Basic Information | |
---|---|
Family ID | F034820 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 173 |
Average Sequence Length | 45 residues |
Representative Sequence | QVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWV |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 173 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 95.38 % |
% of genes from short scaffolds (< 2000 bps) | 86.71 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (56.647 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (31.792 % of family members) |
Environment Ontology (ENVO) | Unclassified (70.520 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (81.503 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.49% β-sheet: 5.80% Coil/Unstructured: 79.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 173 Family Scaffolds |
---|---|---|
PF00004 | AAA | 11.56 |
PF03796 | DnaB_C | 0.58 |
PF04304 | DUF454 | 0.58 |
PF13155 | Toprim_2 | 0.58 |
PF00132 | Hexapep | 0.58 |
PF01370 | Epimerase | 0.58 |
COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
---|---|---|---|
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.58 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.58 |
COG2832 | Uncharacterized membrane protein YbaN, DUF454 family | Function unknown [S] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 56.65 % |
All Organisms | root | All Organisms | 43.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000929|NpDRAFT_10068283 | Not Available | 763 | Open in IMG/M |
3300003277|JGI25908J49247_10065825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 915 | Open in IMG/M |
3300003277|JGI25908J49247_10133039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 585 | Open in IMG/M |
3300003404|JGI25920J50251_10046106 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
3300003411|JGI25911J50253_10101628 | Not Available | 877 | Open in IMG/M |
3300003411|JGI25911J50253_10101792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
3300003491|JGI25924J51412_1038673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300003497|JGI25925J51416_10067840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
3300004112|Ga0065166_10113934 | Not Available | 998 | Open in IMG/M |
3300004123|Ga0066181_10018281 | All Organisms → Viruses → Predicted Viral | 1652 | Open in IMG/M |
3300004123|Ga0066181_10207103 | Not Available | 558 | Open in IMG/M |
3300004124|Ga0066178_10246465 | Not Available | 519 | Open in IMG/M |
3300004240|Ga0007787_10315905 | Not Available | 774 | Open in IMG/M |
3300005517|Ga0070374_10482744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300005517|Ga0070374_10678016 | Not Available | 510 | Open in IMG/M |
3300005527|Ga0068876_10190774 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
3300005581|Ga0049081_10037616 | Not Available | 1839 | Open in IMG/M |
3300005583|Ga0049085_10235639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 602 | Open in IMG/M |
3300005584|Ga0049082_10268505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300005584|Ga0049082_10306145 | Not Available | 530 | Open in IMG/M |
3300005662|Ga0078894_10094584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2628 | Open in IMG/M |
3300005662|Ga0078894_10130930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2240 | Open in IMG/M |
3300005662|Ga0078894_10784674 | Not Available | 835 | Open in IMG/M |
3300005662|Ga0078894_10785216 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 834 | Open in IMG/M |
3300007549|Ga0102879_1276331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300007555|Ga0102817_1055474 | Not Available | 865 | Open in IMG/M |
3300007559|Ga0102828_1048258 | Not Available | 985 | Open in IMG/M |
3300007597|Ga0102919_1181136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300007603|Ga0102921_1156040 | Not Available | 826 | Open in IMG/M |
3300007708|Ga0102859_1007105 | All Organisms → Viruses → Predicted Viral | 2704 | Open in IMG/M |
3300008055|Ga0108970_11223060 | Not Available | 800 | Open in IMG/M |
3300008111|Ga0114344_1024198 | All Organisms → Viruses → Predicted Viral | 2446 | Open in IMG/M |
3300008116|Ga0114350_1143286 | Not Available | 680 | Open in IMG/M |
3300008259|Ga0114841_1000263 | Not Available | 32701 | Open in IMG/M |
3300008261|Ga0114336_1058875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2580 | Open in IMG/M |
