Basic Information | |
---|---|
Family ID | F034097 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 175 |
Average Sequence Length | 44 residues |
Representative Sequence | MKPEDWAKKYAAMDKRIDLKYQQLAKGEQIGKRPEAPKPEAKKS |
Number of Associated Samples | 139 |
Number of Associated Scaffolds | 175 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 86.86 % |
% of genes near scaffold ends (potentially truncated) | 13.14 % |
% of genes from short scaffolds (< 2000 bps) | 87.43 % |
Associated GOLD sequencing projects | 133 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.714 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (15.429 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.143 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (32.571 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 2.78% Coil/Unstructured: 72.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 175 Family Scaffolds |
---|---|---|
PF00384 | Molybdopterin | 11.43 |
PF00890 | FAD_binding_2 | 6.29 |
PF04909 | Amidohydro_2 | 5.14 |
PF04879 | Molybdop_Fe4S4 | 4.00 |
PF00355 | Rieske | 2.29 |
PF00856 | SET | 1.71 |
PF02627 | CMD | 1.14 |
PF00892 | EamA | 1.14 |
PF13744 | HTH_37 | 1.14 |
PF01568 | Molydop_binding | 1.14 |
PF00596 | Aldolase_II | 0.57 |
PF00848 | Ring_hydroxyl_A | 0.57 |
PF01712 | dNK | 0.57 |
PF00691 | OmpA | 0.57 |
PF13649 | Methyltransf_25 | 0.57 |
PF12974 | Phosphonate-bd | 0.57 |
PF01070 | FMN_dh | 0.57 |
PF01814 | Hemerythrin | 0.57 |
PF04892 | VanZ | 0.57 |
COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
---|---|---|---|
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.14 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.14 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.14 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.57 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.57 |
COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.71 % |
Unclassified | root | N/A | 6.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c1810690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 598 | Open in IMG/M |
3300000550|F24TB_14020001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 644 | Open in IMG/M |
3300000891|JGI10214J12806_13058039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 947 | Open in IMG/M |
3300000956|JGI10216J12902_102169742 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
3300000956|JGI10216J12902_103742282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1190 | Open in IMG/M |
3300003319|soilL2_10160641 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
3300003319|soilL2_10320925 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300004019|Ga0055439_10296342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 534 | Open in IMG/M |
3300004022|Ga0055432_10098440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 766 | Open in IMG/M |
3300004024|Ga0055436_10078858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 938 | Open in IMG/M |
3300004024|Ga0055436_10159465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 692 | Open in IMG/M |
3300004049|Ga0055493_10055050 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300004067|Ga0055485_10169421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 605 | Open in IMG/M |
3300004114|Ga0062593_100203900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1578 | Open in IMG/M |
3300004145|Ga0055489_10040949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1209 | Open in IMG/M |
3300004463|Ga0063356_101692621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 945 | Open in IMG/M |
3300004463|Ga0063356_102551402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
3300004463|Ga0063356_103672450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 661 | Open in IMG/M |
3300004643|Ga0062591_100408812 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300004778|Ga0062383_10096923 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300004781|Ga0062379_10220411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
3300004808|Ga0062381_10421056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
3300005295|Ga0065707_10757381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 616 | Open in IMG/M |
3300005331|Ga0070670_100938307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 785 | Open in IMG/M |
3300005336|Ga0070680_101820820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 528 | Open in IMG/M |
3300005341|Ga0070691_10971197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 528 | Open in IMG/M |
3300005441|Ga0070700_100098825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1919 | Open in IMG/M |
3300005450|Ga0066682_10164160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1417 | Open in IMG/M |
3300005518|Ga0070699_102094524 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
3300005829|Ga0074479_10761141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
3300005836|Ga0074470_10090447 | All Organisms → cellular organisms → Bacteria | 3128 | Open in IMG/M |
3300005836|Ga0074470_10217736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5834 | Open in IMG/M |
3300005836|Ga0074470_10255448 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
3300005836|Ga0074470_10881863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 587 | Open in IMG/M |
