Basic Information | |
---|---|
Family ID | F034919 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 173 |
Average Sequence Length | 46 residues |
Representative Sequence | HYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRAAIVELRKLGIDL |
Number of Associated Samples | 141 |
Number of Associated Scaffolds | 173 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 5.78 % |
% of genes near scaffold ends (potentially truncated) | 88.44 % |
% of genes from short scaffolds (< 2000 bps) | 91.91 % |
Associated GOLD sequencing projects | 138 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.705 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.561 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.792 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.665 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.92% β-sheet: 8.22% Coil/Unstructured: 69.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 173 Family Scaffolds |
---|---|---|
PF00933 | Glyco_hydro_3 | 4.05 |
PF07731 | Cu-oxidase_2 | 2.89 |
PF13191 | AAA_16 | 1.73 |
PF00196 | GerE | 1.73 |
PF13783 | DUF4177 | 1.73 |
PF01872 | RibD_C | 1.73 |
PF08734 | GYD | 1.73 |
PF00903 | Glyoxalase | 1.16 |
PF04542 | Sigma70_r2 | 1.16 |
PF01243 | Putative_PNPOx | 1.16 |
PF12681 | Glyoxalase_2 | 1.16 |
PF04545 | Sigma70_r4 | 1.16 |
PF00561 | Abhydrolase_1 | 1.16 |
PF11066 | DUF2867 | 0.58 |
PF00496 | SBP_bac_5 | 0.58 |
PF13426 | PAS_9 | 0.58 |
PF03449 | GreA_GreB_N | 0.58 |
PF00583 | Acetyltransf_1 | 0.58 |
PF13462 | Thioredoxin_4 | 0.58 |
PF04075 | F420H2_quin_red | 0.58 |
PF00400 | WD40 | 0.58 |
PF00571 | CBS | 0.58 |
PF04430 | DUF498 | 0.58 |
PF02525 | Flavodoxin_2 | 0.58 |
PF13602 | ADH_zinc_N_2 | 0.58 |
PF01747 | ATP-sulfurylase | 0.58 |
PF01738 | DLH | 0.58 |
PF00118 | Cpn60_TCP1 | 0.58 |
PF00027 | cNMP_binding | 0.58 |
PF00486 | Trans_reg_C | 0.58 |
PF02615 | Ldh_2 | 0.58 |
PF13565 | HTH_32 | 0.58 |
PF02371 | Transposase_20 | 0.58 |
PF02826 | 2-Hacid_dh_C | 0.58 |
PF12728 | HTH_17 | 0.58 |
PF01566 | Nramp | 0.58 |
PF03176 | MMPL | 0.58 |
PF08327 | AHSA1 | 0.58 |
PF03992 | ABM | 0.58 |
PF00872 | Transposase_mut | 0.58 |
PF00211 | Guanylate_cyc | 0.58 |
PF00144 | Beta-lactamase | 0.58 |
PF06897 | DUF1269 | 0.58 |
PF05988 | DUF899 | 0.58 |
PF16640 | Big_3_5 | 0.58 |
PF13391 | HNH_2 | 0.58 |
PF00916 | Sulfate_transp | 0.58 |
PF00990 | GGDEF | 0.58 |
PF01058 | Oxidored_q6 | 0.58 |
PF03704 | BTAD | 0.58 |
PF00679 | EFG_C | 0.58 |
PF12840 | HTH_20 | 0.58 |
PF02518 | HATPase_c | 0.58 |
PF00781 | DAGK_cat | 0.58 |
PF01709 | Transcrip_reg | 0.58 |
PF01548 | DEDD_Tnp_IS110 | 0.58 |
PF08386 | Abhydrolase_4 | 0.58 |
PF00291 | PALP | 0.58 |
PF07690 | MFS_1 | 0.58 |
PF01266 | DAO | 0.58 |
PF13669 | Glyoxalase_4 | 0.58 |
PF01047 | MarR | 0.58 |
PF10604 | Polyketide_cyc2 | 0.58 |
PF01370 | Epimerase | 0.58 |
PF02254 | TrkA_N | 0.58 |
PF09948 | DUF2182 | 0.58 |
PF03625 | DUF302 | 0.58 |
PF06803 | DUF1232 | 0.58 |
PF00950 | ABC-3 | 0.58 |
PF04237 | YjbR | 0.58 |
PF16657 | Malt_amylase_C | 0.58 |
COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
---|---|---|---|
COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 4.05 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 2.89 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.73 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.73 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.73 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.16 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.16 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.16 |
COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.16 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.16 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.16 |
COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.58 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.58 |
COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.58 |
COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.58 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.58 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.58 |
COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.58 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.58 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.58 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.58 |
COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.58 |
COG2046 | ATP sulfurylase (sulfate adenylyltransferase) | Inorganic ion transport and metabolism [P] | 0.58 |
COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.58 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.58 |
COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.58 |
COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.58 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.58 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.58 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.58 |
COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.58 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.58 |
COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.58 |
COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.58 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.58 |
COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.58 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.58 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.58 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.58 |
COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.71 % |
Unclassified | root | N/A | 13.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig117324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei → Conexibacter woesei DSM 14684 | 565 | Open in IMG/M |
2170459005|F1BAP7Q01CMP0M | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
2189573004|GZGWRS402G63PC | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2089971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
3300000956|JGI10216J12902_105561534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1034 | Open in IMG/M |
3300000956|JGI10216J12902_109051824 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300000956|JGI10216J12902_110536427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1260 | Open in IMG/M |
3300000956|JGI10216J12902_110758699 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300001686|C688J18823_10553855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
3300001686|C688J18823_10787357 | Not Available | 604 | Open in IMG/M |
3300004006|Ga0055453_10204409 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300004114|Ga0062593_102855568 | Not Available | 552 | Open in IMG/M |
3300004157|Ga0062590_100714820 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300004463|Ga0063356_106023984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 520 | Open in IMG/M |
3300005159|Ga0066808_1023829 | Not Available | 613 | Open in IMG/M |
3300005164|Ga0066815_10017128 | Not Available | 975 | Open in IMG/M |
3300005165|Ga0066869_10085121 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300005165|Ga0066869_10133967 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005180|Ga0066685_10210305 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300005206|Ga0068995_10056355 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005332|Ga0066388_100125961 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
3300005332|Ga0066388_108166777 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005437|Ga0070710_10798813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina | 674 | Open in IMG/M |
3300005440|Ga0070705_100726601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 783 | Open in IMG/M |
3300005445|Ga0070708_100262658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1623 | Open in IMG/M |
3300005445|Ga0070708_100634366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
3300005456|Ga0070678_100864992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 824 | Open in IMG/M |
3300005471|Ga0070698_100056667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3970 | Open in IMG/M |
3300005471|Ga0070698_102236077 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005518|Ga0070699_100286325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1476 | Open in IMG/M |
3300005549|Ga0070704_101308658 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300005553|Ga0066695_10473984 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300005558|Ga0066698_10044265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2782 | Open in IMG/M |
3300005559|Ga0066700_10561036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
3300005574|Ga0066694_10580283 | Not Available | 522 | Open in IMG/M |
3300005576|Ga0066708_10851607 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300005587|Ga0066654_10898694 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005764|Ga0066903_107001374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
3300006032|Ga0066696_10902271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
3300006034|Ga0066656_10630407 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300006046|Ga0066652_100511623 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300006049|Ga0075417_10024224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2453 | Open in IMG/M |
3300006578|Ga0074059_10005338 | Not Available | 820 | Open in IMG/M |
3300006579|Ga0074054_11491697 | Not Available | 723 | Open in IMG/M |
3300006580|Ga0074049_10518356 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300006755|Ga0079222_10950801 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300006755|Ga0079222_12009212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
3300006806|Ga0079220_12121104 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300006881|Ga0068865_101222819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 665 | Open in IMG/M |
3300006914|Ga0075436_100258817 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300006953|Ga0074063_14235297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