3300008262|Ga0114337_1102127 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
3300008262|Ga0114337_1174356 | Not Available | 905 | Open in IMG/M |
3300008263|Ga0114349_1244227 | Not Available | 591 | Open in IMG/M |
3300008266|Ga0114363_1248590 | Not Available | 501 | Open in IMG/M |
3300008448|Ga0114876_1001400 | Not Available | 17913 | Open in IMG/M |
3300008950|Ga0102891_1238929 | Not Available | 521 | Open in IMG/M |
3300009026|Ga0102829_1292359 | Not Available | 541 | Open in IMG/M |
3300009152|Ga0114980_10575208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300009155|Ga0114968_10144158 | Not Available | 1418 | Open in IMG/M |
3300009155|Ga0114968_10594950 | Not Available | 586 | Open in IMG/M |
3300009155|Ga0114968_10610054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 577 | Open in IMG/M |
3300009158|Ga0114977_10441924 | Not Available | 719 | Open in IMG/M |
3300009161|Ga0114966_10303038 | Not Available | 966 | Open in IMG/M |
3300009161|Ga0114966_10584995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300009164|Ga0114975_10581934 | Not Available | 598 | Open in IMG/M |
3300009180|Ga0114979_10240840 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
3300009181|Ga0114969_10499524 | Not Available | 681 | Open in IMG/M |
3300009181|Ga0114969_10571033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300009183|Ga0114974_10662499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300009184|Ga0114976_10390319 | Not Available | 730 | Open in IMG/M |
3300009187|Ga0114972_10641256 | Not Available | 590 | Open in IMG/M |
3300009187|Ga0114972_10838394 | Not Available | 502 | Open in IMG/M |
3300009419|Ga0114982_1053779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
3300009419|Ga0114982_1166081 | Not Available | 682 | Open in IMG/M |
3300010158|Ga0114960_10211476 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
3300010160|Ga0114967_10261580 | Not Available | 902 | Open in IMG/M |
3300010160|Ga0114967_10281223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300010885|Ga0133913_10428817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3492 | Open in IMG/M |
3300010970|Ga0137575_10069540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300012663|Ga0157203_1005790 | All Organisms → Viruses → Predicted Viral | 2324 | Open in IMG/M |
3300012779|Ga0138284_1388345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
3300013006|Ga0164294_10270438 | Not Available | 1185 | Open in IMG/M |
3300013006|Ga0164294_11158838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300013295|Ga0170791_11827804 | All Organisms → Viruses → Predicted Viral | 1299 | Open in IMG/M |
3300013372|Ga0177922_10112760 | Not Available | 761 | Open in IMG/M |
3300017766|Ga0181343_1036819 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
3300017774|Ga0181358_1272570 | Not Available | 525 | Open in IMG/M |
3300020141|Ga0211732_1080370 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
3300020141|Ga0211732_1105092 | All Organisms → Viruses → Predicted Viral | 2147 | Open in IMG/M |
3300020141|Ga0211732_1425359 | Not Available | 1354 | Open in IMG/M |
3300020151|Ga0211736_10657746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
3300020159|Ga0211734_10118555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2520 | Open in IMG/M |
3300020159|Ga0211734_10845781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2401 | Open in IMG/M |
3300020159|Ga0211734_10972973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1437 | Open in IMG/M |
3300020159|Ga0211734_11005912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2607 | Open in IMG/M |
3300020161|Ga0211726_10104444 | Not Available | 735 | Open in IMG/M |
3300020162|Ga0211735_10084700 | Not Available | 652 | Open in IMG/M |
3300020162|Ga0211735_10223951 | All Organisms → Viruses → Predicted Viral | 1788 | Open in IMG/M |
3300020162|Ga0211735_10268784 | Not Available | 668 | Open in IMG/M |
3300020172|Ga0211729_10600519 | Not Available | 777 | Open in IMG/M |
3300020172|Ga0211729_11434200 | Not Available | 551 | Open in IMG/M |
3300020205|Ga0211731_10957609 | Not Available | 841 | Open in IMG/M |
3300020519|Ga0208223_1019972 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 938 | Open in IMG/M |
3300021956|Ga0213922_1014481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2106 | Open in IMG/M |
