NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034097

Metagenome / Metatranscriptome Family F034097

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034097
Family Type Metagenome / Metatranscriptome
Number of Sequences 175
Average Sequence Length 44 residues
Representative Sequence MKPEDWAKKYAAMDKRIDLKYQQLAKGEQIGKRPEAPKPEAKKS
Number of Associated Samples 139
Number of Associated Scaffolds 175

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.86 %
% of genes near scaffold ends (potentially truncated) 13.14 %
% of genes from short scaffolds (< 2000 bps) 87.43 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.714 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(15.429 % of family members)
Environment Ontology (ENVO) Unclassified
(33.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(32.571 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 2.78%    Coil/Unstructured: 72.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 175 Family Scaffolds
PF00384Molybdopterin 11.43
PF00890FAD_binding_2 6.29
PF04909Amidohydro_2 5.14
PF04879Molybdop_Fe4S4 4.00
PF00355Rieske 2.29
PF00856SET 1.71
PF02627CMD 1.14
PF00892EamA 1.14
PF13744HTH_37 1.14
PF01568Molydop_binding 1.14
PF00596Aldolase_II 0.57
PF00848Ring_hydroxyl_A 0.57
PF01712dNK 0.57
PF00691OmpA 0.57
PF13649Methyltransf_25 0.57
PF12974Phosphonate-bd 0.57
PF01070FMN_dh 0.57
PF01814Hemerythrin 0.57
PF04892VanZ 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 175 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 1.14
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 1.14
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 1.14
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.57
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.57
COG1428Deoxyadenosine/deoxycytidine kinaseNucleotide transport and metabolism [F] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.71 %
UnclassifiedrootN/A6.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c1810690All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria598Open in IMG/M
3300000550|F24TB_14020001All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria644Open in IMG/M
3300000891|JGI10214J12806_13058039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria947Open in IMG/M
3300000956|JGI10216J12902_102169742All Organisms → cellular organisms → Bacteria1987Open in IMG/M
3300000956|JGI10216J12902_103742282All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1190Open in IMG/M
3300003319|soilL2_10160641All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300003319|soilL2_10320925All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300004019|Ga0055439_10296342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria534Open in IMG/M
3300004022|Ga0055432_10098440All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300004024|Ga0055436_10078858All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria938Open in IMG/M
3300004024|Ga0055436_10159465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria692Open in IMG/M
3300004049|Ga0055493_10055050All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300004067|Ga0055485_10169421All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300004114|Ga0062593_100203900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1578Open in IMG/M
3300004145|Ga0055489_10040949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1209Open in IMG/M
3300004463|Ga0063356_101692621All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium945Open in IMG/M
3300004463|Ga0063356_102551402All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium784Open in IMG/M
3300004463|Ga0063356_103672450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria661Open in IMG/M
3300004643|Ga0062591_100408812All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300004778|Ga0062383_10096923All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300004781|Ga0062379_10220411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300004808|Ga0062381_10421056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300005295|Ga0065707_10757381All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria616Open in IMG/M
3300005331|Ga0070670_100938307All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria785Open in IMG/M
3300005336|Ga0070680_101820820All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria528Open in IMG/M
3300005341|Ga0070691_10971197All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria528Open in IMG/M
3300005441|Ga0070700_100098825All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1919Open in IMG/M
3300005450|Ga0066682_10164160All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1417Open in IMG/M
3300005518|Ga0070699_102094524All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium517Open in IMG/M
3300005829|Ga0074479_10761141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300005836|Ga0074470_10090447All Organisms → cellular organisms → Bacteria3128Open in IMG/M