3300009012|Ga0066710_100643896 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1612 | Open in IMG/M |
3300009012|Ga0066710_102091006 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300009089|Ga0099828_11266340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
3300009137|Ga0066709_103829788 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300009147|Ga0114129_11225923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 933 | Open in IMG/M |
3300009148|Ga0105243_11397128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
3300009545|Ga0105237_11147281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 784 | Open in IMG/M |
3300009818|Ga0105072_1107970 | Not Available | 563 | Open in IMG/M |
3300009840|Ga0126313_11764043 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300010036|Ga0126305_10218583 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300010037|Ga0126304_10047303 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
3300010037|Ga0126304_10897447 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300010038|Ga0126315_11217257 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300010047|Ga0126382_12110253 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300010325|Ga0134064_10139647 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300010333|Ga0134080_10195385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
3300010337|Ga0134062_10768489 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300010403|Ga0134123_13043870 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300011405|Ga0137340_1116683 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300011412|Ga0137424_1059053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Bogoriellaceae → Georgenia → Georgenia yuyongxinii | 721 | Open in IMG/M |
3300012021|Ga0120192_10007937 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300012021|Ga0120192_10012462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1259 | Open in IMG/M |
3300012201|Ga0137365_11142097 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300012204|Ga0137374_10355795 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300012206|Ga0137380_10347988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 1322 | Open in IMG/M |
3300012212|Ga0150985_112993191 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300012212|Ga0150985_122701748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
3300012350|Ga0137372_10247546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1404 | Open in IMG/M |
3300012350|Ga0137372_11223224 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300012353|Ga0137367_10959445 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300012354|Ga0137366_10234888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1363 | Open in IMG/M |
3300012354|Ga0137366_10483447 | Not Available | 895 | Open in IMG/M |
3300012354|Ga0137366_10705660 | Not Available | 719 | Open in IMG/M |
3300012354|Ga0137366_10847846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 647 | Open in IMG/M |
3300012355|Ga0137369_10107970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2271 | Open in IMG/M |
3300012355|Ga0137369_10202213 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
3300012355|Ga0137369_10870361 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300012355|Ga0137369_11120528 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300012358|Ga0137368_10401555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 900 | Open in IMG/M |
3300012359|Ga0137385_10035682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4459 | Open in IMG/M |
3300012360|Ga0137375_10310631 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
3300012360|Ga0137375_11383966 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300012529|Ga0136630_1220605 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300012532|Ga0137373_11042506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
3300012684|Ga0136614_10816504 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300012988|Ga0164306_11594445 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300012989|Ga0164305_11134932 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300013105|Ga0157369_10508364 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300013765|Ga0120172_1141989 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300013770|Ga0120123_1111641 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300013772|Ga0120158_10029363 | All Organisms → cellular organisms → Bacteria | 4240 | Open in IMG/M |
3300014254|Ga0075312_1141453 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300014320|Ga0075342_1199660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 564 | Open in IMG/M |
3300014326|Ga0157380_13186267 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300014965|Ga0120193_10025807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 705 | Open in IMG/M |
3300014968|Ga0157379_10977815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 806 | Open in IMG/M |