3300021961|Ga0222714_10521522 | Not Available | 606 | Open in IMG/M |
3300023174|Ga0214921_10401287 | Not Available | 700 | Open in IMG/M |
3300024289|Ga0255147_1042851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 894 | Open in IMG/M |
3300024346|Ga0244775_10939760 | Not Available | 685 | Open in IMG/M |
3300024505|Ga0255150_1026474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 972 | Open in IMG/M |
3300024561|Ga0255288_1052561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300025757|Ga0256313_1016932 | All Organisms → Viruses → Predicted Viral | 1050 | Open in IMG/M |
3300025848|Ga0208005_1132092 | Not Available | 779 | Open in IMG/M |
3300025896|Ga0208916_10211194 | Not Available | 841 | Open in IMG/M |
3300026457|Ga0255160_1060400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 632 | Open in IMG/M |
3300026473|Ga0255166_1056498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 761 | Open in IMG/M |
3300027132|Ga0255110_1014021 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
3300027146|Ga0255104_1036493 | Not Available | 857 | Open in IMG/M |
3300027146|Ga0255104_1036831 | Not Available | 852 | Open in IMG/M |
3300027148|Ga0255115_1071473 | Not Available | 610 | Open in IMG/M |
3300027291|Ga0255139_1072342 | Not Available | 587 | Open in IMG/M |
3300027293|Ga0255132_1013709 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2138 | Open in IMG/M |
3300027335|Ga0255130_1009836 | Not Available | 2197 | Open in IMG/M |
3300027335|Ga0255130_1047296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300027336|Ga0255128_1065666 | Not Available | 734 | Open in IMG/M |
3300027563|Ga0209552_1056267 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
3300027563|Ga0209552_1179823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300027586|Ga0208966_1191534 | Not Available | 525 | Open in IMG/M |
3300027593|Ga0255118_1043231 | Not Available | 774 | Open in IMG/M |
3300027593|Ga0255118_1082870 | Not Available | 521 | Open in IMG/M |
3300027642|Ga0209135_1121702 | Not Available | 861 | Open in IMG/M |
3300027644|Ga0209356_1089836 | Not Available | 906 | Open in IMG/M |
3300027644|Ga0209356_1121457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 748 | Open in IMG/M |
3300027644|Ga0209356_1141884 | Not Available | 675 | Open in IMG/M |
3300027644|Ga0209356_1202105 | Not Available | 535 | Open in IMG/M |
3300027644|Ga0209356_1212035 | Not Available | 519 | Open in IMG/M |
3300027656|Ga0209357_1004425 | Not Available | 5499 | Open in IMG/M |
3300027656|Ga0209357_1118562 | Not Available | 730 | Open in IMG/M |
3300027659|Ga0208975_1067679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1071 | Open in IMG/M |
3300027688|Ga0209553_1182213 | Not Available | 694 | Open in IMG/M |
3300027688|Ga0209553_1213757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300027707|Ga0209443_1031716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2260 | Open in IMG/M |
3300027708|Ga0209188_1064977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1564 | Open in IMG/M |
3300027710|Ga0209599_10041554 | Not Available | 1228 | Open in IMG/M |
3300027710|Ga0209599_10121977 | Not Available | 689 | Open in IMG/M |
3300027732|Ga0209442_1232719 | Not Available | 666 | Open in IMG/M |
3300027732|Ga0209442_1316354 | Not Available | 533 | Open in IMG/M |
3300027744|Ga0209355_1057269 | Not Available | 1870 | Open in IMG/M |
3300027744|Ga0209355_1190091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
3300027744|Ga0209355_1334035 | Not Available | 562 | Open in IMG/M |
3300027754|Ga0209596_1350592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300027756|Ga0209444_10229582 | Not Available | 656 | Open in IMG/M |
3300027756|Ga0209444_10279166 | Not Available | 569 | Open in IMG/M |
3300027763|Ga0209088_10274413 | Not Available | 692 | Open in IMG/M |
3300027769|Ga0209770_10109291 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
3300027772|Ga0209768_10001062 | Not Available | 17847 | Open in IMG/M |
3300027772|Ga0209768_10087795 | Not Available | 1552 | Open in IMG/M |
3300027785|Ga0209246_10040036 | All Organisms → Viruses → Predicted Viral | 1794 | Open in IMG/M |
3300027785|Ga0209246_10307042 | Not Available | 608 | Open in IMG/M |
3300027798|Ga0209353_10093545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1359 | Open in IMG/M |
3300027798|Ga0209353_10220139 | Not Available | 825 | Open in IMG/M |