3300005836|Ga0074470_10217736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5834Open in IMG/M
3300005836|Ga0074470_10255448All Organisms → cellular organisms → Bacteria1919Open in IMG/M
3300005836|Ga0074470_10881863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium587Open in IMG/M
3300006845|Ga0075421_101015584All Organisms → cellular organisms → Bacteria → Proteobacteria938Open in IMG/M
3300006845|Ga0075421_101567863All Organisms → cellular organisms → Bacteria → Proteobacteria717Open in IMG/M
3300006894|Ga0079215_10085622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1343Open in IMG/M
3300006969|Ga0075419_10485343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria857Open in IMG/M
3300007258|Ga0099793_10677161Not Available520Open in IMG/M
3300009053|Ga0105095_10252710All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300009053|Ga0105095_10422506All Organisms → cellular organisms → Bacteria → Proteobacteria736Open in IMG/M
3300009053|Ga0105095_10784949Not Available533Open in IMG/M
3300009078|Ga0105106_10095559All Organisms → cellular organisms → Bacteria → Proteobacteria2187Open in IMG/M
3300009078|Ga0105106_10304773Not Available1153Open in IMG/M
3300009087|Ga0105107_10459128All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300009087|Ga0105107_10706633All Organisms → cellular organisms → Bacteria → Proteobacteria701Open in IMG/M
3300009091|Ga0102851_12473843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300009100|Ga0075418_11140386All Organisms → cellular organisms → Bacteria → Proteobacteria844Open in IMG/M
3300009147|Ga0114129_11088659All Organisms → cellular organisms → Bacteria → Proteobacteria1001Open in IMG/M
3300009147|Ga0114129_11777060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria750Open in IMG/M
3300009156|Ga0111538_11990322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria731Open in IMG/M
3300009162|Ga0075423_10045886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4489Open in IMG/M
3300009171|Ga0105101_10633232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300009553|Ga0105249_10717517All Organisms → cellular organisms → Bacteria → Proteobacteria1061Open in IMG/M
3300009609|Ga0105347_1015886All Organisms → cellular organisms → Bacteria2568Open in IMG/M
3300009609|Ga0105347_1323030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria653Open in IMG/M
3300009610|Ga0105340_1012408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3359Open in IMG/M
3300009678|Ga0105252_10000016All Organisms → cellular organisms → Bacteria184907Open in IMG/M
3300009678|Ga0105252_10531026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300009678|Ga0105252_10604616All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300009777|Ga0105164_10642848All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300010391|Ga0136847_10321205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria831Open in IMG/M
3300010400|Ga0134122_10600026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1017Open in IMG/M
3300011406|Ga0137454_1066881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300011414|Ga0137442_1075179All Organisms → cellular organisms → Bacteria → Proteobacteria714Open in IMG/M
3300011417|Ga0137326_1061502All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300011420|Ga0137314_1099600All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300011421|Ga0137462_1101461All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium683Open in IMG/M
3300011427|Ga0137448_1126805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium700Open in IMG/M
3300011437|Ga0137429_1083088All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria961Open in IMG/M
3300011438|Ga0137451_1060153All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300011441|Ga0137452_1088473All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300011441|Ga0137452_1252030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300012040|Ga0137461_1001325All Organisms → cellular organisms → Bacteria5040Open in IMG/M
3300012040|Ga0137461_1133174All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium724Open in IMG/M
3300012041|Ga0137430_1174973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300012133|Ga0137329_1007759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1116Open in IMG/M
3300012929|Ga0137404_10156532All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1900Open in IMG/M
3300014262|Ga0075301_1067669All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria721Open in IMG/M
3300014262|Ga0075301_1153405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria538Open in IMG/M
3300014269|Ga0075302_1105384All Organisms → cellular organisms → Bacteria → Proteobacteria640Open in IMG/M
3300014297|Ga0075306_1116157Not Available526Open in IMG/M
