Basic Information | |
---|---|
Family ID | F034288 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 175 |
Average Sequence Length | 41 residues |
Representative Sequence | PVSLVNDALQKKLNEQRDRLKLPDNVGGMKVENGELVMTQK |
Number of Associated Samples | 149 |
Number of Associated Scaffolds | 175 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.96 % |
% of genes near scaffold ends (potentially truncated) | 54.86 % |
% of genes from short scaffolds (< 2000 bps) | 54.29 % |
Associated GOLD sequencing projects | 138 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (72.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.143 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.571 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 11.59% Coil/Unstructured: 68.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 175 Family Scaffolds |
---|---|---|
PF00232 | Glyco_hydro_1 | 46.29 |
PF00753 | Lactamase_B | 5.14 |
PF00578 | AhpC-TSA | 1.71 |
PF05649 | Peptidase_M13_N | 1.14 |
PF02569 | Pantoate_ligase | 1.14 |
PF02511 | Thy1 | 0.57 |
PF12802 | MarR_2 | 0.57 |
PF13087 | AAA_12 | 0.57 |
PF00117 | GATase | 0.57 |
PF12848 | ABC_tran_Xtn | 0.57 |
PF00289 | Biotin_carb_N | 0.57 |
PF13175 | AAA_15 | 0.57 |
PF00694 | Aconitase_C | 0.57 |
PF02786 | CPSase_L_D2 | 0.57 |
PF00069 | Pkinase | 0.57 |
PF06863 | DUF1254 | 0.57 |
PF00009 | GTP_EFTU | 0.57 |
PF02245 | Pur_DNA_glyco | 0.57 |
PF13185 | GAF_2 | 0.57 |
COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
---|---|---|---|
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 46.29 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.29 |
COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 1.14 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 1.14 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.57 |
COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 0.57 |
COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 72.00 % |
All Organisms | root | All Organisms | 28.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004092|Ga0062389_100532486 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300004157|Ga0062590_101243577 | Not Available | 729 | Open in IMG/M |
3300005171|Ga0066677_10475003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 717 | Open in IMG/M |
3300005436|Ga0070713_101028189 | Not Available | 795 | Open in IMG/M |
3300005538|Ga0070731_10094426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1981 | Open in IMG/M |
3300005538|Ga0070731_10225308 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
3300005541|Ga0070733_10059610 | All Organisms → cellular organisms → Bacteria | 2396 | Open in IMG/M |
3300005554|Ga0066661_10363724 | Not Available | 885 | Open in IMG/M |
3300005558|Ga0066698_10515659 | Not Available | 812 | Open in IMG/M |
3300005560|Ga0066670_10234031 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300005586|Ga0066691_10616216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 645 | Open in IMG/M |
3300005881|Ga0075294_1020366 | Not Available | 626 | Open in IMG/M |
3300006052|Ga0075029_100217019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
3300006052|Ga0075029_101228615 | Not Available | 524 | Open in IMG/M |
3300006086|Ga0075019_10358774 | Not Available | 886 | Open in IMG/M |
3300006162|Ga0075030_101144496 | Not Available | 612 | Open in IMG/M |
3300006174|Ga0075014_100457339 | Not Available | 707 | Open in IMG/M |
3300006174|Ga0075014_100624232 | Not Available | 619 | Open in IMG/M |