3300015371|Ga0132258_10050699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9491 | Open in IMG/M |
3300015371|Ga0132258_10122533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae | 6181 | Open in IMG/M |
3300015371|Ga0132258_10245522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4372 | Open in IMG/M |
3300015371|Ga0132258_10274461 | All Organisms → cellular organisms → Bacteria | 4134 | Open in IMG/M |
3300015371|Ga0132258_11646737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1619 | Open in IMG/M |
3300017659|Ga0134083_10511598 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300017959|Ga0187779_11206738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
3300017974|Ga0187777_10183444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1406 | Open in IMG/M |
3300018028|Ga0184608_10365841 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300018029|Ga0187787_10323016 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300018089|Ga0187774_10541787 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300018433|Ga0066667_11378640 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300018466|Ga0190268_11548228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
3300018469|Ga0190270_10235251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 1580 | Open in IMG/M |
3300018481|Ga0190271_10890963 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300019361|Ga0173482_10553683 | Not Available | 569 | Open in IMG/M |
3300020150|Ga0187768_1100252 | Not Available | 660 | Open in IMG/M |
3300021329|Ga0210362_1244660 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300025505|Ga0207929_1109727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 514 | Open in IMG/M |
3300025791|Ga0210115_1054718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 847 | Open in IMG/M |
3300025905|Ga0207685_10730924 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300025915|Ga0207693_10761514 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300025916|Ga0207663_10734274 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300025922|Ga0207646_10058795 | All Organisms → cellular organisms → Bacteria | 3433 | Open in IMG/M |
3300025922|Ga0207646_11164919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
3300025922|Ga0207646_11622305 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300025935|Ga0207709_11085940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 657 | Open in IMG/M |
3300025939|Ga0207665_11302928 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300027401|Ga0208637_1029979 | Not Available | 619 | Open in IMG/M |
3300027636|Ga0214469_1143149 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300027870|Ga0209023_10104080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2007 | Open in IMG/M |
3300027873|Ga0209814_10279500 | Not Available | 726 | Open in IMG/M |
3300027957|Ga0209857_1050521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
3300028573|Ga0265334_10343041 | Not Available | 511 | Open in IMG/M |
3300028589|Ga0247818_11061240 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300028679|Ga0302169_10202451 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300028718|Ga0307307_10081274 | Not Available | 974 | Open in IMG/M |
3300028719|Ga0307301_10077287 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300028771|Ga0307320_10258420 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300028784|Ga0307282_10647473 | Not Available | 512 | Open in IMG/M |
3300028880|Ga0307300_10226309 | Not Available | 614 | Open in IMG/M |
3300028881|Ga0307277_10092725 | Not Available | 1275 | Open in IMG/M |
3300030006|Ga0299907_10679056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
3300031521|Ga0311364_10855978 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300031716|Ga0310813_11251895 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300031716|Ga0310813_12111013 | Not Available | 532 | Open in IMG/M |
3300031722|Ga0311351_10483209 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300031771|Ga0318546_10853026 | Not Available | 641 | Open in IMG/M |
3300031938|Ga0308175_101672445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 712 | Open in IMG/M |
3300031938|Ga0308175_102081206 | Not Available | 636 | Open in IMG/M |
3300032143|Ga0315292_10898930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
3300032143|Ga0315292_11305827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
3300032143|Ga0315292_11602736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
3300032164|Ga0315283_10707995 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300032205|Ga0307472_101374233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 684 | Open in IMG/M |
3300032211|Ga0310896_10624163 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300032397|Ga0315287_10419897 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
3300032770|Ga0335085_12089054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300032829|Ga0335070_11649896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