3300027798|Ga0209353_10259626 | Not Available | 745 | Open in IMG/M |
3300027798|Ga0209353_10269607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300027798|Ga0209353_10424722 | Not Available | 541 | Open in IMG/M |
3300027808|Ga0209354_10028378 | Not Available | 2233 | Open in IMG/M |
3300027816|Ga0209990_10217669 | Not Available | 880 | Open in IMG/M |
3300027816|Ga0209990_10326154 | Not Available | 682 | Open in IMG/M |
3300027836|Ga0209230_10296756 | Not Available | 931 | Open in IMG/M |
3300027892|Ga0209550_10378918 | Not Available | 882 | Open in IMG/M |
3300027963|Ga0209400_1299595 | Not Available | 616 | Open in IMG/M |
3300027969|Ga0209191_1031548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2539 | Open in IMG/M |
3300027969|Ga0209191_1100016 | Not Available | 1238 | Open in IMG/M |
3300027969|Ga0209191_1332246 | Not Available | 554 | Open in IMG/M |
3300028103|Ga0255172_1018760 | Not Available | 1332 | Open in IMG/M |
3300028393|Ga0304728_1113315 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
3300031758|Ga0315907_10094642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2564 | Open in IMG/M |
3300031758|Ga0315907_10360513 | Not Available | 1180 | Open in IMG/M |
3300031786|Ga0315908_11292331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300031857|Ga0315909_10420289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
3300031951|Ga0315904_10539096 | Not Available | 1019 | Open in IMG/M |
3300032050|Ga0315906_10381448 | All Organisms → Viruses → Predicted Viral | 1235 | Open in IMG/M |
3300033992|Ga0334992_0207559 | Not Available | 969 | Open in IMG/M |
3300034082|Ga0335020_0248246 | Not Available | 881 | Open in IMG/M |
3300034082|Ga0335020_0296198 | Not Available | 793 | Open in IMG/M |
3300034093|Ga0335012_0112794 | All Organisms → Viruses → Predicted Viral | 1510 | Open in IMG/M |
3300034104|Ga0335031_0382579 | Not Available | 890 | Open in IMG/M |
3300034108|Ga0335050_0078445 | Not Available | 1970 | Open in IMG/M |
3300034117|Ga0335033_0404509 | Not Available | 672 | Open in IMG/M |
3300034356|Ga0335048_0049849 | Not Available | 2712 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 31.79% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.18% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 10.40% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.83% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.36% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.62% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.62% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.47% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.47% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.31% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.16% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.58% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.58% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.58% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.58% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.58% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.58% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.58% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.58% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.58% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025757 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027148 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h | Environmental | Open in IMG/M |
3300027291 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8d | Environmental | Open in IMG/M |
3300027293 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d | Environmental | Open in IMG/M |
3300027335 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300027336 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8d | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
NpDRAFT_100682832 | 3300000929 | Freshwater And Marine | VESMGFMLVRADDEPEDFVKRVMKKPVMMVDSWL* |
JGI25908J49247_100658251 | 3300003277 | Freshwater Lake | VCEVDLVESMGFVLVRCDDEPEDFVKRVLKKPVTVVESWV* |
JGI25908J49247_101330391 | 3300003277 | Freshwater Lake | MNVAFEAGGIDLQVCEVDLVESMGFVLVRCDDEPEDFVKRVLKKPVTVVESWV* |
JGI25920J50251_100461061 | 3300003404 | Freshwater Lake | MNIAFEAAALDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI* |
JGI25911J50253_101016281 | 3300003411 | Freshwater Lake | DLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI* |