3300006176|Ga0070765_101479428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300009098|Ga0105245_10462076 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300009520|Ga0116214_1185378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
3300009520|Ga0116214_1359558 | Not Available | 564 | Open in IMG/M |
3300009521|Ga0116222_1425211 | Not Available | 579 | Open in IMG/M |
3300009525|Ga0116220_10238425 | Not Available | 793 | Open in IMG/M |
3300009635|Ga0116117_1168116 | Not Available | 570 | Open in IMG/M |
3300009644|Ga0116121_1150901 | Not Available | 734 | Open in IMG/M |
3300009839|Ga0116223_10241696 | Not Available | 1091 | Open in IMG/M |
3300010048|Ga0126373_13077491 | Not Available | 520 | Open in IMG/M |
3300010358|Ga0126370_12106707 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 554 | Open in IMG/M |
3300010376|Ga0126381_101834042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
3300010379|Ga0136449_100122214 | All Organisms → cellular organisms → Bacteria | 5227 | Open in IMG/M |
3300011271|Ga0137393_10139957 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
3300012362|Ga0137361_11753655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300012685|Ga0137397_11185241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300012918|Ga0137396_10867185 | Not Available | 663 | Open in IMG/M |
3300012924|Ga0137413_10217075 | Not Available | 1295 | Open in IMG/M |
3300012989|Ga0164305_11612241 | Not Available | 579 | Open in IMG/M |
3300014169|Ga0181531_10446498 | Not Available | 796 | Open in IMG/M |
3300014169|Ga0181531_10796515 | Not Available | 589 | Open in IMG/M |
3300016445|Ga0182038_11671661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300016445|Ga0182038_11954620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300017822|Ga0187802_10169547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
3300017938|Ga0187854_10498553 | Not Available | 505 | Open in IMG/M |
3300017943|Ga0187819_10335986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
3300017955|Ga0187817_10713491 | Not Available | 640 | Open in IMG/M |
3300017973|Ga0187780_10556562 | Not Available | 822 | Open in IMG/M |
3300017973|Ga0187780_11187431 | Not Available | 559 | Open in IMG/M |
3300017975|Ga0187782_10133637 | Not Available | 1839 | Open in IMG/M |
3300018006|Ga0187804_10322220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300018007|Ga0187805_10556996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
3300018017|Ga0187872_10447914 | Not Available | 541 | Open in IMG/M |
3300018034|Ga0187863_10081602 | Not Available | 1820 | Open in IMG/M |
3300018085|Ga0187772_11053388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300018086|Ga0187769_10278096 | Not Available | 1249 | Open in IMG/M |
3300018090|Ga0187770_11428038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300018468|Ga0066662_12228671 | Not Available | 575 | Open in IMG/M |
3300019786|Ga0182025_1382465 | Not Available | 1949 | Open in IMG/M |
3300020199|Ga0179592_10168656 | Not Available | 998 | Open in IMG/M |
3300020580|Ga0210403_10880514 | Not Available | 707 | Open in IMG/M |
3300021181|Ga0210388_10561221 | Not Available | 1000 | Open in IMG/M |
3300021420|Ga0210394_11104681 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300021433|Ga0210391_10922005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 681 | Open in IMG/M |
3300021475|Ga0210392_10490942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300021475|Ga0210392_11139251 | Not Available | 584 | Open in IMG/M |