3300014312|Ga0075345_1031047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1044Open in IMG/M
3300014326|Ga0157380_11074919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium842Open in IMG/M
3300014865|Ga0180078_1012277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1209Open in IMG/M
3300014871|Ga0180095_1108873All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300014872|Ga0180087_1035062All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria925Open in IMG/M
3300014877|Ga0180074_1038008Not Available996Open in IMG/M
3300014882|Ga0180069_1138967All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium591Open in IMG/M
3300014883|Ga0180086_1082829All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium802Open in IMG/M
3300015201|Ga0173478_10447515All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300015374|Ga0132255_104827969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria571Open in IMG/M
3300017939|Ga0187775_10019528All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1838Open in IMG/M
3300017966|Ga0187776_10090201All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1809Open in IMG/M
3300018028|Ga0184608_10256432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria770Open in IMG/M
3300018031|Ga0184634_10281552Not Available763Open in IMG/M
3300018053|Ga0184626_10093330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1274Open in IMG/M
3300018056|Ga0184623_10402484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria602Open in IMG/M
3300018063|Ga0184637_10060871All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2307Open in IMG/M
3300018071|Ga0184618_10233864All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria775Open in IMG/M
3300018077|Ga0184633_10096633All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1525Open in IMG/M
3300018077|Ga0184633_10405006All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria681Open in IMG/M
3300018078|Ga0184612_10029154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2850Open in IMG/M
3300018079|Ga0184627_10137271All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1295Open in IMG/M
3300018083|Ga0184628_10022024All Organisms → cellular organisms → Bacteria → Proteobacteria3144Open in IMG/M
3300018083|Ga0184628_10038510All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2399Open in IMG/M
3300018084|Ga0184629_10049398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1912Open in IMG/M
3300018084|Ga0184629_10187977All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1063Open in IMG/M
3300018084|Ga0184629_10439832Not Available683Open in IMG/M
3300018084|Ga0184629_10495095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria637Open in IMG/M
3300018422|Ga0190265_10306260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1661Open in IMG/M
3300018429|Ga0190272_10521880All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1016Open in IMG/M
3300018432|Ga0190275_10024846All Organisms → cellular organisms → Bacteria → Proteobacteria4720Open in IMG/M
3300018469|Ga0190270_10033117All Organisms → cellular organisms → Bacteria3392Open in IMG/M
3300018469|Ga0190270_10512544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1146Open in IMG/M
3300018469|Ga0190270_11556408All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium712Open in IMG/M
3300018469|Ga0190270_13401105All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300018476|Ga0190274_10162952All Organisms → cellular organisms → Bacteria → Proteobacteria1904Open in IMG/M
3300018476|Ga0190274_11525698All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300018476|Ga0190274_11692039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria726Open in IMG/M
3300018481|Ga0190271_10457798All Organisms → cellular organisms → Bacteria → Proteobacteria1381Open in IMG/M
3300018482|Ga0066669_10242633All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1418Open in IMG/M
3300018920|Ga0190273_11323306All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300019874|Ga0193744_1048285All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria814Open in IMG/M
3300019881|Ga0193707_1055826All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1250Open in IMG/M
3300019884|Ga0193741_1043854All Organisms → cellular organisms → Bacteria → Proteobacteria1154Open in IMG/M
3300020027|Ga0193752_1237273All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria674Open in IMG/M
3300020034|Ga0193753_10363386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria596Open in IMG/M
3300020061|Ga0193716_1002854All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria9632Open in IMG/M
3300021051|Ga0206224_1008542All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1111Open in IMG/M
3300021051|Ga0206224_1057418All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300021081|Ga0210379_10019898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2533Open in IMG/M