3300032897|Ga0335071_10392453 | Not Available | 1341 | Open in IMG/M |
3300032897|Ga0335071_10776421 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300032955|Ga0335076_10514608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1080 | Open in IMG/M |
3300033158|Ga0335077_11134540 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300033416|Ga0316622_101534624 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300033550|Ga0247829_11053770 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300033808|Ga0314867_042553 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.20% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.05% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.89% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.89% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.31% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.31% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.31% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.73% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.73% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.73% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.73% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.73% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.16% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.16% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.16% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.16% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.16% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.16% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.58% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.58% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.58% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.58% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.58% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.58% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.58% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.58% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.58% | |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_02223700 | 2124908016 | PTPGHYRVLRGGEPLRKANGMPFMLPFSPDTTRWRRTATVELRKLGIDL | |
E41_12385540 | 2170459005 | Grass Soil | STPGHYHVLRDGKPLRKQNGMPFTLPFSPDTIRWRRAAIVELRKLGIDV |
FG2_06958200 | 2189573004 | Grass Soil | PGHYRVLREGKPLRKQNGMPFTLPFSPDTIRWRRAAIVELRKLGIDL |
ICChiseqgaiiDRAFT_20899711 | 3300000033 | Soil | TLRKENGMPFMLPFSPDTVRWRRAAIVELRKLGIDL* |
JGI10216J12902_1055615343 | 3300000956 | Soil | MNHLWHTLGPKSYRVLRDGRPLRKANGLPFMSVSRDTIPWRRAAIVELRKLGINV |
JGI10216J12902_1090518242 | 3300000956 | Soil | RKANGMPFTLPFSPDTTRWRRTAIVDLRKLDIHL* |
JGI10216J12902_1105364271 | 3300000956 | Soil | HDGKPLRKANGMPFMLPFSPDTIRWRRAAIVELRKLGINV* |
JGI10216J12902_1107586992 | 3300000956 | Soil | VLRNGKPLRKANGMPFTLPFSPDTTRWRRAATVELRKLGIDLSN |
C688J18823_105538551 | 3300001686 | Soil | LGKANGMPFTLPYFPDTIRWRRAAILELRKLGIDL* |
C688J18823_107873571 | 3300001686 | Soil | RKENGMPVTLPFSPGTTRWRKTAILELRKLGVDV* |
Ga0055453_102044091 | 3300004006 | Natural And Restored Wetlands | STPGHYRVLRDGKPLRKANGMPFMLPFSPDTVRWRRTAIVELRKLGIDV* |
Ga0062593_1028555682 | 3300004114 | Soil | STPGHYRVLRDGKPLRKANGLPFTLPFSPDTIRWRRAAIVELRKLGISV* |
Ga0062590_1007148201 | 3300004157 | Soil | TPGHYRVLRDGKPLRKANGLPFTLPFSPDTIRWRRAAIVELRKLGISV* |
Ga0063356_1060239842 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VESTPGHYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRAAIVELRKLGIDV* |
Ga0066808_10238292 | 3300005159 | Soil | GHYHVWRDGKPLRKANGMPVTLPFSPGTTRWRKTAILELRKLGIEV* |
Ga0066815_100171281 | 3300005164 | Soil | YHVWRDGRPLRKANGMPFTLPFSPGTTRWRKTAILDLRKLGIDV* |
Ga0066869_100851212 | 3300005165 | Soil | VLRDGQPLRKQNGMPFTLPFSPDTVRWRRTAIVELRKLGIDL* |
Ga0066869_101339671 | 3300005165 | Soil | VQSTPGHYHVWRDGKPLRKANGMPFTLPFSPGTTRWRKTAILDLRKLGIDV* |
Ga0066685_102103052 | 3300005180 | Soil | VRTYSGPVTVEPTPGHYRVLRDGKVLRKANGMPFTLPFSPDTIRWRRAAIVELRKLGIEP |
Ga0068995_100563552 | 3300005206 | Natural And Restored Wetlands | VGLTVEATPGHYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRSAIIELRKLGINV* |
Ga0066388_1001259612 | 3300005332 | Tropical Forest Soil | VGLTVESTPGHYRVLRDGKPLRKPNGMPVTLPFSPDTIRWRRAAIVELRKLGIDL* |
Ga0066388_1081667772 | 3300005332 | Tropical Forest Soil | MPGHYRVLRDGKPLRKANGMPFTLPFSPDTIRWRRTALVELGKLGLDL* |
Ga0070710_107988132 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | RVLRGGEPLRKANGLPFTLPFSPDTTRWRRTAIVELRKLGIDV* |
Ga0070705_1007266011 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GLTVEPTPGHYRVLRDGKPLRKANGMPFMLPFSPDTTRWRRAAIVELRKLGIDI* |
Ga0070708_1002626583 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VKPAPGHYRVLRNGKPLRKANGMPFTLPFSPDTIRWRRAAIVELRKLGIDL* |
Ga0070708_1006343662 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TVESTPGHYHVYRDGKPLRKANGMPVTLPFSPGTTRWRRTAILDLRKLGIDV* |
Ga0070678_1008649921 | 3300005456 | Miscanthus Rhizosphere | YHVYRDGKPLRKANGMPVTLPFSPGTTRWRRTAILDLRKLGIDV* |
