNVSAYKAAQGQGKPASSPFAKKT |
| Ga0208043_11950772 | 3300027570 | Peatlands Soil | MNMSKGQKGNKENKKPKADKDRVRGVSAYKAAQSQGKPASSRFGKKA |
| Ga0209217_10361791 | 3300027651 | Forest Soil | NKENKKPKADKTQTKANVSAYKAAQSQGKPASSPFAKKT |
| Ga0209248_100673512 | 3300027729 | Bog Forest Soil | MSKAQKGNKENKKPKAEKNWSKANVSAYRAAQSQGKPASSQFAKKS |
| Ga0209180_102217681 | 3300027846 | Vadose Zone Soil | KEKKKPKADKNQPKTHVSAYKAAQDQAKPPFNPFAKKT |
| Ga0209590_104349101 | 3300027882 | Vadose Zone Soil | KENKKPKADKNQSKANVSAYKVAQGQGKPAGSPFAKKT |
| Ga0209068_103790061 | 3300027894 | Watersheds | MVFGLSIRRITMSKAQKGNKENRKPKADKDQSKTNVSAYKAAQRLGKPASSPFAKKT |
| Ga0209624_100450315 | 3300027895 | Forest Soil | MSMSKGQKSNRESMKPKGDKNRIKRLSAYKAAQSQGKPANSQFGKKT |
| Ga0209624_102647243 | 3300027895 | Forest Soil | MSKSQKGNKENKKPKADENRVKGVSAYKSAQNQAKPSSSRF |
| Ga0209067_109044352 | 3300027898 | Watersheds | ENKKPKADKNQSKANVSAYKAAQGQGKPASSPFAKKT |
| Ga0268265_108242841 | 3300028380 | Switchgrass Rhizosphere | MSKAQKGNKENKKPKADKSQSKANVSAYRTAQDQGKPVSSPFA |
| Ga0268265_112433783 | 3300028380 | Switchgrass Rhizosphere | GRIAMSKAQKGNKENKKPKADKSQSKANVSAYRTAQDQGKPVQPLR |
| Ga0307280_102286141 | 3300028768 | Soil | KKKPKGDKNQPKTHVSAYKAAQGEGKPSFNPFARKT |
| Ga0307305_102464012 | 3300028807 | Soil | EKKKPKGDKNQPKTHVSAYKAAQGEGKPSFNPFARKT |
| Ga0308202_11561481 | 3300030902 | Soil | KKPKADKNQPRATLSAYRTAQGQGKPASNPFARKKI |
| Ga0075386_121956041 | 3300030916 | Soil | MSKTQKGNKEKKKPKADKVQPKSHLSAYKAAQGQGKPS |
| Ga0308201_103267291 | 3300031091 | Soil | ESKKPKADKNQSKANVSSYKAAQGQGKPANNPFAKKA |
| Ga0308197_102568471 | 3300031093 | Soil | MSKAQKGNKENKKPKGDKNQHKANVSAYKAAQGQGKPASSPFAKKT |
| Ga0308199_10404812 | 3300031094 | Soil | PPCRRLKKEIRKKRKADKNQPKTHVSAYKSAQGEGKPSFNPFARKT |
| Ga0308181_10933243 | 3300031099 | Soil | GRPMSKAQKGNKENKKPKGDKNQAKSNVSAYKVAQGQGKPSTNPFARKT |
| Ga0308187_100418791 | 3300031114 | Soil | KKKPKADKDQPKSHVSAYKAAQGQGKPSFNPFARKT |
| Ga0170824_1154160682 | 3300031231 | Forest Soil | QKGNKEKKKPKTDKSQPKTHVSAYKAAQGQGKPSFNPFAKKT |
| Ga0307474_106614042 | 3300031718 | Hardwood Forest Soil | MSKAQKGNKENKKAKADKNRVKNVSAYKAAQGLGKPASSQFGKKT |
| Ga0306918_113988951 | 3300031744 | Soil | MSKAQKGNKENKKPKADKNRPRNVSAYKAAQGQGKPASPFAKKT |
| Ga0318557_101214945 | 3300031795 | Soil | NKEKKKPKADKNQPKTHVSAYKAAQDQAKPSFNPFAKKT |
| Ga0306919_113215412 | 3300031879 | Soil | EKKKPKADKNQPKTHVSAYKAAQDQAKPSFNPFAKKT |
| Ga0306925_107884253 | 3300031890 | Soil | NKKPKADKNQSKANVSAYKAAQGQGKPASSPFAKKT |
| Ga0306923_100396047 | 3300031910 | Soil | MSKAQKGNKENKKPKADKNRAKNVSAYKAAQGQGRPASPFAKKT |
| Ga0310910_111491092 | 3300031946 | Soil | KKPKADKNQPKTHVSAYKAAQDQAKPSFNPFAKKT |
| Ga0310909_106032171 | 3300031947 | Soil | MSKAQKGNKENKKPKANKNQSKANVSAYKAAQGQGKPASSPF |
| Ga0306926_115941721 | 3300031954 | Soil | MSKAQKGNKEKEKPKADKNQSKANVSAYKAAQGQGKP |
| Ga0310895_104502281 | 3300032122 | Soil | NKKPKADKNQPRATISAYRTAQGQGKPASSPFARKKI |
| Ga0315281_115066781 | 3300032163 | Sediment | MSKAQKGNKESKKPKAAKNQSKDNVSAYKVAQGQGK |
| Ga0306920_1001065648 | 3300032261 | Soil | MSKAQKGNKENKKPKADKNRAKNVSAYKAAQGQGKPAS |
| Ga0335074_111739762 | 3300032895 | Soil | MSKGQKSNKENKKAKADKNRVKNVSAYKAAQSLGKPASSHFGKKTGS |
| ⦗Top⦘ |