3300021332|Ga0210339_1445019All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300022208|Ga0224495_10140918All Organisms → cellular organisms → Bacteria → Terrabacteria group1034Open in IMG/M
3300022209|Ga0224497_10028955All Organisms → cellular organisms → Bacteria2490Open in IMG/M
3300024241|Ga0233392_1010152All Organisms → cellular organisms → Bacteria → Proteobacteria881Open in IMG/M
3300025324|Ga0209640_10326153All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1278Open in IMG/M
3300025953|Ga0210068_1019093All Organisms → cellular organisms → Bacteria → Proteobacteria975Open in IMG/M
3300025971|Ga0210102_1012739All Organisms → cellular organisms → Bacteria1786Open in IMG/M
3300026095|Ga0207676_11954734All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria585Open in IMG/M
3300026320|Ga0209131_1135342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1264Open in IMG/M
3300027573|Ga0208454_1000020All Organisms → cellular organisms → Bacteria146887Open in IMG/M
3300027731|Ga0209592_1279735All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300027778|Ga0209464_10052601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1341Open in IMG/M
3300027815|Ga0209726_10017289All Organisms → cellular organisms → Bacteria6408Open in IMG/M
3300027815|Ga0209726_10318662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium752Open in IMG/M
3300027815|Ga0209726_10324417All Organisms → cellular organisms → Bacteria → Proteobacteria743Open in IMG/M
3300027818|Ga0209706_10484189Not Available567Open in IMG/M
3300027831|Ga0209797_10068640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1565Open in IMG/M
3300027840|Ga0209683_10106310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1271Open in IMG/M
3300027843|Ga0209798_10073928All Organisms → cellular organisms → Bacteria1755Open in IMG/M
3300027843|Ga0209798_10156507Not Available1140Open in IMG/M
3300027909|Ga0209382_11096727All Organisms → cellular organisms → Bacteria → Proteobacteria822Open in IMG/M
3300027909|Ga0209382_11250670All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria756Open in IMG/M
3300028145|Ga0247663_1086747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria561Open in IMG/M
3300028381|Ga0268264_12211481All Organisms → cellular organisms → Bacteria558Open in IMG/M
(restricted) 3300031248|Ga0255312_1117733All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300031548|Ga0307408_100456702All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1109Open in IMG/M
3300031716|Ga0310813_10217558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1575Open in IMG/M
3300031852|Ga0307410_10175447All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1619Open in IMG/M
3300031965|Ga0326597_10001635All Organisms → cellular organisms → Bacteria35744Open in IMG/M
3300032144|Ga0315910_10616686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium841Open in IMG/M
3300032157|Ga0315912_10737218Not Available785Open in IMG/M
3300032157|Ga0315912_10910543All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium699Open in IMG/M
3300032163|Ga0315281_10315775All Organisms → cellular organisms → Bacteria1703Open in IMG/M
3300033408|Ga0316605_10456738All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300033419|Ga0316601_100027086All Organisms → cellular organisms → Bacteria → Proteobacteria3913Open in IMG/M
3300033433|Ga0326726_10092025All Organisms → cellular organisms → Bacteria → Proteobacteria2701Open in IMG/M
3300033485|Ga0316626_12180860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria503Open in IMG/M
3300033815|Ga0364946_105037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria630Open in IMG/M
3300034115|Ga0364945_0107620All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium819Open in IMG/M
3300034149|Ga0364929_0264002All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300034155|Ga0370498_039795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1030Open in IMG/M
3300034177|Ga0364932_0114587Not Available1024Open in IMG/M
3300034257|Ga0370495_0167491All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium701Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil15.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment9.14%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.71%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.14%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment4.57%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.86%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.86%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.29%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater1.