3300021478|Ga0210402_11745460 | Not Available | 549 | Open in IMG/M |
3300021479|Ga0210410_10091676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2678 | Open in IMG/M |
3300021559|Ga0210409_11130158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 658 | Open in IMG/M |
3300021560|Ga0126371_12763072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300022557|Ga0212123_10513082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 775 | Open in IMG/M |
3300023019|Ga0224560_107592 | Not Available | 675 | Open in IMG/M |
3300025473|Ga0208190_1091463 | Not Available | 601 | Open in IMG/M |
3300025929|Ga0207664_11505012 | Not Available | 595 | Open in IMG/M |
3300026215|Ga0209849_1010155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1532 | Open in IMG/M |
3300026552|Ga0209577_10714412 | Not Available | 565 | Open in IMG/M |
3300026557|Ga0179587_10686184 | Not Available | 675 | Open in IMG/M |
3300027326|Ga0209731_1077369 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300027502|Ga0209622_1066947 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300027575|Ga0209525_1018083 | Not Available | 1722 | Open in IMG/M |
3300027591|Ga0209733_1117711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300027853|Ga0209274_10036782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2288 | Open in IMG/M |
3300027867|Ga0209167_10454031 | Not Available | 700 | Open in IMG/M |
3300027884|Ga0209275_10072551 | Not Available | 1708 | Open in IMG/M |
3300027911|Ga0209698_10252603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1408 | Open in IMG/M |
3300028776|Ga0302303_10307696 | Not Available | 533 | Open in IMG/M |
3300028800|Ga0265338_10015249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8465 | Open in IMG/M |
3300030490|Ga0302184_10187850 | Not Available | 875 | Open in IMG/M |
3300030659|Ga0316363_10220143 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300030707|Ga0310038_10089189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1636 | Open in IMG/M |
3300031231|Ga0170824_126356286 | Not Available | 678 | Open in IMG/M |
3300031233|Ga0302307_10525227 | Not Available | 598 | Open in IMG/M |
3300031474|Ga0170818_100591786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300031720|Ga0307469_10732719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 900 | Open in IMG/M |
3300031823|Ga0307478_10573889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 943 | Open in IMG/M |
3300031962|Ga0307479_10265151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1697 | Open in IMG/M |
3300032205|Ga0307472_101983948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300032828|Ga0335080_10785107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 986 | Open in IMG/M |
3300032828|Ga0335080_10981230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
3300032896|Ga0335075_11241900 | Not Available | 642 | Open in IMG/M |
3300032955|Ga0335076_10001121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25617 | Open in IMG/M |
3300033807|Ga0314866_007702 | Not Available | 1363 | Open in IMG/M |
3300034282|Ga0370492_0230636 | Not Available | 753 | Open in IMG/M |