JGI25911J50253_101017923 | 3300003411 | Freshwater Lake | AALDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI* |
JGI25924J51412_10386733 | 3300003491 | Freshwater Lake | AFEAAALDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI* |
JGI25925J51416_100678403 | 3300003497 | Freshwater Lake | CEVDLVESYGXMLVRCDDEPEDFVKRVMKKPVMMVDSWI* |
Ga0065166_101139343 | 3300004112 | Freshwater Lake | AGLDLQICSADLVESMGYMLVRADDEPEDFVKRVLKKPVLMVESWID* |
Ga0066181_100182811 | 3300004123 | Freshwater Lake | CEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWC* |
Ga0066181_102071031 | 3300004123 | Freshwater Lake | ALDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWI* |
Ga0066178_102464652 | 3300004124 | Freshwater Lake | EAAALDLQVCEVDLVESMGFMLVRCDDEPEDFVKRVLKKPVVMVESWLD* |
Ga0007787_103159053 | 3300004240 | Freshwater Lake | LEIAEVDLVESYGYMLVRTDDTPESFVKRVMKKPVVMVESWVD* |
Ga0070374_104827441 | 3300005517 | Freshwater Lake | LDLEVKEADLVESMGYVLTLTDDEPEDFVKRVLKKPVLHVESWV* |
Ga0070374_106780161 | 3300005517 | Freshwater Lake | EVDLVESMGYVLVRADDEPEDFVKRVLKKPVMMVDSWI* |
Ga0068876_101907745 | 3300005527 | Freshwater Lake | KSVDLVESLGHMLVRTDDDPESFAKRATKKPVLMVESWV* |
Ga0049081_100376161 | 3300005581 | Freshwater Lentic | FEAAALDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI* |
Ga0049085_102356391 | 3300005583 | Freshwater Lentic | CEVDLVESMGFVLVRCDDEPEDFVKRVLKKPVTVVESWV* |
Ga0049082_102685052 | 3300005584 | Freshwater Lentic | CEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWV* |
Ga0049082_103061451 | 3300005584 | Freshwater Lentic | DLQVCEVDLVESMGFMLVRCDDEPEDFVKRVMKKPVMMVDSWV* |
Ga0078894_1009458411 | 3300005662 | Freshwater Lake | LVESMGYMLVRTDDTPESFAKRVMKKPVVMVESWVD* |
Ga0078894_101309301 | 3300005662 | Freshwater Lake | QICEVDLVESMGFVMVRADDEPEDFVKRVLKKPVMMVDSWV* |
Ga0078894_107846743 | 3300005662 | Freshwater Lake | DLVESMGYVLVRTDDEPEDFVKRVLKKPVMMVDSWI* |
Ga0078894_107852163 | 3300005662 | Freshwater Lake | QICEVDLVESMGFVMVRADDEPEDFVKRVLKKPVMMVDSWC* |
Ga0102879_12763312 | 3300007549 | Estuarine | LVDASGFMMVRCDDEPEDFVKRALKKPVVIVDSWV* |
Ga0102817_10554743 | 3300007555 | Estuarine | EAAGVDLQICEVDLVESMGFVLVRADDEPEDWAKRIMKKPVMMVDSWI* |
Ga0102828_10482581 | 3300007559 | Estuarine | KMNIAFEAAALDLQVCEVDLVESMGFVLVRADDETEDFVKRVLKKPVMMVDSWI* |
Ga0102919_11811361 | 3300007597 | Estuarine | LQVCEVDLVEAYGYMLVRCDDEPEDFVKRVLKKPVLAVDSWV* |
Ga0102921_11560403 | 3300007603 | Estuarine | EVDLVESMGFVLVRADDEPEDWAKRIMKKPVMMVDSWI* |
Ga0102859_10071055 | 3300007708 | Estuarine | YALTKMNIAFEAAAVDLQICEVDLVETMGFVLVRADDEPEDFVKRVLKKPVMMVDSWV* |
Ga0108970_112230601 | 3300008055 | Estuary | DAADLPLEIAGVDLVESMGYMLVRTDDTPESFAKRVMKKPVLMVESWVD* |
Ga0114344_10241987 | 3300008111 | Freshwater, Plankton | LALEAAGIDVQVCEVDLVESMGFIMVRCDDEPEDFVKRALKKPVMMVDSWV* |
Ga0114350_11432861 | 3300008116 | Freshwater, Plankton | GLDLQVCEVDLVESMGFMLVRADDEPEDFVKRVLKKPVMMVDSWI* |
Ga0114841_100026352 | 3300008259 | Freshwater, Plankton | TKMNIAFEAAALDLQVCEVDLVESMGFMLVRCDDEPEDFVKRVLKKPVVMVESWLD* |
Ga0114336_10588751 | 3300008261 | Freshwater, Plankton | LTKMNIAFEAAAIDLQICEVDLVESMGFILVRADDQPEDFVKRVLKKPVLMVDSWI* |
Ga0114337_11021271 | 3300008262 | Freshwater, Plankton | AGVELQICEVDLVDASGFMMVRCDDEPEDFVKRVLKKPVVMVDSWV* |
Ga0114337_11743561 | 3300008262 | Freshwater, Plankton | AAGLDLQVCEVDLVESMGFMMVRCDDEPEDFVKRVLKKPVMMVDSWC* |
Ga0114349_12442272 | 3300008263 | Freshwater, Plankton | SKMNIAFEKAGVELQICEVDLVDAQGFMMVRCDDEPEDFVKRALKKPVQQVDSWV* |
Ga0114363_12485901 | 3300008266 | Freshwater, Plankton | DLVESLGNMLVRSDDDPESFAKRATKKPVLMVESWV* |
Ga0114876_10014001 | 3300008448 | Freshwater Lake | VKSVDLVESLGHMLVRTDDDPESFAKRATKKPVLMVESWV* |
Ga0102891_12389292 | 3300008950 | Estuarine | KMNIAFEAAAVDLQICEVDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWV* |
Ga0102829_12923593 | 3300009026 | Estuarine | DLVESMGFVLVRTDDEPEDFVKRVLKKPVMMVESWVD* |
Ga0114980_105752081 | 3300009152 | Freshwater Lake | LAFEAAGVDLQVCETDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWV* |
Ga0114968_101441586 | 3300009155 | Freshwater Lake | DLVESMGFMLVRCDDEPEDFVKRVLKKPVVMVDSWV* |
Ga0114968_105949502 | 3300009155 | Freshwater Lake | DLVESMGFMLVRADDEPEDFVKRVLKKPVMMVDSWI* |
Ga0114968_106100543 | 3300009155 | Freshwater Lake | LVESMGYMLVRADDEPEDFVKRVMKKPVMMVDSWV* |
Ga0114977_104419241 | 3300009158 | Freshwater Lake | ALTKMNIAFEAAGLDLQICTVDLVESMGFVMVRADDEPEDFVKRVLKKPVLMVESWID* |