Ga0070698_1000566676 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LREGKPLRKANGMPFTLPFSPDTIRWRRAAIVELRKLGIDV* |
Ga0070698_1022360771 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VEPTPGHYRVLREGKPLRKANGMPFTLPFSPDTIRWRRAAIVELRKLGIGL* |
Ga0070699_1002863253 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PGHYRVLREGKPLRKANGMPFTLPFSPDTIRWRRAAIVELRKLGIDV* |
Ga0070704_1013086583 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LRAGKPLRKANGMPFMLPFSPDTTRWRRTAIVELRKLGIDV* |
Ga0066695_104739842 | 3300005553 | Soil | MRKDLPVRKAKGLTFTLPFSPDTSRWRRTAILDLRKLGIDP* |
Ga0066698_100442652 | 3300005558 | Soil | VRTYSGPVTVEPTPGHYRILRDGKVLRKANGMPFTLPFSPDMIRWRRAAIVELRKLGIEP |
Ga0066700_105610362 | 3300005559 | Soil | VRTYSGPVTVEPTPGHYRVLRDGKVLRKANGMPVTLPFSPDTIRWRRVAIVELRKLGIEP |
Ga0066694_105802832 | 3300005574 | Soil | KALRKQNGMPFTLPFSPDTIRWRRTAIVELRKLGINL* |
Ga0066708_108516072 | 3300005576 | Soil | VESTPGHYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRAATVELRRLGIKL* |
Ga0066654_108986941 | 3300005587 | Soil | GKPLRKANGMPVTLPFSPDTTRWRRTAILDLRKLGIDL* |
Ga0066903_1070013741 | 3300005764 | Tropical Forest Soil | ALGLTVESTPGHYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRTAIVELRKLGIDV* |
Ga0066696_109022711 | 3300006032 | Soil | TVEPTPGHYRVLRKGKPLRRANGMPFMLPFSPDTIRWRRAAIVELRKLGIDV* |
Ga0066656_106304071 | 3300006034 | Soil | YRVLRDGKPLRRPNGMSFMLSFSPDTIRWRRAAIVDLRKLGIDV* |
Ga0066652_1005116232 | 3300006046 | Soil | LTVEPTPGHYRVLRDGRPLRKANGMPFMLPFSPDTIRWRRSAIVELRKLGIDV* |
Ga0075417_100242243 | 3300006049 | Populus Rhizosphere | STPGHYRVLRDGKPLRKANGMPVTLPFSPDTTRWRRAAIVELRKLGFDV* |
Ga0074059_100053383 | 3300006578 | Soil | STPGHYHVWRDGKPLRKANGMPFTLPFSPGTTRWRKTAILDLRKLGIDV* |
Ga0074054_114916971 | 3300006579 | Soil | GHYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRAAIVELRKLGIDV* |
Ga0074049_105183562 | 3300006580 | Soil | GLTVEATPGHYRVLRDGKPLLKANGMPLMLPFSPDTIRWRRAAIVELRKLGINV* |
Ga0079222_109508012 | 3300006755 | Agricultural Soil | ESTPGHYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRSAIVELRKLGIDL* |
Ga0079222_120092122 | 3300006755 | Agricultural Soil | RKANGMPVTLPFSPGTTRWRRTAILDLRKIGIDV* |
Ga0079220_121211041 | 3300006806 | Agricultural Soil | HYHVMRDGKPLRKANGMPFTLPFSPGTTRWRRTAIVELRKLGIDV* |
Ga0068865_1012228192 | 3300006881 | Miscanthus Rhizosphere | GLTVESTPGHYHVYRDGKPLRKANGMPVTLPFSPGTTRWRRTAILDLRKLGIDV* |
Ga0075436_1002588171 | 3300006914 | Populus Rhizosphere | GKPLRKANGMPFTLPFSPDTIRWRRTALVELRKLGIDL* |
Ga0074063_142352971 | 3300006953 | Soil | LTVESTPGHYHVLRDGKPLRKQNGMPFTLPFSPDTIRWRRAAIVELRKLGIDL* |
Ga0066710_1006438961 | 3300009012 | Grasslands Soil | VRTYSGPVTVEPTPGHYRVLRDGKVLRKANGMPFTLPFSPDMIRWRRAAIVELRKLGIEP |
Ga0066710_1020910061 | 3300009012 | Grasslands Soil | MRKDLPVRKAKGLTFTLPFSPDTSRWRRTAILDLRKLGIDP |
Ga0099828_112663401 | 3300009089 | Vadose Zone Soil | LRKANGMPFTLPFSPDTTRWRKTAILDLRKLGIHL* |
Ga0066709_1038297881 | 3300009137 | Grasslands Soil | MRKDLPVRKAKGLTFTLPFSPDTSRWRRTAILDLR |
Ga0114129_112259231 | 3300009147 | Populus Rhizosphere | PLRKANGMPFTLPFSPDTTRWRRAAIVELRKLGIRP* |
Ga0105243_113971282 | 3300009148 | Miscanthus Rhizosphere | RKANGMPFMLPFSPDTIRWRRSAIVELRKLGIDV* |
Ga0105237_111472812 | 3300009545 | Corn Rhizosphere | GKPLRKANGMPVTLPFSPGTTRWRRTAILDLRKIGIDV* |
Ga0105072_11079701 | 3300009818 | Groundwater Sand | VESTPGHYRVLREGKPLRKANGMPFTLPFSPDTIRWRRAAIVELRKLGIDL* |
Ga0126313_117640432 | 3300009840 | Serpentine Soil | TPGHYRVMRDGKPLRKANGMPFMLPFSPDTTRWRRAAVVELRKLGIDI* |
Ga0126305_102185833 | 3300010036 | Serpentine Soil | YRVLRDGKPLRKENGMPFMLPFSPDMTRWRRAAIVELRKLGIDL* |
Ga0126304_100473031 | 3300010037 | Serpentine Soil | HVLRDGKPLRKQNGMPFTLPFSPDTIRWRRTAIVELRKLGIEL* |
Ga0126304_108974472 | 3300010037 | Serpentine Soil | LRKANGMPFMLPFSPDTVRWRRAATVELRKLGIDL* |
Ga0126315_112172571 | 3300010038 | Serpentine Soil | RKSNGMPFTLPFSPDTIRWRRSAIVELRKLGIDL* |
Ga0126382_121102532 | 3300010047 | Tropical Forest Soil | VREGKPFRKANGMPFMLPFSPDTTRWRRTAILELRKLGIEV* |
Ga0134064_101396472 | 3300010325 | Grasslands Soil | VGLTVESTPGHYYVLRDGKPLRKQNGMPFTLPFSPDTIRWRRAAIVELRKLGIDL* |
Ga0134080_101953853 | 3300010333 | Grasslands Soil | LTVESTPGHYKVLRDGKPVRKANGMPFMLPFSPDTTRWRKTAILELRKLGIHL* |
Ga0134062_107684892 | 3300010337 | Grasslands Soil | VESTPGHYHVLRDVKLLRKQNGMPFMLPFSPDTIRWRRAAIVELRKLGINL* |
Ga0134123_130438701 | 3300010403 | Terrestrial Soil | KPLRKANGMPFMLPFSPDTIRWRRSAIVELRKLGIDV* |
Ga0137340_11166831 | 3300011405 | Soil | RDGKPLRKQNGMPFTLPFSPDTIRWRRAAIVELRKLGIDLQR* |
Ga0137424_10590531 | 3300011412 | Soil | RVMRDGKPLRKANGMPFMLPFSPDTIRWRRSAIVELRKLGIDL* |
Ga0120192_100079372 | 3300012021 | Terrestrial | YHVLRDGKPLRKQNGMPFMLPFSPDTIRWRKAALVELRKLGIHL* |
Ga0120192_100124621 | 3300012021 | Terrestrial | HYRVLRDGKPLRKQNGMPFLLPFSPDTIRWRRAAIVELRKLGIDL* |
Ga0137365_111420971 | 3300012201 | Vadose Zone Soil | VRTYSGPVTVEPTPGHYRVLRDGKVLRKANGMPFTLPFSPDTIRWRRAAIVDLRKLGIDL |
Ga0137374_103557952 | 3300012204 | Vadose Zone Soil | LTPFTLRKQNGMPFTLPFSPDTIRWRRAAILELRKLGIEL* |