3300034282|Ga0370492_0245793 | Not Available | 727 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.29% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.57% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.57% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.43% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.29% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.71% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.71% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.14% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.14% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.14% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.57% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.57% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.57% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.57% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.57% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.57% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.57% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.57% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.57% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023019 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1 | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12654J13325_10097672 | 3300001160 | Forest Soil | VNDALQKRLNEQRDRLKLPDNVGGMKVENGELVMTQK* |
Ga0062389_1005324861 | 3300004092 | Bog Forest Soil | PVSLVNPALQKKLAEQRDRLKLPDYVGDVRVQNGELVMQQK* |
Ga0062590_1012435772 | 3300004157 | Soil | LSVPVSLVNPALQKKLAEERDRLKLPDGVGGMKVENSQLVLQGR* |
Ga0066677_104750032 | 3300005171 | Soil | KVGDLNVPVSLVNPALQKKLAEQRDRMKLPDYVGDVKVQNSELVMQEK* |
Ga0070713_1010281892 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SLVNPALQKKLAEQRDRLKLPDNVGGMKVENGELVMQGK* |
Ga0070701_100657451 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | LNVPVSLVNDALQKKLSEQRDRLKLPDNVGGMKVENGELVMTQK* |
Ga0070731_100944261 | 3300005538 | Surface Soil | NPSLQKKLAEQRDRMKLPDYVGDVKVQNGELVMQQK* |
Ga0070731_102253082 | 3300005538 | Surface Soil | NPALQKKLAEQRDRLKLPDGVGSMKVEHSELVMQQK* |
Ga0070733_1000597715 | 3300005541 | Surface Soil | LVNDALQKKLSEQRDHLKLPDDVGGIRVENGELVMTQR* |
Ga0070733_100596103 | 3300005541 | Surface Soil | PTEFKVGDLEIPVSLVKPALEKKMQEERDRLKLPDYVGDVKVKDSELVMTQK* |
Ga0066661_103637241 | 3300005554 | Soil | NVPVSLVNPALQRKLAEERDRLKLPNSVGGMKVENGELVMQQK* |
Ga0066661_105399663 | 3300005554 | Soil | NVPVSLVNDALQKKLIEQRDRLKLPDNVDSIKVENGELVMTQK* |
Ga0066698_105156591 | 3300005558 | Soil | PALQRKLAEERDRLKLPNSVGGMKVENGELVMQQK* |
Ga0066700_101957183 | 3300005559 | Soil | LNVPVSLVNSALQKRLAEQRDRLKLPDSVGVMKVENGELVMTQK* |
Ga0066700_106097391 | 3300005559 | Soil | NDALQKRLAEQRDRLKLPDNVSGIKVENGELVMTQK* |
Ga0066670_102340312 | 3300005560 | Soil | PTEFKVGEMNVPVSLVNSALQKKLAEQRDRLKLPDYVGDVRVQNGELVMQQK* |
Ga0066705_100447851 | 3300005569 | Soil | GDLEVPVSLVNDQLQKRLSEQRDRLKLPDNVGGMKVENSEVVLTNK* |
Ga0066691_106162161 | 3300005586 | Soil | VPVSLVNSALQRKLSEQRDRLKLPDYIGDVKVQNGELVMEQK* |
Ga0066903_1064422952 | 3300005764 | Tropical Forest Soil | DQLQKKLFEQREQMKLPDSVGQLKVENGEVVVTNK* |
Ga0075294_10203662 | 3300005881 | Rice Paddy Soil | PVSLVNPALQKKLAEERDRLRLPDGVGGIKVENGQLVMQGK* |
Ga0075289_10066852 | 3300005888 | Rice Paddy Soil | PALQKKLAEERDRLRLPDGVGGIKVENGQLVMQGK* |
Ga0075029_1002170191 | 3300006052 | Watersheds | PALQKKLAEQRDRLKLPGGVGSMKVENGELVMQQK* |
Ga0075029_1012286152 | 3300006052 | Watersheds | SLVNPALQKKLTEQRDRMKLPDNVGDLKVQNGELVMQQK* |
Ga0075019_103587741 | 3300006086 | Watersheds | VSLVNPALQKKLAEERDRLKLPDNVGAMKVENGELVMQQK* |
Ga0075030_1011444961 | 3300006162 | Watersheds | VGDLSVPVSLVNPALQKKLAEQRDRLKLPDSVGAMKVENSELVMQQK* |
Ga0075014_1004573392 | 3300006174 | Watersheds | LSVPVSLVNPALQKKLAEERDRLRLPDNVGAMKVENGELVMQQK* |
Ga0075014_1006242322 | 3300006174 | Watersheds | LSVPVSLVNPALQKKLAEQRDRLKLPDNVGAMKVENGELVMQQK* |