Ga0114966_103030383 | 3300009161 | Freshwater Lake | KMNIAFEAAAVDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI* |
Ga0114966_105849952 | 3300009161 | Freshwater Lake | AGVDLQVCETDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWV* |
Ga0114975_105819341 | 3300009164 | Freshwater Lake | AAIDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWV* |
Ga0114979_102408401 | 3300009180 | Freshwater Lake | AAGVDLQVCETDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWV* |
Ga0114969_104995241 | 3300009181 | Freshwater Lake | KMNIAFEAAGVDLQVCEVDLVESMGFVLVRADDEPEDFVKRVMKKPVLMVDSWV* |
Ga0114969_105710331 | 3300009181 | Freshwater Lake | VDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI* |
Ga0114974_106624992 | 3300009183 | Freshwater Lake | AFEKAGVDLQICEVDLVESMGFMLVRADDEPEDFVKRVLKKPVPMVEPWL* |
Ga0114976_103903193 | 3300009184 | Freshwater Lake | DLQICEVDLVESMGFMLVRADDEPEDFVKRVLKKPVPMVEPWL* |
Ga0114972_106412563 | 3300009187 | Freshwater Lake | FEKAGVDLQICEVDLVESMGFMLVRADDEPEDFVKRVLKKPVMMVDSWV* |
Ga0114972_108383941 | 3300009187 | Freshwater Lake | QICEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI* |
Ga0114982_10537791 | 3300009419 | Deep Subsurface | QVCQADLVESMGFMLVRCDDEPEDFVKRVLKKPIPMVESWV* |
Ga0114982_11660811 | 3300009419 | Deep Subsurface | IQVCEVDLVESMGFVMVRCDDEPEDFVKRVLKKPVLMVDSWV* |
Ga0114960_102114763 | 3300010158 | Freshwater Lake | LVESMGFMLVRADDEPEDFVKRVLKKPVLMVDSWV* |
Ga0114967_102615801 | 3300010160 | Freshwater Lake | CEVDLVESMGFVLVRADDEPESFVKRVMKKPVLMVDSWI* |
Ga0114967_102812233 | 3300010160 | Freshwater Lake | NIAFEAAARDLQICEVDLVESMGFVMVRAEDEPEDFVKRVLKKPVMMVDSWI* |
Ga0133913_104288176 | 3300010885 | Freshwater Lake | LDLQICEVDLVESMGFVMVRADDEPEDFVKRVLKKPVMMVDSWI* |
Ga0137575_100695403 | 3300010970 | Pond Fresh Water | AGVDIQVCETDLVESMGFIMVRCDDEPEDFVKRALKKPVLMVDSWV* |
Ga0157203_10057901 | 3300012663 | Freshwater | GVDLQICEVDLVESMGFMLVRADDEPEDFVKRVLKKPVLMVDSWV* |
Ga0138284_13883451 | 3300012779 | Freshwater Lake | MNIAFEAAAVDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWV* |
Ga0164294_102704381 | 3300013006 | Freshwater | ADLVESMGYVLTLADDEPEDFVKRVLKKPVLHVESWV* |
Ga0164294_111588381 | 3300013006 | Freshwater | QVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWV* |
Ga0170791_118278043 | 3300013295 | Freshwater | AGVDLQVCETDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWV* |
Ga0177922_101127602 | 3300013372 | Freshwater | EAAALDLQVCEVDLVESMGFVLVRCDDEPEDFVKRVMKKPVMMVDSWV* |
Ga0181343_10368195 | 3300017766 | Freshwater Lake | NIAFEAAGLDLQICEVDLVESMGFIMVRADDEPEDFVKRVLKKPVMMVESWID |
Ga0181358_12725702 | 3300017774 | Freshwater Lake | VESMGYMLVRTDDTPESFAKRVMKKPVLMVESWVD |
Ga0211732_10803701 | 3300020141 | Freshwater | FEAAGLDLQICEVDLVESMGFVMVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0211732_11050921 | 3300020141 | Freshwater | IAFEAAGIDLQVCEIDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWV |
Ga0211732_14253593 | 3300020141 | Freshwater | EAAGIDLQVCEIDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWV |
Ga0211736_106577461 | 3300020151 | Freshwater | ALTKMNVAFEAAGVDLQVCEVDLVESMGFVLVRCDDEPEDFVKRVLKKPIPMVESWV |
Ga0211734_101185555 | 3300020159 | Freshwater | LTKMNIAFEAAGIDLQVCEIDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWV |
Ga0211734_108457811 | 3300020159 | Freshwater | AGLDLEVKEADLVESMGYVLTLADDEPEDFVKRALKKPVLHVESWV |
Ga0211734_109729734 | 3300020159 | Freshwater | QVCEVDLVESMGFVLVRCDDEPEDFVKRVLKKPIPMVESWV |
Ga0211734_110059129 | 3300020159 | Freshwater | LDLQICQADLVESMGYVMVRADDEPEDFVKRVLKKPVLMVESWID |
Ga0211726_101044441 | 3300020161 | Freshwater | VKEADLVESMGYVLTLADDEPEDFVKRALKKPVLHVESWV |
Ga0211735_100847003 | 3300020162 | Freshwater | VDLVESMGFVMVRADDEPEDFVKRVLKKPVLMVESWVD |
Ga0211735_102239511 | 3300020162 | Freshwater | IAFEAAGLDLQVCETDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVESWID |
Ga0211735_102687841 | 3300020162 | Freshwater | CEIDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWV |
Ga0211729_106005191 | 3300020172 | Freshwater | LEVQSTDLGESMGYMLVRVDDTPEDFVKRVLKKPVLMVEPWL |
Ga0211729_114342001 | 3300020172 | Freshwater | LDLQICEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVESWID |
Ga0211731_109576094 | 3300020205 | Freshwater | DLVESMGFMMVRADDEPEDFVKRVMKKPVMMVDSWV |
Ga0208223_10199723 | 3300020519 | Freshwater | LQICTVDLVESMGFVMVRADDEPEDFVKRVLKKPVMMVDSWV |