Ga0137380_103479883 | 3300012206 | Vadose Zone Soil | ESRPGHYQVLRDGKPLRKANGMPFTLPFSPDTTRWRRAAIVDLRKLDIHL* |
Ga0150985_1129931912 | 3300012212 | Avena Fatua Rhizosphere | LRKQNGMPFTLPFSPGTTRWRRAAIVELRKLGIEV* |
Ga0150985_1227017482 | 3300012212 | Avena Fatua Rhizosphere | GHYRVLREGKPLGKANGMPFTLPYFPDTIRWRRAAILELRKLGIDL* |
Ga0137372_102475463 | 3300012350 | Vadose Zone Soil | VGLTVEATPGHYRVLREGKPLRKANGMPFTLPFSPDTIRWRRAAIVELRKLGIDP* |
Ga0137372_112232241 | 3300012350 | Vadose Zone Soil | HYHVLRDGKPLRKQNGMPFTLPFSPDTIRWRRAAILELRKLGIEL* |
Ga0137367_109594452 | 3300012353 | Vadose Zone Soil | YHVLRDGKPLRKQNGMPFTLPFSPDTIRWRRAAILELRRLGIEL* |
Ga0137366_102348881 | 3300012354 | Vadose Zone Soil | TPGHYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRAAVVELRKLGIDP* |
Ga0137366_104834471 | 3300012354 | Vadose Zone Soil | HVLRDGKPLRKQNGMPFTLPFSPDTIRWRRAAIVELRKLGIDL* |
Ga0137366_107056601 | 3300012354 | Vadose Zone Soil | HYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRAAIVELRKLGIDL* |
Ga0137366_108478462 | 3300012354 | Vadose Zone Soil | RKANGMPFMLPFSPDTIRWRRAAIVDLRKLDIHL* |
Ga0137369_101079701 | 3300012355 | Vadose Zone Soil | LTVEPTPGHYHVLRDGKPLRKQNGMPFTLPFSPDTIRWRRTAIVELRKLGIDL* |
Ga0137369_102022133 | 3300012355 | Vadose Zone Soil | LRRANGMPFMLPFSPDTIRWRRAAMIELRKLGIDV* |
Ga0137369_108703613 | 3300012355 | Vadose Zone Soil | VLRDGKPLRKANGMPFTLPFSPDTTRWRRTALLDLRKLGIDV* |
Ga0137369_111205281 | 3300012355 | Vadose Zone Soil | HYHVLRDGKPLRKANGMPFTLPFSPDTTRWRRTAIVDLRKLHIHLE* |
Ga0137368_104015551 | 3300012358 | Vadose Zone Soil | KPLRKANGMPFMLPFSPDTIRWRRAATVELRRLGINL* |
Ga0137385_100356822 | 3300012359 | Vadose Zone Soil | MPGHYRVLRDGKVLRKASGMPFTLPFSPDTIRWRRAAIVELRKLGIEP* |
Ga0137375_103106312 | 3300012360 | Vadose Zone Soil | LGLTVESTPGHYSLLRDGTPLRKANGMPFLLPFSPDTIRWRRAAILELRKLGIHL* |
Ga0137375_113839661 | 3300012360 | Vadose Zone Soil | HVLRDGKPLRKQNGMPFTLPFSPDTIRWRRTAIVELRKLGIDL* |
Ga0136630_12206052 | 3300012529 | Polar Desert Sand | GLTVESTPGHYRVLRDGMPLRKANGMPFMLPFSPDTIRWRRAAVVELGRLGIHL* |
Ga0137373_110425062 | 3300012532 | Vadose Zone Soil | TVEPTAGHYRVLRKGKPLRRANGMPFMLPFSPDTIRWRRAAMIELRKLGIDV* |
Ga0136614_108165042 | 3300012684 | Polar Desert Sand | GHYRVLRDGMPLRKANGMPFMLPFSPDTIRWRRAAVVELRRLGIHL* |
Ga0164306_115944451 | 3300012988 | Soil | RDGKPLRKQNGMPFTLPFSPDTIRWRRAAIVELRKLGIDL* |
Ga0164305_111349321 | 3300012989 | Soil | YHVLRDGKPLRKQNGMPVTLPFSPDTIRWRRAAIVELRKLGINL* |
Ga0157369_105083641 | 3300013105 | Corn Rhizosphere | LRKANGMPFMLPFSPDTIRWRRAAIVELRKLGIEV* |
Ga0120172_11419891 | 3300013765 | Permafrost | HYRVLRDGKPLRKPNGMPFTLPFSPDTIRWRRAAIVELRKLGINL* |
Ga0120123_11116411 | 3300013770 | Permafrost | PVRRDGEPLRNVNGMPFTLPFSPDNTRWRRAAIVDLRKLDIDV* |
Ga0120158_100293637 | 3300013772 | Permafrost | GTKPLRKANGMPFPLPFSPDTTRWRRSAIIDLRKLGIYL* |
Ga0075312_11414531 | 3300014254 | Natural And Restored Wetlands | RKENGMPFMLPFSPDTTRWRRSATVELRKLGIDV* |
Ga0075342_11996602 | 3300014320 | Natural And Restored Wetlands | VLRDGKPLRKANGMPFRLPFSPDTTRWRRSAVVELRKLGIDL* |
Ga0157380_131862671 | 3300014326 | Switchgrass Rhizosphere | TPGHYRVLRDGKPLRKANGMPFMLPSSPDTIRWRRAAIVELRKLGIEP* |
Ga0120193_100258071 | 3300014965 | Terrestrial | MRIRRVIAVDSPPGHYRVMRGEKPLRKANGMPFTLPFSPDTTRWRRSAIVELRKLGIHV* |
Ga0157379_109778151 | 3300014968 | Switchgrass Rhizosphere | HYHVYRDGKPLRKANGMPVTLPFSPGTTRWRRTAILDLRKIGIDV* |
Ga0132258_100506991 | 3300015371 | Arabidopsis Rhizosphere | PLRKANGMPFMLPFSPDTTRWRRAAIVELRKLGISI* |
Ga0132258_101225339 | 3300015371 | Arabidopsis Rhizosphere | ESTPGHYRVLRDGKPLRKANGMPFMLPFSPDMVRWRRAAIVELRKLGIDV* |
Ga0132258_102455224 | 3300015371 | Arabidopsis Rhizosphere | LHEGKPLRKANGMPFTLPFSPDTIRWRRAAIVELRKLGIDL* |
Ga0132258_102744616 | 3300015371 | Arabidopsis Rhizosphere | DGKPLRKANGMPFMLPFSPDTIRWRRAAIVELRKLAIDV* |
Ga0132258_116467371 | 3300015371 | Arabidopsis Rhizosphere | PGHYRVLRDGKPLRKANGMPFMLPFSPDTTRWRRAATVELRRLGIDL* |
Ga0134083_105115982 | 3300017659 | Grasslands Soil | VLRNGKPLRKANGMPFTLPFSPDTTRWRKAAILDLRKLGIHI |
Ga0187779_112067382 | 3300017959 | Tropical Peatland | REGKPLRKANGMPFMLPFSPDTTRWRRAATVELRKLGIRV |
Ga0187777_101834441 | 3300017974 | Tropical Peatland | KVLRDGKPLRKANGMPFTLPFSPDTTRWRRTAILDLRKLGIEV |
Ga0184608_103658411 | 3300018028 | Groundwater Sediment | RVLRDGKPLRKANGMPFMLPFSPDTIRWRRAAIVELRKLGIDL |
Ga0187787_103230161 | 3300018029 | Tropical Peatland | VLRDGKPLRRQNGMPFTLPFSPDATRWRKAALVELRKLGIDL |
Ga0187774_105417871 | 3300018089 | Tropical Peatland | TVEPTPGHYRVLREGKPLRKANGMPFMLPFSPDTTRWRRTAIVELRKLGIDV |
Ga0066667_113786401 | 3300018433 | Grasslands Soil | GLTVESTPGHYYVLRDGKPLRKQNGMPFTLPFSPDTIRWRRAAIVELRKLGIDL |
Ga0190268_115482281 | 3300018466 | Soil | HYRVLRDGKPLRKQNGMPFMLPFSPDTIRWRKAAILDLRKLGIDV |
Ga0190270_102352511 | 3300018469 | Soil | YHVLRDGKPLRKQNGMPFTLPFSPDTTRWRRAAIVELRKLGIEL |
Ga0190271_108909631 | 3300018481 | Soil | GLTVEPTPGHYRVLRDGKPLRKQNGMPFMLPFSPDTTRWRRAAIVDLRKLGIDV |
Ga0173482_105536832 | 3300019361 | Soil | RVLRNGKPLRKANGMPFTLPFSPDMIRWRRAAIVELRKLGINL |