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.71%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.71%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment1.71%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.71%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.14%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.14%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.14%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.14%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.14%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.14%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.14%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.14%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.57%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.57%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.57%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.57%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.57%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.57%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.57%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.57%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.57%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.57%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004049Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2EnvironmentalOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004781Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2FreshEnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012133Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300014297Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014312Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014865Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10DEnvironmentalOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019874Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020027Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300021051Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021332Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022208Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022209Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13EnvironmentalOpen in IMG/M
3300024241Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PBEnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025953Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025971Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300027731Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034257Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_181069023300000033SoilMSQEDWVKKYAAMDQRLMLXYEHXPXGEQVGKXPXLPKPEAKKS*
F24TB_1402000123300000550SoilMKPTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKKS*
JGI10214J12806_1305803923300000891SoilMSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS*
JGI10216J12902_10216974223300000956SoilMSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPDLPKSEAKKS*
JGI10216J12902_10374228213300000956SoilLLPVEHFRTLSMQPEDWAKKYAAMDKPIDLKYQQLAKGEQIGKRPEAPKPPPKKS*
soilL2_1016064123300003319Sugarcane Root And Bulk SoilMSGDWAKKYAAMDQRLLLKYQQLPQGEQVGKKVQALAPEARD*
soilL2_1032092523300003319Sugarcane Root And Bulk SoilMSRVDWAKKYAAMDQRLSLKYEQLPRGEQIGKKAPEVKPAKKEAWQTTTRSAAR*
Ga0055439_1029634223300004019Natural And Restored WetlandsMSQEDWAKKYAAMDKRLMLKYEQLPQGEQIGKQPELAKSEAKKC*
Ga0055432_1009844013300004022Natural And Restored WetlandsMKPEDWARKYAAMDKRIELKYQQLAKGEQIGKRPEAPKSEAKKS*
Ga0055436_1007885823300004024Natural And Restored WetlandsMSQEDWAKKYAAMDQRLTLKYEQLPKGEQIGKKPEWPKTEAKKC*
Ga0055436_1015946523300004024Natural And Restored WetlandsMSQEDWAKKYAAMDQRLTLIYEQLPKGEQIGKKSERPQMEAKKCSSSAS*
Ga0055493_1005505023300004049Natural And Restored WetlandsMKSEDWAKKYEAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS*
Ga0055485_1016942113300004067Natural And Restored WetlandsMSREDWARKYAAMDKRLMLKYEQLPSGEQVGKKPKMAQSNGKQS*
Ga0062593_10020390033300004114SoilMKPTDWVKKYAAMDKRVELKYQHLPNGEQIGKRPEAPKSEAKKS*
Ga0055489_1004094923300004145Natural And Restored WetlandsMSREDWARKYAAMDKRLMLKYEQQPSGEQVGKKPKIAQSDGKKS*
Ga0063356_10169262133300004463Arabidopsis Thaliana RhizosphereRLSMNPTDWAKKYAAMNKRVGLKYQHLPKGEQIGKRPAMPKPDANKS*
Ga0063356_10255140223300004463Arabidopsis Thaliana RhizosphereMKPTDWVKKYAAMDKRVELRYLHLPKGEQIGKRPAAPKPEVKKS*
Ga0063356_10367245023300004463Arabidopsis Thaliana RhizosphereMSQEDWVKKYAAMDQRLMLKYEHLPKGEQVGKKPELPKPEAK
Ga0062591_10040881223300004643SoilMSQEDWVKKYAAMDQRLMLKYEHLPKGEQVGKKPELPKPEAKKS*
Ga0062383_1009692323300004778Wetland SedimentMKPTDWVKKYSAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS*
Ga0062379_1022041113300004781Wetland SedimentWVKKYSAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS*
Ga0062381_1042105623300004808Wetland SedimentMKPTDWVKKYAAMDKRVDLKYQFLPKGEQIGKRPEAPKPNAKKS*
Ga0065707_1075738123300005295Switchgrass RhizosphereMSQEDWAKKYAAMDKRLMIKYEHLPKGEQIGKKPELPLKEAKKS*
Ga0070670_10093830723300005331Switchgrass RhizosphereMKSTDWAKKYAAMDKRVGLKYQYLPKGEQVGKRPFAPQAAAKKA*
Ga0070680_10182082023300005336Corn RhizosphereQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS*