Ga0213922_10144811 | 3300021956 | Freshwater | EVAEVDLVESMGYMLVRTDDTPESFVKRVMKKPVVMVESWVD |
Ga0222714_105215221 | 3300021961 | Estuarine Water | LDAADLPLEVAEVDLVESMGYMLVRTDDTPESFVKRVMKKPVVMVESWVD |
Ga0214921_104012871 | 3300023174 | Freshwater | VDLVESMGYMLVRTDDTPESFVKRVMKKPVVMVESWVD |
Ga0255147_10428513 | 3300024289 | Freshwater | YALTKMNIALEAAGIDVQICETDLVEAMGFVMVRCDDEPEDFVKRALKKPVLQVESWV |
Ga0244775_109397603 | 3300024346 | Estuarine | QICEVDLVESMGFILVRADDEPEDFVKRVMKKPVMMVDSWL |
Ga0255150_10264743 | 3300024505 | Freshwater | KMNIALEAAGIDVQICETDLVEAMGFVMVRCDDEPEDFVKRALKKPVLQVESWV |
Ga0255288_10525615 | 3300024561 | Freshwater | DLVESMGFMLVRVDDEPEDFVKRALKKPVMMVDSWV |
Ga0256313_10169321 | 3300025757 | Freshwater | LQVCEIDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWI |
Ga0208005_11320923 | 3300025848 | Aqueous | VDLVESMGFIMVRCDDEPEDFVKRALKKPVMMVDSWV |
Ga0208916_102111941 | 3300025896 | Aqueous | LTKMNIAFEAAAVDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWV |
Ga0255160_10604003 | 3300026457 | Freshwater | TDLVEAMGFVMVRCDDEPEDFVKRALKKPVLQVESWV |
Ga0255166_10564981 | 3300026473 | Freshwater | AGIDVQICETDLVEAMGFVMVRCDDEPEDFVKRALKKPVLQVESWV |
Ga0255110_10140213 | 3300027132 | Freshwater | QVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWC |
Ga0255104_10364931 | 3300027146 | Freshwater | IAGVDLVESMGYMLVRTDDTPESFAKRVMKKPVLMVESWVD |
Ga0255104_10368311 | 3300027146 | Freshwater | GIDLQVCEIDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWI |
Ga0255115_10714733 | 3300027148 | Freshwater | VDLQICEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWC |
Ga0255139_10723421 | 3300027291 | Freshwater | IAGVDLVESMGYMLVRTDDTPESFAKRVMKKPVVMVESWVD |
Ga0255132_10137091 | 3300027293 | Freshwater | FEAAAVDLQICEVDLVESMGFIMVRADDEPEDFVKRVMKKPVMMVDSWC |
Ga0255130_10098364 | 3300027335 | Freshwater | DLQICEVDLVESMGFIMVRADDEPEDFVKRVMKKPVMMVDSWC |
Ga0255130_10472961 | 3300027335 | Freshwater | VKYALTKMNIAFEAAAVDLQICEVDLVESMGFIMVRADDEPEDFVKRVMKKPVMMVDSWC |
Ga0255128_10656663 | 3300027336 | Freshwater | MNIAFEAAGIDLQVCEIDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWI |
Ga0209552_10562671 | 3300027563 | Freshwater Lake | AGVDLVESMGYMLVRTDDTPESFAKRVMKKPVVMVESWVD |
Ga0209552_11798232 | 3300027563 | Freshwater Lake | LDLEVKQADLVESMGFVLTLTDDEPEDFVKRVLKKPVLHVESWV |
Ga0208966_11915341 | 3300027586 | Freshwater Lentic | GIDVQVCEVDLVESMGFMLVRCDDEPEDFVKRVMKKPVMMVDSWV |
Ga0255118_10432313 | 3300027593 | Freshwater | DLVESMGYMLVRTDDTPESFAKRVMKKPVLMVESWVD |
Ga0255118_10828701 | 3300027593 | Freshwater | LVESMGFMLVRADDEPEDFVKRVLKKPVLMVDSWV |
Ga0209135_11217021 | 3300027642 | Freshwater Lake | CEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209356_10898362 | 3300027644 | Freshwater Lake | MNIAFEAAALDLQVCEVDLVESMGFMLVRCDDEPEDFVKRVLKKPVVMVESWLD |
Ga0209356_11214571 | 3300027644 | Freshwater Lake | DLQVCEVDLVESMGFVLVRCDDEPEDFVKRVLKKPVTVVESWV |
Ga0209356_11418841 | 3300027644 | Freshwater Lake | YALTKMNIAFEAAAIDLQICEVDLVESMGFILVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209356_12021051 | 3300027644 | Freshwater Lake | DLVESMGYVLTLADDEPEDFVKRVLKKPVLHVESWV |
Ga0209356_12120353 | 3300027644 | Freshwater Lake | LGESMGYMLVRVDDTPEDFVKRVLKKPVLMVEPWL |
Ga0209357_10044251 | 3300027656 | Freshwater Lake | ALDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209357_11185623 | 3300027656 | Freshwater Lake | VESMGYMLVRTDDTPESFAKRVMKKPVVMVESWVD |
Ga0208975_10676791 | 3300027659 | Freshwater Lentic | QVCEVDLVESMGFVLVRCDDEPEDFVKRVLKKPVTVVESWV |
Ga0209553_11822131 | 3300027688 | Freshwater Lake | KYALTKMNIAFEAAALDLQVCEVDLIESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209553_12137571 | 3300027688 | Freshwater Lake | KQADLVESMGFVLTLADDEPEDFVKRVLKKPVLHVESWV |
Ga0209443_10317164 | 3300027707 | Freshwater Lake | VDLVESMGFMLVRCDDEPEDFVKRVLKKPVMMVDSWV |
Ga0209188_10649777 | 3300027708 | Freshwater Lake | IDLEIQTADMVESMGFMLVRTDDTPEDFVKRVLKKPVMMVESWVD |
Ga0209599_100415541 | 3300027710 | Deep Subsurface | VDIQVCEVDLVESMGFVMVRVDDEPEDFVKRVMKKPVMMVDSWV |
Ga0209599_101219771 | 3300027710 | Deep Subsurface | GVDIQVCEVDLVESMGFVMVRCDDEPEDFVKRVLKKPVLMVDSWV |
Ga0209442_12327191 | 3300027732 | Freshwater Lake | KMNIAFEAAALDLQVCEVDLVESMGFMLVRCDDEPEDFVKRVLKKPVVMVESWLD |