Ga0075014_1010180741 | 3300006174 | Watersheds | GALQKKLAEQRDRLKLPDDVGGIKVENGQLVATQK* |
Ga0070765_1014794281 | 3300006176 | Soil | SVPVSLVNPALQKKLAEQRDRLKLPDNVGAMKVENGELVMQQK* |
Ga0075425_1005867541 | 3300006854 | Populus Rhizosphere | ALQKKLNEQRDRLKLPDNVGGMKVENGELVMTQK* |
Ga0068865_1004648202 | 3300006881 | Miscanthus Rhizosphere | VPVSLVNDALQKKLSEQRDRLKLPDNVGGMKVENGELVMTQK* |
Ga0099828_102403583 | 3300009089 | Vadose Zone Soil | VNDALQKKLNEQRNRLKLPDNVGGMKVEKGELVMTQK* |
Ga0105245_104620764 | 3300009098 | Miscanthus Rhizosphere | TSLVNRALQKQLVDQRDKLKLPDSVGAVKIEKGELVLTQK* |
Ga0116214_11853782 | 3300009520 | Peatlands Soil | LSIPVSLVNDALQKKLSEQRDRMKLPDDVGTIKVENGELVVTQK* |
Ga0116214_13595582 | 3300009520 | Peatlands Soil | VSLVKPALEKKMQEQRDRLKLPDYVGDMKVKDGELVMTQK* |
Ga0116222_10698132 | 3300009521 | Peatlands Soil | SIPVSLVNDALQKKLSEQRDRLKLPDNVDGIKVENGELVITQR* |
Ga0116222_14252112 | 3300009521 | Peatlands Soil | PVSLVNPALQKKLAEQRDRMKLPENVGGLKVENGELVMQQK* |
Ga0116220_102384252 | 3300009525 | Peatlands Soil | VNPALQKKLAEQHDRLKLPEFVGDVKVQNGELVMQQK* |
Ga0116117_11681161 | 3300009635 | Peatland | EFKVGDLNVPVSLVNPALQKKLAEQRDRMKLPDNVGDMKVENGQLVMQQK* |
Ga0116121_11509012 | 3300009644 | Peatland | VSLVNPALQKKLFEQRDRMKLPENVGDLKVQNGELVMQQK* |
Ga0116223_102416962 | 3300009839 | Peatlands Soil | SLVNPAFQKKLAEQRDRIKLPENVGDLKVQNGQLVMQQK* |
Ga0126384_115571401 | 3300010046 | Tropical Forest Soil | PVSLVNDALQKRLAEQRDRLKLPDNVGGIKVENGEVVLTQR* |
Ga0126373_130774911 | 3300010048 | Tropical Forest Soil | LVNPALQKKLAEQRDRLKLPDGVGSLRIQNSELVIEGR* |
Ga0126370_110111071 | 3300010358 | Tropical Forest Soil | DQLQKRLMEQRDRLKLPDSVGGIKVENGEVVLNNK* |
Ga0126370_121067071 | 3300010358 | Tropical Forest Soil | ALQKKLAEEHDRLKLPDNVGGLKVENSELVMQGK* |
Ga0126376_124060402 | 3300010359 | Tropical Forest Soil | LVNDQLQKRLMEQRDRLKLPDSVNGIKVENSEVVLSNK* |
Ga0126372_129621901 | 3300010360 | Tropical Forest Soil | LVNDQLQKRLAEQRDRLKLPDGVGGIKVENSEVVLTNR* |
Ga0105239_131483782 | 3300010375 | Corn Rhizosphere | LVNDALQKKLSEQKDRLKLPDNVGGMKVENGELVMTQK* |
Ga0126381_1018340422 | 3300010376 | Tropical Forest Soil | LNVPVSVVNLALQKKLAEEHDRLKLPDNVGNLKVENSQLVMQQK* |
Ga0136449_1001103609 | 3300010379 | Peatlands Soil | SLVNDALQKRLTEQRDRLKLPDNVDGIKVENGELVMTGK* |
Ga0136449_1001222146 | 3300010379 | Peatlands Soil | LSVPISLVNPALQKKLAEERDRLKLPDNVGAMKVQNSELVMQQK* |
Ga0134122_115696992 | 3300010400 | Terrestrial Soil | NVPVSLVNEALQKKLNEQRDRLNLPDNVGGMKVENGELVMTQK* |
Ga0137393_101399571 | 3300011271 | Vadose Zone Soil | TEFKLGDLNVPVSLVNPALQKKLAEQRDRMKLPDFVGDVKVNNSELVMTEK* |
Ga0137393_101528703 | 3300011271 | Vadose Zone Soil | PVSLVNDALQKKLNEQRDRLKLPDNVGGMKVENGELVMTQK* |
Ga0137361_117536552 | 3300012362 | Vadose Zone Soil | VSLVNDHLQKRLMEQRERLKLPESVSGIRVENGEIVLSK* |
Ga0137397_111852412 | 3300012685 | Vadose Zone Soil | LNIPVSLVNPSLQKKLSEERDRMKLPGYVGGVKVKNGELVMQQK* |
Ga0137396_108671852 | 3300012918 | Vadose Zone Soil | VGDLNVPVSLVNPALQKKLAEQRDRMKLPDYVGDVKVQNSELVMQEK* |
Ga0137413_102170751 | 3300012924 | Vadose Zone Soil | DALQKKLAEQHDRMKLPDSVGGLKVENGELVVTQK* |
Ga0126375_114631311 | 3300012948 | Tropical Forest Soil | PVSLVNDQLQKRLMDQRDRLKLPESVSGIKVENGEVVLSK* |
Ga0164305_116122412 | 3300012989 | Soil | PVSLVNPALQKKLAEERDRLKLPDGVGGMKVENSQLVLQGR* |
Ga0181528_105955032 | 3300014167 | Bog | PVSLVNDALQKKLGEQRDKLKLPDNVGGFKVENGEMVLTQR* |
Ga0181534_105282572 | 3300014168 | Bog | VAAVAVALQKKLGEQRDKLKLPDNVGGFKVENGEMVLTQR* |
Ga0181531_104464982 | 3300014169 | Bog | SLVNPALQKKLAEQRDRLKLPENVGGVKVQNGELVMQGK* |