Ga0070691_1097119713300005341Corn, Switchgrass And Miscanthus RhizosphereMMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPELPKQEPKKS*
Ga0070700_10009882523300005441Corn, Switchgrass And Miscanthus RhizosphereMNQIDWAKKYAAMERRVTLKYQQLPKGEQIGKRLEAEAPKTKKS*
Ga0066682_1016416033300005450SoilMSDEDWATKYAAMNGRVTQKYEHLPKGEQIGKRPEAKPQ*
Ga0070699_10209452413300005518Corn, Switchgrass And Miscanthus RhizosphereMSQEDWAKKYAAMDQRLLLKYEHLPNGEQIGKKPELPKPEAKKT*
Ga0074479_1076114123300005829Sediment (Intertidal)MKPEDWARKYAAMDKRVGLKYQFLPKGEQTGKRPEAPKPEAKKP*
Ga0074470_1009044723300005836Sediment (Intertidal)MKPTDWVKKYAAMDKRVGLKYQHLPKGEQIGKPPDAPKPQAK*
Ga0074470_1021773683300005836Sediment (Intertidal)MSQEDWAKKYAAMDQRLTLKYEQLPRGEQIGKKPEPPNTEAKKCK
Ga0074470_1025544833300005836Sediment (Intertidal)MKPTDWVKKYAAMDKRVELKYQHLPKGEQIGKRPDAPEPQAK*
Ga0074470_1088186323300005836Sediment (Intertidal)MKPTDWVKKYAAMDKRVALKYQHLPKGEQIGKRPDAPKPQTK*
Ga0075421_10101558423300006845Populus RhizosphereMSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKSEAKKS*
Ga0075421_10156786323300006845Populus RhizosphereMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEPPKPEAKKS*
Ga0079215_1008562223300006894Agricultural SoilMSQTDWAKIYAVMDKRVELKYAQLPKGEQIGERPALVKAQVKKS*
Ga0075419_1048534313300006969Populus RhizosphereMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEPPKPEATKS*
Ga0099793_1067716113300007258Vadose Zone SoilDEDWATKYAAMNGRVTQKYEHLPKGEQIGKRPEAKPQ*
Ga0105095_1025271023300009053Freshwater SedimentMKPVDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPEAKKS*
Ga0105095_1042250613300009053Freshwater SedimentMEVSTMSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQTGKAEQKAF*
Ga0105095_1078494923300009053Freshwater SedimentMKAENWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAAKPEAKKS*
Ga0105106_1009555913300009078Freshwater SedimentKKYAAMDKRVDLKYQHLPNGEQIGKRPEAPKPQAK*
Ga0105106_1030477313300009078Freshwater SedimentMKPEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPDAKKS*
Ga0105107_1045912823300009087Freshwater SedimentMKAEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPDAKKS*
Ga0105107_1070663323300009087Freshwater SedimentMEVSTMSQTDWAKKYAAMDKRIVLKYEQLPNGEQVGKRPQTGKAEQKAF*
Ga0102851_1247384323300009091Freshwater WetlandsMKSEDWAKKYAAMDKRVDLKYQHLPKGEQIGKRPEAPKPQAK*
Ga0075418_1114038623300009100Populus RhizosphereMMSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKSEAKKS*
Ga0114129_1108865923300009147Populus RhizosphereMMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEPPKPEAKKS*
Ga0114129_1177706023300009147Populus RhizosphereMMSQEDWAKKYAAMDQRLLLKYEHLPNGEQIGKKPELPKPETKKV*
Ga0111538_1199032223300009156Populus RhizosphereMMSQEDWANKYAAMDQRLLLKYEHLPDGEQIGKKPELSKPETKKA*
Ga0075423_1004588633300009162Populus RhizosphereMMSQEDWAKKYAAMDQRLLLKYEHLPDGEQIGKKPELSKPETKKA*
Ga0105101_1063323213300009171Freshwater SedimentSMKPVDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPEAKKS*
Ga0105249_1071751723300009553Switchgrass RhizosphereMMSQEDWAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS*
Ga0105347_101588613300009609SoilMKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKPPEAPKAAAKKS*
Ga0105347_132303023300009609SoilMSQEDWAKKYAAMDRRLMLKYEHLPKGEQIGKKPVSPKPEGKKS*
Ga0105340_101240823300009610SoilMKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKAAAKKS*
Ga0105252_100000161323300009678SoilMGQEDWAKKYAAMDPRLMLKYEQLPKGEQIGKKPMAPKTPVKKS*
Ga0105252_1053102623300009678SoilMKTEDWAKEYAAMDKRVDLKYQHLPNGEQIGKRPAAPKPNAKKS*
Ga0105252_1060461623300009678SoilMKAEDWAKKYAAMDKRVDLKYQHLPKGEQIGKRPEAPNPQAK*
Ga0105164_1064284823300009777WastewaterMKPEDWAKKYAAMDKRIDLKYQQLAKGEQIGKRPEAPKPDTKKS*
Ga0136847_1032120523300010391Freshwater SedimentMSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKTELSTADVKKS*
Ga0134122_1060002623300010400Terrestrial SoilMKPEDWVKKYAAMDKRVGLKYQYLPKGEQIGKRSEPPKSEAKKS*
Ga0137454_106688113300011406SoilMKPADWAKKYAAMDKRLLLKYQYLPKGEQIGKKPAAPNPTAKKS*
Ga0137442_107517913300011414SoilMSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPTSAQPASKKA*
Ga0137326_106150213300011417SoilMKSEDWAKKYAAMDKRIELKYQQLAKAEQIGKRPEAPKAAAKKS*
Ga0137314_109960023300011420SoilMKTEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPAAPKPNAKKS*
Ga0137462_110146123300011421SoilMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPESPKPAAKKS*
Ga0137448_112680523300011427SoilLSMKPQDWAKKYAAMDKRVGLKYQHLPKGEQIGKRPETPKPATKIS*
Ga0137429_108308833300011437SoilMSQEDWAKKYAAMDKRLMLKYQQLPKGEQIGKKPASPKPEGKKS*
Ga0137451_106015323300011438SoilMKPEDWAKKYAVMDKRIDLKYQQLAKGEQIGKRPEAPKPAAKKS*
Ga0137452_108847323300011441SoilMKTEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPQAK*
Ga0137452_125203013300011441SoilYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS*
Ga0137461_100132553300012040SoilMSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKRPELPKQELKKS*