3300006845|Ga0075421_101015584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
3300006845|Ga0075421_101567863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
3300006894|Ga0079215_10085622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1343 | Open in IMG/M |
3300006969|Ga0075419_10485343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 857 | Open in IMG/M |
3300007258|Ga0099793_10677161 | Not Available | 520 | Open in IMG/M |
3300009053|Ga0105095_10252710 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300009053|Ga0105095_10422506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
3300009053|Ga0105095_10784949 | Not Available | 533 | Open in IMG/M |
3300009078|Ga0105106_10095559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2187 | Open in IMG/M |
3300009078|Ga0105106_10304773 | Not Available | 1153 | Open in IMG/M |
3300009087|Ga0105107_10459128 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300009087|Ga0105107_10706633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
3300009091|Ga0102851_12473843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
3300009100|Ga0075418_11140386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
3300009147|Ga0114129_11088659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
3300009147|Ga0114129_11777060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 750 | Open in IMG/M |
3300009156|Ga0111538_11990322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 731 | Open in IMG/M |
3300009162|Ga0075423_10045886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4489 | Open in IMG/M |
3300009171|Ga0105101_10633232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300009553|Ga0105249_10717517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1061 | Open in IMG/M |
3300009609|Ga0105347_1015886 | All Organisms → cellular organisms → Bacteria | 2568 | Open in IMG/M |
3300009609|Ga0105347_1323030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 653 | Open in IMG/M |
3300009610|Ga0105340_1012408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3359 | Open in IMG/M |
3300009678|Ga0105252_10000016 | All Organisms → cellular organisms → Bacteria | 184907 | Open in IMG/M |
3300009678|Ga0105252_10531026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
3300009678|Ga0105252_10604616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
3300009777|Ga0105164_10642848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
3300010391|Ga0136847_10321205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 831 | Open in IMG/M |
3300010400|Ga0134122_10600026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1017 | Open in IMG/M |
3300011406|Ga0137454_1066881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
3300011414|Ga0137442_1075179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
3300011417|Ga0137326_1061502 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300011420|Ga0137314_1099600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 713 | Open in IMG/M |
3300011421|Ga0137462_1101461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 683 | Open in IMG/M |
3300011427|Ga0137448_1126805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 700 | Open in IMG/M |
3300011437|Ga0137429_1083088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 961 | Open in IMG/M |
3300011438|Ga0137451_1060153 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300011441|Ga0137452_1088473 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300011441|Ga0137452_1252030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
3300012040|Ga0137461_1001325 | All Organisms → cellular organisms → Bacteria | 5040 | Open in IMG/M |
3300012040|Ga0137461_1133174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 724 | Open in IMG/M |
3300012041|Ga0137430_1174973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 619 | Open in IMG/M |
3300012133|Ga0137329_1007759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1116 | Open in IMG/M |
3300012929|Ga0137404_10156532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1900 | Open in IMG/M |
3300014262|Ga0075301_1067669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 721 | Open in IMG/M |
3300014262|Ga0075301_1153405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 538 | Open in IMG/M |
3300014269|Ga0075302_1105384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
3300014297|Ga0075306_1116157 | Not Available | 526 | Open in IMG/M |
3300014312|Ga0075345_1031047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1044 | Open in IMG/M |
3300014326|Ga0157380_11074919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 842 | Open in IMG/M |
3300014865|Ga0180078_1012277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1209 | Open in IMG/M |
3300014871|Ga0180095_1108873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
3300014872|Ga0180087_1035062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 925 | Open in IMG/M |
3300014877|Ga0180074_1038008 | Not Available | 996 | Open in IMG/M |
3300014882|Ga0180069_1138967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
3300014883|Ga0180086_1082829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 802 | Open in IMG/M |
3300015201|Ga0173478_10447515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
3300015374|Ga0132255_104827969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 571 | Open in IMG/M |