Ga0181531_107965152 | 3300014169 | Bog | VSLVNPALQKKLAEQHDRLKLPDYVGDVKVQNGELVMQQK* |
Ga0181537_106367341 | 3300014201 | Bog | ALQKKLGEQRDKLKLPDNVGGFKVENGEMVLTQR* |
Ga0167631_10064201 | 3300015168 | Glacier Forefield Soil | VNDALQKKLADQKDHLKLPDGVGGIKVENGELVLTQR* |
Ga0182036_100523371 | 3300016270 | Soil | VPVSLVNDQLQKKLLEQRDRLKLPDSVRDLKVENSEVVVSK |
Ga0182038_116716611 | 3300016445 | Soil | VSLVNPALQKKLAEEHDRLKLPDNVGNLKIENSQLVMQQK |
Ga0182038_119546201 | 3300016445 | Soil | LNVPVSLVNPTLQKKLAEQRDRLKLPDNVGNLKVENSELVMQQK |
Ga0187802_101695472 | 3300017822 | Freshwater Sediment | LVSDALQKKLSEQRDRMKLPDDVGTIKVENGELVVTQK |
Ga0187854_104985531 | 3300017938 | Peatland | EFKVGDLNVPVSLVNPALQKKLFEQRDRMKLPENVGDLKVQNGELVMQQK |
Ga0187819_102289872 | 3300017943 | Freshwater Sediment | DLSIPVSLVNDALQRKLSEQRDRLKLPDDVSGIRVENGELVMTQK |
Ga0187819_103359861 | 3300017943 | Freshwater Sediment | VGDLNVPVSLVNPQLQKKLAEQRDRLKLPDNVGSMKVEDSQLVMQQR |
Ga0187817_107134911 | 3300017955 | Freshwater Sediment | PALQKKLAEERDRLKLPDSVGGLKVENSELVMQGK |
Ga0187781_103287602 | 3300017972 | Tropical Peatland | SLVNPALQKKLSEQRDRLKLPDNVGGMKIENGELVMQQK |
Ga0187780_105565623 | 3300017973 | Tropical Peatland | SLVNPALQKKLGEERDRLKLPDNVGGVKVENGELVMQQK |
Ga0187780_111874312 | 3300017973 | Tropical Peatland | VSLVNPALQKKLAEERDRLKLPDNVGGVKVENGQLVMQQK |
Ga0187782_101336372 | 3300017975 | Tropical Peatland | DVPVSLVNPELQKKLAEQRDRLKLPEGVGGLKIEKSELVMQGK |
Ga0187823_101272292 | 3300017993 | Freshwater Sediment | PVSLVNDQLQKRLAEQRDRLKLPDSIGGIKVENGEVVLKNK |
Ga0187816_103764751 | 3300017995 | Freshwater Sediment | LVNDALQKRLAEQHDRMKLPDNVGGIKVENGQLVLTQK |
Ga0187804_103222202 | 3300018006 | Freshwater Sediment | VGDLNVPVSLVNPQLQKKLAEQRDRLKLPDNVGSLKVEDSQLVMQQR |
Ga0187805_105569962 | 3300018007 | Freshwater Sediment | PVSLVNPALQKKLAEQRDRLKLPDYVGDVKVQNGQLVMQQK |
Ga0187872_104479142 | 3300018017 | Peatland | VPVSLVNPALQKKLAEQRDRMKLPNNVGDLKVQNGELVMQQK |
Ga0184605_104726441 | 3300018027 | Groundwater Sediment | VSLVNDALQKKLIEQHDRLKLPDNVGGIKVENGELVMTQK |
Ga0187863_100816023 | 3300018034 | Peatland | VSLVNPALQKKLAEQRDRMKLPDNVGDVKVQNSELVMQQK |
Ga0187772_110533881 | 3300018085 | Tropical Peatland | VPVSLVNPALQKKLAEERDRLKLPDNVGNLKIENGELVMQQR |
Ga0187769_102780962 | 3300018086 | Tropical Peatland | PALQKKLAEERDRLKLPDNVGGVKVENGQLVMQQK |
Ga0187770_111524221 | 3300018090 | Tropical Peatland | PVSLVNEELQKKLADQRDRLKLPDDVGGIRVENGELVMTQK |
Ga0187770_114280381 | 3300018090 | Tropical Peatland | LVNPALQKKLAEERDRLKVPDNVGSMKVENGELVMQQK |
Ga0066662_122286712 | 3300018468 | Grasslands Soil | SLVNPTLQKKLAEQRDRLKLPDNVGSMKVENGELVMQGK |
Ga0182025_13824654 | 3300019786 | Permafrost | VNPALQKKLAEQRDRMKLPENVGGVKVENGELVMQQK |
Ga0179592_101686562 | 3300020199 | Vadose Zone Soil | VGDINVPTSLVNDALQKKLAEQHDRMKLPDSVGGLKVENGELVVTQK |
Ga0179592_101817241 | 3300020199 | Vadose Zone Soil | SLFNDHLQKRLMEQRERLKLPESVSGIRVENGEIVLSK |
Ga0210403_108805141 | 3300020580 | Soil | SVPVSLVNPTLQKKLEEQRDRLKLPDNVGAMKVENGELVMQQK |
Ga0210403_114870041 | 3300020580 | Soil | SLVNDALQKKLIEQRDRLKLPDNVGGMKVENGELVMTQK |
Ga0210399_108534701 | 3300020581 | Soil | PVSLVNDALQKKLIEQRDRLKLPDNVGGMKVENGELVMTQK |
Ga0210401_111085302 | 3300020583 | Soil | DQLQKRLLEQRDRLKLPDNVGGIKVENGEVVVTNK |
Ga0210404_102574642 | 3300021088 | Soil | DLAIPVSLVNDQLQKRLLEQRDQLKLPESVGGIKVENGEVVVTNR |
Ga0210405_106458962 | 3300021171 | Soil | SGALQKKLSEQRDRLKLPDDVGNIKVENGQLVATQK |
Ga0210388_105612212 | 3300021181 | Soil | SLVNPALQKKLAEQRDRMKLPDFVGDVKVQNGELVMQQK |