Ga0137461_113317413300012040SoilMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPETPKPATKKS*
Ga0137430_117497323300012041SoilMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPNPQAK*
Ga0137329_100775923300012133SoilMSQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPVSPKPEGKKS*
Ga0137404_1015653213300012929Vadose Zone SoilMSDEDWATKYAAMNGRVPQKYEHLPNGEQIGKRPEAKPQ*
Ga0075301_106766923300014262Natural And Restored WetlandsMSQEDWAKRYAAMDQRLTLKYEQLPKGEQIGKKPEVPETEAKKCSSFAS*
Ga0075301_115340513300014262Natural And Restored WetlandsMSQENWAKKYAAMDKRLMLKYEQLPKGEQIGKKPVPAKSEANKS*
Ga0075302_110538423300014269Natural And Restored WetlandsMSQEDWAKRYAAMDQRSTLKYEQLPKGKQIGKKPELPETEAKKCSSFAS*
Ga0075306_111615713300014297Natural And Restored WetlandsMKPTDWVKKYAAMDKQVELKFLYLPKGEQIGKRPVAPKPDAKKSY
Ga0075345_103104723300014312Natural And Restored WetlandsMKSDNWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS*
Ga0157380_1107491923300014326Switchgrass RhizosphereMKPTDWVKKYAAMDKRVELKYQHLPKGEQIGKRLAAPTADVKKS*
Ga0180078_101227723300014865SoilMKSEDWAKKYAAMDKRIELKYQQLAKGEQNGKRPEAPKPAAKKS*
Ga0180095_110887313300014871SoilKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS*
Ga0180087_103506223300014872SoilMSQEDWAKNYAAMDKRLMLKYEHLPKGEQIGKKPEAPKREATNS*
Ga0180074_103800823300014877SoilMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS*
Ga0180069_113896723300014882SoilMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKV*
Ga0180086_108282913300014883SoilMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPAAPKPEAKKS*
Ga0173478_1044751513300015201SoilMKSTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKKS*
Ga0132255_10482796923300015374Arabidopsis RhizosphereMSQIDWAKKYAIMDKRLMLKYEYLPKGEQVGKKPQLPKPEAKKS*
Ga0187775_1001952833300017939Tropical PeatlandMSQEDWVKKYAAMDKRLMLKYEHLPKGEQIGKKPVQPKQGETKSSQAERLR
Ga0187776_1009020133300017966Tropical PeatlandMSQEDWVKKYAAMDKRLMLKYEHLPKGEQIGKKPVQPKQG
Ga0184608_1025643223300018028Groundwater SedimentMSQIDWAKKYAAMDRRVTLKYQQVPKGEQIGKRLEAEAPKTKKS
Ga0184634_1028155223300018031Groundwater SedimentMSQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPDLPKHELKKS
Ga0184626_1009333023300018053Groundwater SedimentMSQVDWAKKYAAMDKRLMLKYEHLPNGEQICKKPVALKTEVKKS
Ga0184623_1040248423300018056Groundwater SedimentMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPLPKPTA
Ga0184637_1006087143300018063Groundwater SedimentMSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPKLPKQE
Ga0184618_1023386423300018071Groundwater SedimentMTQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS
Ga0184633_1009663333300018077Groundwater SedimentMSQEDWAKKYAAMDKRLMLKYEQLPKGEQIVRKPELPKQEAKKS
Ga0184633_1040500623300018077Groundwater SedimentMSQVDWVKKYAAMEKQLMLKYEHLPKGEQIGKKPELAKQEAKKP
Ga0184612_1002915423300018078Groundwater SedimentMSQVDWAKKYAAMDKRLMLKYEQLPNGEQIGKKPVALKTEAKKS
Ga0184627_1013727123300018079Groundwater SedimentMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEAPKSEAKQS
Ga0184628_1002202423300018083Groundwater SedimentMKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS
Ga0184628_1003851023300018083Groundwater SedimentMSQEDWAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS
Ga0184629_1004939823300018084Groundwater SedimentMSQEDWAKKYAAMDKRLMLKYQQLPKGEQIGKKPVPQKSEGKKS
Ga0184629_1018797723300018084Groundwater SedimentMKPEDWAKKYAAMDKRIDLKYQQLAKGEQIGKRPEAPKPEAKKS
Ga0184629_1043983213300018084Groundwater SedimentMSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKRPELPKQELKKS
Ga0184629_1049509513300018084Groundwater SedimentMSQEDWAKKYAAMDKRLILKYEQLPKGEQVGKKPVPPAANVKKA
Ga0190265_1030626023300018422SoilMQPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPDAPKPQPKKS
Ga0190272_1052188023300018429SoilMNQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS
Ga0190275_1002484643300018432SoilMQPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPDAPKTQPKKS
Ga0190270_1003311743300018469SoilMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPQLPKSEAKKS
Ga0190270_1051254423300018469SoilMKPEDWAKKYAAMDKRIELKYQQLAKGEQNGKRPEAPKPAAKKS
Ga0190270_1155640823300018469SoilMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEASKPTAKKS
Ga0190270_1340110523300018469SoilYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS
Ga0190274_1016295233300018476SoilMKPTDWVKKYAAMDTRVELKYQHLPKGEQIGKRPAAPKPEVKKS
Ga0190274_1152569823300018476SoilMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPPPKKS
Ga0190274_1169203913300018476SoilMKSTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKNS
Ga0190271_1045779823300018481SoilMKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKAAAKKS
Ga0066669_1024263333300018482Grasslands SoilMSDEDWATKYAAMNGRVTQKYEHLPKGEQIGKRPEAKPQ
Ga0190273_1132330623300018920SoilMQPEDWAKKYAAMDKRIEIKYQQLAKGEQIGKRPDAPKPQPKKA
Ga0193744_104828513300019874SoilMSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKA
Ga0193707_105582623300019881SoilMSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS
Ga0193741_104385423300019884SoilMSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKPEAKKS
Ga0193752_123727313300020027SoilKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS
Ga0193753_1036338623300020034SoilMSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKHLEAEAPEAKKS
Ga0193716_1002854113300020061SoilMSQFDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS
Ga0206224_100854223300021051Deep Subsurface SedimentMSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPQPQKTEAKKS
Ga0206224_105741823300021051Deep Subsurface SedimentMKPEDWAKKYAAMDKRIALKYQLLAKGEQIGKRPAAPKPEAKKS
Ga0210379_1001989823300021081Groundwater SedimentMSQEDWAKKYAAMDRRLMLKYEHLPKGEQIGKKPVSPKPEGKKS
Ga0210339_144501923300021332EstuarineMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEASKAEAKKS
Ga0224495_1014091823300022208SedimentMKPTDWVKKYAAMDKRVGFKYQFLPKGEQIGKRPEAPKTDAKKS
Ga0224497_1002895523300022209SedimentMNQTDWAKLYAAMDERLVLKYEHLPNGEQIRKRPENPPRPAERKRT
Ga0233392_101015223300024241Deep Subsurface SedimentMSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKSEPANTEAKKS
Ga0209640_1032615333300025324SoilMSQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPMAP
Ga0210068_101909323300025953Natural And Restored WetlandsMKSEDWAKKYEAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS
Ga0210102_101273943300025971Natural And Restored WetlandsRLWMKSEDWAKKYEAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS
Ga0207676_1195473423300026095Switchgrass RhizosphereKKYAAMDRRVTLKYQQLPNGEQIGKRLEAQAPKTKKS
Ga0209131_113534233300026320Grasslands SoilMSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPTPAQPAPKKA
Ga0208454_1000020503300027573SoilMGQEDWAKKYAAMDPRLMLKYEQLPKGEQIGKKPMAPKTPVKKS
Ga0209592_127973523300027731Freshwater SedimentMKPVDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPEAKKS
Ga0209464_1005260123300027778Wetland SedimentMKPADWVKKYAAMDKRVDLKYQFLPKGEQIGKRPEAPKPNAKKS
Ga0209726_1001728963300027815GroundwaterMGQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPELSKLEVKKS
Ga0209726_1031866223300027815GroundwaterMKPEDWAKKYAAMDKRIELKYQQLAKGEQTGKRPEAPKPEAKKS
Ga0209726_1032441713300027815GroundwaterMSQVDWAKKYAAMDKRLLLKYEHLPKGEQIGKKPALPTPEAKKS
Ga0209706_1048418913300027818Freshwater SedimentMKAEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPDAKKS
Ga0209797_1006864033300027831Wetland SedimentVKKNAAMDKRVDLKYQFLPKGEQIGKRPEAPKPDAKKS
Ga0209683_1010631033300027840Wetland SedimentMKPTDWVKKYSAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS
Ga0209798_1007392823300027843Wetland SedimentMKPTDWVKKYAAMDKRVDLKYQFLPKGEQIGKRPEAPKPDAKKS
Ga0209798_1015650713300027843Wetland SedimentMKPTDWVKKYAAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS
Ga0209382_1109672723300027909Populus RhizosphereMSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKSEAKKS
Ga0209382_1125067023300027909Populus RhizosphereMSQEDWAKKYAAMDQRLLLKYEHLPDGEQIGKKPAPAQPEAKKS
Ga0247663_108674713300028145SoilLISDGERKQTMSQVDWAKKYSAMDKRLMLKYEQLPKGEQIGKKPVAVKQETKKV
Ga0268264_1221148123300028381Switchgrass RhizosphereMSQEDSAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS
(restricted) Ga0255312_111773323300031248Sandy SoilMKSEDWAKKYAAMDKRVDLKYQHLPKGEQIGKRPDAPKPQAK
Ga0307408_10045670223300031548RhizosphereMKPTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKKS
Ga0310813_1021755823300031716SoilMSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKQPTSALPASKKA
Ga0307410_1017544733300031852RhizosphereMKPTDWVKKYAAMDKRVELKYLHLPKNEQIGKRPAAPKPEVKKS
Ga0326597_10001635353300031965SoilMSQEDWAKKYAAMDKRLLLKYEHLPNGEQIGGKPIAPNSEAKKS
Ga0315910_1061668613300032144SoilMSQTDWVKKYAAMDKRLILKYEQLPKGEQIGKRPLVVKAEEKRS
Ga0315912_1073721813300032157SoilMKPTDWVKKYAAMDKRVELKYQHLPNGEQIGKRPEAPKPEAKKS
Ga0315912_1091054313300032157SoilPMKPEDWARKYAAMDKRVDLKFQHLPNGEQIGKRPAAPKPNAKKS
Ga0315281_1031577523300032163SedimentMSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPETPKADVKKT
Ga0316605_1045673823300033408SoilMKPEDWAKKYAAMDRRVDLKYQHLPNGEQIGKRSPAPKPDAKKS
Ga0316601_10002708623300033419SoilMKPEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRSPAPKPDAKKS
Ga0326726_1009202523300033433Peat SoilMKTEDWAKKYAAMDKRVDLKYQYLPKGEQIGKRPVAPKPDAKKS
Ga0316626_1218086023300033485SoilMSQEDWAKKYAAMDKRLMLKYQHLPKGEQIGKKPVPPKS
Ga0364946_105037_11_1453300033815SedimentMSKEDWAKKYAAMDKRLLLKYEHLPNGEQIGKKPELPKQEAKKS
Ga0364945_0107620_478_6123300034115SedimentMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKAAAKKS
Ga0364929_0264002_150_2873300034149SedimentMMSQEDWAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS
Ga0370498_039795_855_10043300034155Untreated Peat SoilMEDGSMSAIDWAKKYAAMDGRVTLKYQQLPKGEQIGKHLAPAAPEAKKS
Ga0364932_0114587_51_2183300034177SedimentMVKQIERGGSPMSQTDWAKKYAAMDKRLQLKYEQLPKGEQIGKRPQAPKPQAQKS
Ga0370495_0167491_16_1503300034257Untreated Peat SoilMKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.