3300017939|Ga0187775_10019528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1838 | Open in IMG/M |
3300017966|Ga0187776_10090201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1809 | Open in IMG/M |
3300018028|Ga0184608_10256432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 770 | Open in IMG/M |
3300018031|Ga0184634_10281552 | Not Available | 763 | Open in IMG/M |
3300018053|Ga0184626_10093330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1274 | Open in IMG/M |
3300018056|Ga0184623_10402484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 602 | Open in IMG/M |
3300018063|Ga0184637_10060871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2307 | Open in IMG/M |
3300018071|Ga0184618_10233864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 775 | Open in IMG/M |
3300018077|Ga0184633_10096633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1525 | Open in IMG/M |
3300018077|Ga0184633_10405006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 681 | Open in IMG/M |
3300018078|Ga0184612_10029154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2850 | Open in IMG/M |
3300018079|Ga0184627_10137271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1295 | Open in IMG/M |
3300018083|Ga0184628_10022024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3144 | Open in IMG/M |
3300018083|Ga0184628_10038510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2399 | Open in IMG/M |
3300018084|Ga0184629_10049398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1912 | Open in IMG/M |
3300018084|Ga0184629_10187977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1063 | Open in IMG/M |
3300018084|Ga0184629_10439832 | Not Available | 683 | Open in IMG/M |
3300018084|Ga0184629_10495095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 637 | Open in IMG/M |
3300018422|Ga0190265_10306260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1661 | Open in IMG/M |
3300018429|Ga0190272_10521880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1016 | Open in IMG/M |
3300018432|Ga0190275_10024846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4720 | Open in IMG/M |
3300018469|Ga0190270_10033117 | All Organisms → cellular organisms → Bacteria | 3392 | Open in IMG/M |
3300018469|Ga0190270_10512544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1146 | Open in IMG/M |
3300018469|Ga0190270_11556408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 712 | Open in IMG/M |
3300018469|Ga0190270_13401105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
3300018476|Ga0190274_10162952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1904 | Open in IMG/M |
3300018476|Ga0190274_11525698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 760 | Open in IMG/M |
3300018476|Ga0190274_11692039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 726 | Open in IMG/M |
3300018481|Ga0190271_10457798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1381 | Open in IMG/M |
3300018482|Ga0066669_10242633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1418 | Open in IMG/M |
3300018920|Ga0190273_11323306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
3300019874|Ga0193744_1048285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 814 | Open in IMG/M |
3300019881|Ga0193707_1055826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1250 | Open in IMG/M |
3300019884|Ga0193741_1043854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1154 | Open in IMG/M |
3300020027|Ga0193752_1237273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 674 | Open in IMG/M |
3300020034|Ga0193753_10363386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 596 | Open in IMG/M |
3300020061|Ga0193716_1002854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 9632 | Open in IMG/M |
3300021051|Ga0206224_1008542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1111 | Open in IMG/M |
3300021051|Ga0206224_1057418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300021081|Ga0210379_10019898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2533 | Open in IMG/M |
3300021332|Ga0210339_1445019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
3300022208|Ga0224495_10140918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1034 | Open in IMG/M |
3300022209|Ga0224497_10028955 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
3300024241|Ga0233392_1010152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
3300025324|Ga0209640_10326153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1278 | Open in IMG/M |
3300025953|Ga0210068_1019093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 975 | Open in IMG/M |
3300025971|Ga0210102_1012739 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
3300026095|Ga0207676_11954734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 585 | Open in IMG/M |
3300026320|Ga0209131_1135342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1264 | Open in IMG/M |
3300027573|Ga0208454_1000020 | All Organisms → cellular organisms → Bacteria | 146887 | Open in IMG/M |
3300027731|Ga0209592_1279735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
3300027778|Ga0209464_10052601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1341 | Open in IMG/M |
3300027815|Ga0209726_10017289 | All Organisms → cellular organisms → Bacteria | 6408 | Open in IMG/M |