Ga0209442_13163541 | 3300027732 | Freshwater Lake | QVCEVDLVESMGFMLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209355_10572696 | 3300027744 | Freshwater Lake | LQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209355_11900911 | 3300027744 | Freshwater Lake | AFEAAALDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209355_13340352 | 3300027744 | Freshwater Lake | QVCEVDLIESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209596_13505922 | 3300027754 | Freshwater Lake | LTKMNVAFEKAGVDLQVCEVDLVESMGFMLVRCDDEPEDFVKRVLKKPVMMVDSWV |
Ga0209444_102295823 | 3300027756 | Freshwater Lake | NIAFEAAAIDLQICEVDLVESMGFILVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209444_102791662 | 3300027756 | Freshwater Lake | VESMGFVMVRADDEPEDFVKRVLKKPVLMVESWID |
Ga0209088_102744131 | 3300027763 | Freshwater Lake | SVDLVESMGFVMVRADDEPEDFVKRVLKKPVMMVESWID |
Ga0209770_101092911 | 3300027769 | Freshwater Lake | LDAADLPLEIAEVDLVESYGYMLVRTDDTPESFVKRVMKKPVVMVESWVD |
Ga0209768_100010621 | 3300027772 | Freshwater Lake | KMNVAFEKAGVDLQVCEVDLVESYGYMLVRCDDEPEDFVKRVLKKPVMMVDSWI |
Ga0209768_100877955 | 3300027772 | Freshwater Lake | EVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209246_100400361 | 3300027785 | Freshwater Lake | LQVCEVDLVESYGYMLVRCDDEPEDFVKRVLKKPVMMVDSWV |
Ga0209246_103070421 | 3300027785 | Freshwater Lake | LPLEIAGVDLVESMGYMLVRTDDTPESFAKRVMKKPVLMVESWVD |
Ga0209353_100935455 | 3300027798 | Freshwater Lake | TRMNIAFEAAAVDLQICEVDLVESMGFILVRADDEPEDFVKRVLKKPVLMVDSWV |
Ga0209353_102201391 | 3300027798 | Freshwater Lake | DLGESMGYMLVRVDDTPEDFVKRVLKKPVLMVEPWL |
Ga0209353_102596261 | 3300027798 | Freshwater Lake | DLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209353_102696073 | 3300027798 | Freshwater Lake | GVKYALTKMNIAFEAAAVDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVMMVDSW |
Ga0209353_104247221 | 3300027798 | Freshwater Lake | MNIAFEAAAVDLQVCEVDLVESMGFVLVRADDEPEDFVKRVLKKPVLMVDSWV |
Ga0209354_100283781 | 3300027808 | Freshwater Lake | VDLQVCEVDLVESYGYMLVRCDDEPEDFVKRVLKKPVMMVDSWV |
Ga0209990_102176693 | 3300027816 | Freshwater Lake | KSVDLVESLGHMLVRTDDDPESFAKRATKKPVLMVESWV |
Ga0209990_103261543 | 3300027816 | Freshwater Lake | VDLEVKSVDLVESLGHMLVRTDDDPESFAKRATKKPVLMVESWV |
Ga0209230_102967563 | 3300027836 | Freshwater And Sediment | QSADLGESMGYMLTRVDDTPEDFVKRVLKKPVMMVEPWL |
Ga0209550_103789184 | 3300027892 | Freshwater Lake | AADLPLEIAEVDLVESYGYMLVRTDDTPESFVKRVMKKPVVMVESWVD |
Ga0209400_12995951 | 3300027963 | Freshwater Lake | MNTAFEKAGVDLQICEVDLVESMGFMLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0209191_10315481 | 3300027969 | Freshwater Lake | CSVDLVESMGFVMVRADDEPEDFVKRVLKKPVLMVESWID |
Ga0209191_11000161 | 3300027969 | Freshwater Lake | DLQVCEVDLVESMGFMLVRTDDEPEDFVKRVLKKPVLMVESWID |
Ga0209191_13322462 | 3300027969 | Freshwater Lake | AAVDLQVCEVDLVESMGFVLVRADDEPEDFVKRVMKKPVMMVDSWV |
Ga0255172_10187603 | 3300028103 | Freshwater | RALEAAGIDIEIKEVDLVESMGFVMVRTDDEPEDFVKRALKKPVMMVDSWV |
Ga0304728_11133153 | 3300028393 | Freshwater Lake | ICEVDLVESMGFMLVRADDEPEDFVKRVLKKPVLMVDSWV |
Ga0315907_100946428 | 3300031758 | Freshwater | EAAGVDLEVKSVDLVESLGHMLVRTDDDPESFAKRATKKPVLMVESWV |
Ga0315907_103605135 | 3300031758 | Freshwater | LDLQICEADLVESMGYMLVRTDDTPEDFVKRVLKKPVLMVESWVD |
Ga0315908_112923311 | 3300031786 | Freshwater | ALEAAGLDIQVCSVDLVESMGFVMVRCDDEPEDFVKRVMKKPVLMVESWVD |
Ga0315909_104202891 | 3300031857 | Freshwater | AAALDLQVCEVDLVESMGFMMVRADDEPEDFVKRVMKKPVMMVDSWI |
Ga0315904_105390964 | 3300031951 | Freshwater | VCEVDLVESMGFMLVRADDEPEDFVKRVLKKPVLMVESWID |
Ga0315906_103814486 | 3300032050 | Freshwater | LEVKSVDLVESLGHMLVRTDDDPESFAKRATKKPVLMVESWV |
Ga0334992_0207559_2_112 | 3300033992 | Freshwater | DLVESMGFVMVRCDDEPEDFVKRALKKPVMMVDSWV |
Ga0335020_0248246_749_880 | 3300034082 | Freshwater | LEVAEVDLVESMGYMLVRTDDTPESFVKRVMKKPVVMVESWVD |
Ga0335020_0296198_12_176 | 3300034082 | Freshwater | MNIAFEAAGLDLQICTVDLVESMGFVMVRADDEPEDFVKRVLKKPVLMVESWID |
Ga0335012_0112794_1382_1498 | 3300034093 | Freshwater | VDLVESMGFVMVRADDEPEDFVKRVMKKPVMMVESWID |
Ga0335031_0382579_14_175 | 3300034104 | Freshwater | MNIAFEAAALDLQVCEVDLVESMGFILVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0335050_0078445_1799_1960 | 3300034108 | Freshwater | MNIAFEKAGVDLQICEVDLVESMGFMLVRADDEPEDFVKRVLKKPVMMVDSWI |
Ga0335033_0404509_528_662 | 3300034117 | Freshwater | LDLEVKEADLVESMGYMLVLADDEPEDFVKRVLKKPVLHVESWV |
Ga0335048_0049849_2589_2711 | 3300034356 | Freshwater | VCETDLVESMGFVMVRCDDEPEDFVKRALKKPVMMVDSWV |
⦗Top⦘ |