Ga0187768_11002522 | 3300020150 | Tropical Peatland | PTPGHYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRAATVELRRLGINL |
Ga0210362_12446601 | 3300021329 | Estuarine | LTVEATPGHYHVYRDGKPLRKANGMPFTLPFSPDTTRWRKTAVNDLRKLGIDV |
Ga0207929_11097272 | 3300025505 | Arctic Peat Soil | AVEPTPGHYHVLRDGRPLRKANGMPFTLPFSPDTTRWRKTAILDLRKLGIDV |
Ga0210115_10547182 | 3300025791 | Natural And Restored Wetlands | SVESTPGHYKVLRDGKALRKANGMPFTLPFSPDTTRWRKTAILELRKLGIDL |
Ga0207685_107309242 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLTVEPTPGHYRVLREGKPLRKANGMPFTLPFSPDTTRWRRTAIVELRKLGIEL |
Ga0207693_107615141 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LRKHNGMPFTLPFSPDTTRWRKTALVELRRLGIEL |
Ga0207663_107342741 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QPLRKQNGMPFTLPFSPDTVRWRRTAIVELRKLGIDL |
Ga0207646_100587955 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GHYRVLREGKPLRKQNGMPFTLPFSPDTIRWRRAAIVELRKLGIDL |
Ga0207646_111649192 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TPGHYRVLRDGKPLRKQNGMPFMLPFSPDTIRWRRAAIVELRKVGIDL |
Ga0207646_116223052 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LREGKPLRKANGMPFTLPFSPDTIRWRRAAIVELRKLGIDV |
Ga0207709_110859402 | 3300025935 | Miscanthus Rhizosphere | PTPGHYRVLRDGKPLRKANGMPFMLPFSPDTTRWRRAAIVELRKLGIDI |
Ga0207665_113029281 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GGKPLRKANGMPFTLPFSPDTTRWRRTATVELRKLGIDL |
Ga0208637_10299792 | 3300027401 | Soil | YHVWRDGRPLRKANGMPFTLPFSPGTTRWRKTAILDLRKLGIDV |
Ga0214469_11431492 | 3300027636 | Soil | KPLRKANGMPFMLPFSPDTTRWRRSATVELRKLGIEL |
Ga0209023_101040802 | 3300027870 | Freshwater And Sediment | VLRDGKPLRKANGMPFMLPFSPDTIRWRRSAIIELRKLGINV |
Ga0209814_102795001 | 3300027873 | Populus Rhizosphere | LRDGKPLRKANGMPFMLPFSPDTIRWRRAAIVELRKLGIDL |
Ga0209857_10505212 | 3300027957 | Groundwater Sand | VNGRGKVRPTVEPTAGHYRVLRGDKPLRKANGMPFMLPFSPDTTRWRRSAIVELHKLGID |
Ga0265334_103430411 | 3300028573 | Rhizosphere | GKPLRKANGMPFTLPFSPDTTRWRRTALLDLRKLGIEL |
Ga0247818_110612401 | 3300028589 | Soil | DGKPLRKANGMPVTLPFSPGTTRWRRTAILDLRKLGIDV |
Ga0302169_102024512 | 3300028679 | Fen | GHYKVLRDGKPLRKLNGMPFMLPFSPDTTRWRRSAIVELRKLGIDI |
Ga0307307_100812742 | 3300028718 | Soil | LQVESTPGHYHVWRNGKPLRKENGMPVTLPFSPGTTRWRKTAILELRKLGIDV |
Ga0307301_100772871 | 3300028719 | Soil | VEATPGHYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRAAIVELRKLGIDL |
Ga0307320_102584202 | 3300028771 | Soil | YRVLRDGKPLRKASGMPFMLPFSPDTTRWRRSAIVELRKLGIDL |
Ga0307282_106474732 | 3300028784 | Soil | RVLHGGEPLRKANGMPFTLPFSPDATRRRRSAIVELRKLGIGP |
Ga0307300_102263091 | 3300028880 | Soil | AGLQVESTPGHYHVWRNGKPLRKENGMPVTLPFSPGTTRWRKTAILELRKLGIDV |
Ga0307277_100927251 | 3300028881 | Soil | KPLRKANGMPFTLPFSPDTIRWRRTAIVELRKLGIDL |
Ga0299907_106790561 | 3300030006 | Soil | VESTPGHYKVLRDGKALRKANGMPFTLPFSPDTTRWRKTAILELRKLGIDL |
Ga0311364_108559781 | 3300031521 | Fen | KPLRKENGMPFTLPFSPDTTRWRKTAINDLRRLGIDV |
Ga0310813_112518951 | 3300031716 | Soil | ESTPGHYRVLRDGKPLRKPNGMPFTLPFSPDTIRWRRTAVVELRKLGIDL |
Ga0310813_121110132 | 3300031716 | Soil | DGKPLRKANGMPFTLPFSPDTIRWRRTAIVELRKLGIDL |
Ga0311351_104832091 | 3300031722 | Fen | HYHVYRDGRPLRKENGMPFTLPFSPDTTRWRKTAVNDLRRLGIEI |
Ga0318546_108530262 | 3300031771 | Soil | PTPGHYRVLRDGEPLRKANGMPFMLPFSPDTSRWRRAAIVELHKLGIDP |
Ga0308175_1016724452 | 3300031938 | Soil | RNGKPLRKANGMPMTLPFSPGTTRWRRTAILDLRKLGIDV |
Ga0308175_1020812062 | 3300031938 | Soil | GLTVESTPGHYRVLREGKPLRKANGMPFTLPFSPDTIRWRRTAIVELRKLGIDL |
Ga0315292_108989302 | 3300032143 | Sediment | HVFRDGKPLRKANGMPFTLPFSPDTTRWRKTAILDLRKLGIDV |
Ga0315292_113058272 | 3300032143 | Sediment | TPGHYHVFRDGKPLRKENGMPFTLPFSPDTTRWRKTAILDLRKLGIDV |
Ga0315292_116027362 | 3300032143 | Sediment | VFRDGKPLRKENGMPFTLPFSPDTIRWRKTAILDLRKIGIDV |
Ga0315283_107079951 | 3300032164 | Sediment | HVYRDGKPLRKENGMPFTLPFSPDTTRWRKTAINDLRKLGIEV |
Ga0307472_1013742331 | 3300032205 | Hardwood Forest Soil | EPTPGHYRVLRDGKPLRKANGMPFMLPFSPDTTRWRRAATVELRKLGIDI |
Ga0310896_106241632 | 3300032211 | Soil | LRDGRPLRKENGMPFMLPFSPDTTRWRRSATVELRKLGIDV |
Ga0315287_104198971 | 3300032397 | Sediment | PLRKENGMPFTLPFSPDTTRWRKTAINDLRKLGIDV |
Ga0335085_120890542 | 3300032770 | Soil | ESTPGHYHVLRDGKPLRKANGMPFTLPFSPDTTRWRRTALVELRKLGIDL |
Ga0335070_116498962 | 3300032829 | Soil | KPLRKANGMPFTLPFSPDTTRWRRTALVELRKLGIDL |
Ga0335071_103924532 | 3300032897 | Soil | PLRKANGMPFMLPFSPDTVRWRRSALVELRKLGIRV |
Ga0335071_107764212 | 3300032897 | Soil | AAGLTVEPTPGHYRVLRDGKPLRKASGMPFMLPFSPDTVRWRRSALVELRKLGIRV |
Ga0335076_105146081 | 3300032955 | Soil | TVEPTPGHYRVLRDGKPLRKANGMPFMLPFSPDTTRWRRAATIELRRLGIDL |
Ga0335077_111345401 | 3300033158 | Soil | KPLRKANGMPFMLPFSPDTTRWRRAATIELRRLGIDL |
Ga0316622_1015346241 | 3300033416 | Soil | EATPGHYRVLRDGKPLRKANGMPFMLPFSPDTTRWRRSAIVELRRLGIDVSDNRNS |
Ga0247829_110537701 | 3300033550 | Soil | TVESTPGHYRVLRDGKPLRKANGMPFMLPFSPDTIRWRRSAIIELRKLDIDV |
Ga0314867_042553_895_1065 | 3300033808 | Peatland | AAGLAVEPTPGHYRVLRDGKPLRKANGMPFMLPFSPDTVRWRRAALVELRKLGIRV |
⦗Top⦘ |