3300027815|Ga0209726_10318662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 752 | Open in IMG/M |
3300027815|Ga0209726_10324417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
3300027818|Ga0209706_10484189 | Not Available | 567 | Open in IMG/M |
3300027831|Ga0209797_10068640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1565 | Open in IMG/M |
3300027840|Ga0209683_10106310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1271 | Open in IMG/M |
3300027843|Ga0209798_10073928 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
3300027843|Ga0209798_10156507 | Not Available | 1140 | Open in IMG/M |
3300027909|Ga0209382_11096727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
3300027909|Ga0209382_11250670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 756 | Open in IMG/M |
3300028145|Ga0247663_1086747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 561 | Open in IMG/M |
3300028381|Ga0268264_12211481 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1117733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 653 | Open in IMG/M |
3300031548|Ga0307408_100456702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1109 | Open in IMG/M |
3300031716|Ga0310813_10217558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1575 | Open in IMG/M |
3300031852|Ga0307410_10175447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1619 | Open in IMG/M |
3300031965|Ga0326597_10001635 | All Organisms → cellular organisms → Bacteria | 35744 | Open in IMG/M |
3300032144|Ga0315910_10616686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 841 | Open in IMG/M |
3300032157|Ga0315912_10737218 | Not Available | 785 | Open in IMG/M |
3300032157|Ga0315912_10910543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 699 | Open in IMG/M |
3300032163|Ga0315281_10315775 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
3300033408|Ga0316605_10456738 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300033419|Ga0316601_100027086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3913 | Open in IMG/M |
3300033433|Ga0326726_10092025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2701 | Open in IMG/M |
3300033485|Ga0316626_12180860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 503 | Open in IMG/M |
3300033815|Ga0364946_105037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 630 | Open in IMG/M |
3300034115|Ga0364945_0107620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 819 | Open in IMG/M |
3300034149|Ga0364929_0264002 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300034155|Ga0370498_039795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1030 | Open in IMG/M |
3300034177|Ga0364932_0114587 | Not Available | 1024 | Open in IMG/M |
3300034257|Ga0370495_0167491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 701 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 15.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.71% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 9.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.71% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.71% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.14% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 4.57% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.86% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.29% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.71% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.71% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.71% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.14% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.14% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.14% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.14% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.14% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.14% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.57% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.57% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.57% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.57% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.57% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.57% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.57% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.57% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.57% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004049 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 | Environmental | Open in IMG/M |
3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
3300014297 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1 | Environmental | Open in IMG/M |
3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
3300014871 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da | Environmental | Open in IMG/M |
3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022209 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13 | Environmental | Open in IMG/M |
3300024241 | Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PB | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_18106902 | 3300000033 | Soil | MSQEDWVKKYAAMDQRLMLXYEHXPXGEQVGKXPXLPKPEAKKS* |
F24TB_140200012 | 3300000550 | Soil | MKPTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKKS* |
JGI10214J12806_130580392 | 3300000891 | Soil | MSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS* |