Ga0210397_110154501 | 3300021403 | Soil | VPVSLVNDSLQKRLTEQRDRMKLPDNVGGIKVENGELVMTQR |
Ga0210397_111659441 | 3300021403 | Soil | VSLVNDALQKKLNEQRDRLRLPDNVGGMKVENGELVMTQK |
Ga0210394_111046812 | 3300021420 | Soil | SLVNPALQKKLAEQRDRLKLPDGVGTMKVENGELVMQGK |
Ga0210391_109220052 | 3300021433 | Soil | FKLGDLNVPVSLVNPALQKKLAEQRDRMKLPDYVGDVKVQNGELVMQQK |
Ga0210392_104909422 | 3300021475 | Soil | VGDLSVPVSLVNPALQKKLAEQRDRLKLPDSVGALKVQNGELVMQQK |
Ga0210392_111392512 | 3300021475 | Soil | NVPVSLVNPALQKKLAEERDRLKLPNNVGAMKVENSELVMQQK |
Ga0210402_117454602 | 3300021478 | Soil | SLVNDALQKKLAEQHDRLKLPDSVGGLKVENGELVVMQK |
Ga0210410_100916761 | 3300021479 | Soil | DFKVGDLSVPVSLVNPALQKKLAEQRDRLKLPDSVGALKVQNGELVMQQK |
Ga0210409_111301581 | 3300021559 | Soil | KVGDLNVPVSLVNPALQKKLAEQRDRLKLPDGVGTMKVENGELVMQGK |
Ga0126371_127630721 | 3300021560 | Tropical Forest Soil | GELNIPVAMVNPALQKKLAEQRDRLKLPDNVGNLKVENSQLVMQQK |
Ga0212123_105130822 | 3300022557 | Iron-Sulfur Acid Spring | EFKVGDLNVPVSLVNPTLQKKLAEQRDRMKLPDNVGSMKVQNGELVMQQK |
Ga0224560_1075922 | 3300023019 | Soil | GDLNVPVSLVNPALQKKLAEQRDRMKLPDNVGGLKVENGELVMQQK |
Ga0208190_10914631 | 3300025473 | Peatland | LVNPALQKKLFEQRDRMKLPENVGDLKVQNGELVMQQK |
Ga0207699_100582521 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LVNDQLQKRLMEQRDRLKLPDNVGGIKVENSEVVVTNK |
Ga0207693_114276602 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DQLQKRLLEQRDRLKLPDNVGGLRVENGEVVMTNK |
Ga0207660_102847301 | 3300025917 | Corn Rhizosphere | LNVPVSLVNDALQKRLMEQRDRLKLPDNVGGIKVENGEVVLTQR |
Ga0207664_115050122 | 3300025929 | Agricultural Soil | LVNPTLQKKLAEQRDRMKLPDNVGSMKVENGELVMQQK |
Ga0207665_106723072 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | NDQLQKRLLEQRDRLKLPDNVGGLRVENGEVVMTNK |
Ga0207702_102915703 | 3300026078 | Corn Rhizosphere | NDALQKKLNEQRDRLKLPDNVGGMKVENGELVMTQK |
Ga0209849_10101551 | 3300026215 | Soil | LNVPVSLVNSALQKKLAEQRDRMKLPDFVGDVKVDNGELVMTQK |
Ga0209055_12473702 | 3300026309 | Soil | PVSLVNDALQKKLIEQRDRLKLPDNVDSIKVENGELVMTQK |
Ga0209807_13476641 | 3300026530 | Soil | GDLEVPVSLVNDQLQKRLSEQRDRLKLPDNVGGMKVENSEVVLTNK |
Ga0209577_107144121 | 3300026552 | Soil | VPVSLVNPALQKKLAEQRDRLKLPGYVGDVKVENGELVMQQK |
Ga0179587_106861841 | 3300026557 | Vadose Zone Soil | GDISIPASLVNDALQKKLAEQHDRLKLPDSVGGLKVENGELVVLQK |
Ga0209731_10773692 | 3300027326 | Forest Soil | NPALQKKLAEQRDRLKLPDNVGNLKVENSQLVMQQK |
Ga0209622_10669471 | 3300027502 | Forest Soil | NVPVSLVNPALQKKLGEERDRLKLPDGVGGLKVENGQLVMQGK |
Ga0209525_10180831 | 3300027575 | Forest Soil | KVGDLDIPVSLVKPALEKKMQDERDRLKLPDYVGDVKVKDSELVMTQK |
Ga0209733_11177111 | 3300027591 | Forest Soil | VNPALQKKLAEQRDRMKLPDFVGEVKVNNSELVMTEK |
Ga0209528_10586463 | 3300027610 | Forest Soil | DALQKKLNEQRDRLKLPENVGGMKVENGELVMTQK |
Ga0208565_12248292 | 3300027662 | Peatlands Soil | DALQKKLSEQRDRLKLPDNVDGIKVENGELVITQR |
Ga0207826_11344531 | 3300027680 | Tropical Forest Soil | VNDQLQKKLLEHRDRLKLPDSVGGVKVEKGELVLSNK |
Ga0209274_100367821 | 3300027853 | Soil | VGDLDIPVSLVKPALEKKMQDERDRLKLPDYVGDVKVKDSELVMTQK |
Ga0209167_100152877 | 3300027867 | Surface Soil | LVNDALQKKLSEQRDHLKLPDDVGGIRVENGELVMTQR |
Ga0209167_104540312 | 3300027867 | Surface Soil | LSVPVSLVNPALQKKLAEQRDQMRLPDNVGELKVQNGELVMQQK |
Ga0209579_102749241 | 3300027869 | Surface Soil | NIPVSLVNGPLQKKLDEQRDKLKLPDDVGGIKVENGELVMTGK |
Ga0209275_100725511 | 3300027884 | Soil | VPVSLVNPALQKKLAEQRDRLKLPENVGAMKVENSELVMQQK |
Ga0209415_107039781 | 3300027905 | Peatlands Soil | SLVNDALQKRLTEQRDRLKLPDNVDGIKVENGELVMTGK |
Ga0209583_107560571 | 3300027910 | Watersheds | VNDALQKRLSEQRDRLKLPDNVGGMKVENGELVMTQK |
Ga0209698_102526034 | 3300027911 | Watersheds | PALQKKLAEQRDRLKLPDGVGNMKVENGELVMQGK |
Ga0302303_103076962 | 3300028776 | Palsa | VSLVNPALQKKLAEQRDRLKLPENVGGVKVQNGELVMQGK |
Ga0265338_100152498 | 3300028800 | Rhizosphere | INVPVSLVNPALQKKLAEERDRLKLPGNVGNLKIENSQLVMQQK |
Ga0307312_109447381 | 3300028828 | Soil | VPVSLVNDALQKKLNGQRDRLKLPDNVGGMKVENGELVMTQK |
Ga0302278_104385271 | 3300028866 | Bog | VPVSLVNDALQKKLGEQRDKLKLPDNVGGFKVENGEMVLTQR |
Ga0222749_100733943 | 3300029636 | Soil | PVSLVNDALQKKLNEQRDRLRLPDNVGGMKVENGELVMTQK |
Ga0302184_101878502 | 3300030490 | Palsa | VSLVNPALQKKLAEQHDRLKLPDYVGDVKVQNGELVMQQK |
Ga0316363_102201432 | 3300030659 | Peatlands Soil | LVNPALQKKLAEERDRLKLPNNVGAMKVENGELVMQQK |
Ga0310038_100891892 | 3300030707 | Peatlands Soil | SLVNPALQKKLAEQRDRLKLPDNVGAMKVQNGELVMQQK |
Ga0170824_1263562861 | 3300031231 | Forest Soil | LVNPALQKKLAEQRDRLKLPDYVGDVKVQGGELVMQQK |
Ga0302307_105252271 | 3300031233 | Palsa | KPALEKKMQEERDRLKLPDYVGDVKVKDSELVMTQK |
Ga0170818_1005917862 | 3300031474 | Forest Soil | NVPVSLVNPALQKKLAEQHDRMKLPDYVGDVRVQNGELVMQQK |
Ga0307509_107538861 | 3300031507 | Ectomycorrhiza | DALQKKLSEQKDRLKLPDNVGGMKVENGELVMTQK |
Ga0310686_1002828022 | 3300031708 | Soil | PVSLVNPTLQKKLVEQRDQLKLPDYVGDVRVQNGELVMQQK |
Ga0307469_107327191 | 3300031720 | Hardwood Forest Soil | FKVGDLSVPVSLVNPALQKKLGEQRDRLKLPDFVGDVKVQNGELVMQQK |
Ga0306918_102687842 | 3300031744 | Soil | DLDIPTSLVNGALQKRLTEQRDRLKLPDDVGSIRVENGELVMTQK |
Ga0307475_109521871 | 3300031754 | Hardwood Forest Soil | VSLVNDQLQKRLLEQRDRLKLPDNVGGLRVENGEVVMTNK |
Ga0307478_105738891 | 3300031823 | Hardwood Forest Soil | LNVPVSLVNPALQKKLAEQRDRLKLPDGVGTMKVENGELVMQGK |
Ga0318520_101982432 | 3300031897 | Soil | SLVNDQLQKKLLEQRDRLKLPDSVRDLKVENSEVVVSK |
Ga0307479_100817041 | 3300031962 | Hardwood Forest Soil | SLVNDSLQKRLAEQRDRMKLPDNVGGIKVENGELVMTQR |
Ga0307479_102651512 | 3300031962 | Hardwood Forest Soil | TEFKVGDLSVPVSLVNPTLQKRLAEQRDRLKLPDYVGDVKVQNGELVMQQK |
Ga0318563_104229532 | 3300032009 | Soil | IGDLEVPVSLVNDQLQKRLAEQRDRLKLPDGVGGIKVENGQVVLTNK |
Ga0318506_104843732 | 3300032052 | Soil | VNDQLQKRLAEQRDRLKLPDGVGGIKVENGQVVLTNK |
Ga0307470_101573261 | 3300032174 | Hardwood Forest Soil | RVSLVNDQLQKKLLEQRDQLKLPDSVGGLKVENGEVVVTNK |
Ga0307472_1019839482 | 3300032205 | Hardwood Forest Soil | VPVSLVNPALQKKLDGQRDRMKLPDFVGDVKVNNSELVMTEK |
Ga0335079_101101571 | 3300032783 | Soil | VSLVNEPLQKRLAEQHDRLKLPDNVGGIKVENGELVLTQK |
Ga0335080_107851073 | 3300032828 | Soil | VNPALQKKLAEERDRLKLPDNVGNLKVENSQLVMQQK |
Ga0335080_109812302 | 3300032828 | Soil | NVPVSLVNPALQKKLSEERDRLKLPDNVGNLKVENSQLVMQQK |
Ga0335070_104995502 | 3300032829 | Soil | LVNDALQRKLSEQRDRLKLPDNVDGMKIENGELVLKQR |
Ga0335075_112419001 | 3300032896 | Soil | PVSLINPALQKKLAEQRDRLKLPDNVGDVKVQGGELVMQQK |
Ga0335076_1000112119 | 3300032955 | Soil | DLSVPVSLVNPALQKKLAEQKDRLKLPDNVGSMKVENGELVMQQK |
Ga0335076_110357381 | 3300032955 | Soil | QALQKRLAEQHDRLKLPDNVGGIKVENGELVLTQK |
Ga0335077_102379713 | 3300033158 | Soil | LVNDALQQKLSEQRDRLKLPDNVGGIRVENGELVMTQK |
Ga0310914_117597061 | 3300033289 | Soil | SLVNDQLQKKLLEQRDRLKLPDSINGIKVENGEVVLSNK |
Ga0314866_007702_1239_1352 | 3300033807 | Peatland | VNPALQKKLGEERDRLKLPDNVGGVKVENGELVMQQK |
Ga0370492_0230636_644_751 | 3300034282 | Untreated Peat Soil | PALQKKMAEQRDRMKLPDYVGGMKVENGQLVMQQK |
Ga0370492_0245793_14_142 | 3300034282 | Untreated Peat Soil | VPVSLVNPALQKRLAEQRDRMKLPDNVGDMKVENGQLVMQQK |
⦗Top⦘ |