JGI10216J12902_1021697422 | 3300000956 | Soil | MSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPDLPKSEAKKS* |
JGI10216J12902_1037422821 | 3300000956 | Soil | LLPVEHFRTLSMQPEDWAKKYAAMDKPIDLKYQQLAKGEQIGKRPEAPKPPPKKS* |
soilL2_101606412 | 3300003319 | Sugarcane Root And Bulk Soil | MSGDWAKKYAAMDQRLLLKYQQLPQGEQVGKKVQALAPEARD* |
soilL2_103209252 | 3300003319 | Sugarcane Root And Bulk Soil | MSRVDWAKKYAAMDQRLSLKYEQLPRGEQIGKKAPEVKPAKKEAWQTTTRSAAR* |
Ga0055439_102963422 | 3300004019 | Natural And Restored Wetlands | MSQEDWAKKYAAMDKRLMLKYEQLPQGEQIGKQPELAKSEAKKC* |
Ga0055432_100984401 | 3300004022 | Natural And Restored Wetlands | MKPEDWARKYAAMDKRIELKYQQLAKGEQIGKRPEAPKSEAKKS* |
Ga0055436_100788582 | 3300004024 | Natural And Restored Wetlands | MSQEDWAKKYAAMDQRLTLKYEQLPKGEQIGKKPEWPKTEAKKC* |
Ga0055436_101594652 | 3300004024 | Natural And Restored Wetlands | MSQEDWAKKYAAMDQRLTLIYEQLPKGEQIGKKSERPQMEAKKCSSSAS* |
Ga0055493_100550502 | 3300004049 | Natural And Restored Wetlands | MKSEDWAKKYEAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS* |
Ga0055485_101694211 | 3300004067 | Natural And Restored Wetlands | MSREDWARKYAAMDKRLMLKYEQLPSGEQVGKKPKMAQSNGKQS* |
Ga0062593_1002039003 | 3300004114 | Soil | MKPTDWVKKYAAMDKRVELKYQHLPNGEQIGKRPEAPKSEAKKS* |
Ga0055489_100409492 | 3300004145 | Natural And Restored Wetlands | MSREDWARKYAAMDKRLMLKYEQQPSGEQVGKKPKIAQSDGKKS* |
Ga0063356_1016926213 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RLSMNPTDWAKKYAAMNKRVGLKYQHLPKGEQIGKRPAMPKPDANKS* |
Ga0063356_1025514022 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKPTDWVKKYAAMDKRVELRYLHLPKGEQIGKRPAAPKPEVKKS* |
Ga0063356_1036724502 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSQEDWVKKYAAMDQRLMLKYEHLPKGEQVGKKPELPKPEAK |
Ga0062591_1004088122 | 3300004643 | Soil | MSQEDWVKKYAAMDQRLMLKYEHLPKGEQVGKKPELPKPEAKKS* |
Ga0062383_100969232 | 3300004778 | Wetland Sediment | MKPTDWVKKYSAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS* |
Ga0062379_102204111 | 3300004781 | Wetland Sediment | WVKKYSAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS* |
Ga0062381_104210562 | 3300004808 | Wetland Sediment | MKPTDWVKKYAAMDKRVDLKYQFLPKGEQIGKRPEAPKPNAKKS* |
Ga0065707_107573812 | 3300005295 | Switchgrass Rhizosphere | MSQEDWAKKYAAMDKRLMIKYEHLPKGEQIGKKPELPLKEAKKS* |
Ga0070670_1009383072 | 3300005331 | Switchgrass Rhizosphere | MKSTDWAKKYAAMDKRVGLKYQYLPKGEQVGKRPFAPQAAAKKA* |
Ga0070680_1018208202 | 3300005336 | Corn Rhizosphere | QIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS* |
Ga0070691_109711971 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPELPKQEPKKS* |
Ga0070700_1000988252 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQIDWAKKYAAMERRVTLKYQQLPKGEQIGKRLEAEAPKTKKS* |
Ga0066682_101641603 | 3300005450 | Soil | MSDEDWATKYAAMNGRVTQKYEHLPKGEQIGKRPEAKPQ* |
Ga0070699_1020945241 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQEDWAKKYAAMDQRLLLKYEHLPNGEQIGKKPELPKPEAKKT* |
Ga0074479_107611412 | 3300005829 | Sediment (Intertidal) | MKPEDWARKYAAMDKRVGLKYQFLPKGEQTGKRPEAPKPEAKKP* |
Ga0074470_100904472 | 3300005836 | Sediment (Intertidal) | MKPTDWVKKYAAMDKRVGLKYQHLPKGEQIGKPPDAPKPQAK* |
Ga0074470_102177368 | 3300005836 | Sediment (Intertidal) | MSQEDWAKKYAAMDQRLTLKYEQLPRGEQIGKKPEPPNTEAKKCK |
Ga0074470_102554483 | 3300005836 | Sediment (Intertidal) | MKPTDWVKKYAAMDKRVELKYQHLPKGEQIGKRPDAPEPQAK* |
Ga0074470_108818632 | 3300005836 | Sediment (Intertidal) | MKPTDWVKKYAAMDKRVALKYQHLPKGEQIGKRPDAPKPQTK* |
Ga0075421_1010155842 | 3300006845 | Populus Rhizosphere | MSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKSEAKKS* |
Ga0075421_1015678632 | 3300006845 | Populus Rhizosphere | MSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEPPKPEAKKS* |
Ga0079215_100856222 | 3300006894 | Agricultural Soil | MSQTDWAKIYAVMDKRVELKYAQLPKGEQIGERPALVKAQVKKS* |
Ga0075419_104853431 | 3300006969 | Populus Rhizosphere | MSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEPPKPEATKS* |
Ga0099793_106771611 | 3300007258 | Vadose Zone Soil | DEDWATKYAAMNGRVTQKYEHLPKGEQIGKRPEAKPQ* |
Ga0105095_102527102 | 3300009053 | Freshwater Sediment | MKPVDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPEAKKS* |
Ga0105095_104225061 | 3300009053 | Freshwater Sediment | MEVSTMSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQTGKAEQKAF* |
Ga0105095_107849492 | 3300009053 | Freshwater Sediment | MKAENWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAAKPEAKKS* |
Ga0105106_100955591 | 3300009078 | Freshwater Sediment | KKYAAMDKRVDLKYQHLPNGEQIGKRPEAPKPQAK* |
Ga0105106_103047731 | 3300009078 | Freshwater Sediment | MKPEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPDAKKS* |
Ga0105107_104591282 | 3300009087 | Freshwater Sediment | MKAEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPDAKKS* |
Ga0105107_107066332 | 3300009087 | Freshwater Sediment | MEVSTMSQTDWAKKYAAMDKRIVLKYEQLPNGEQVGKRPQTGKAEQKAF* |
Ga0102851_124738432 | 3300009091 | Freshwater Wetlands | MKSEDWAKKYAAMDKRVDLKYQHLPKGEQIGKRPEAPKPQAK* |
Ga0075418_111403862 | 3300009100 | Populus Rhizosphere | MMSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKSEAKKS* |
Ga0114129_110886592 | 3300009147 | Populus Rhizosphere | MMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEPPKPEAKKS* |
Ga0114129_117770602 | 3300009147 | Populus Rhizosphere | MMSQEDWAKKYAAMDQRLLLKYEHLPNGEQIGKKPELPKPETKKV* |
Ga0111538_119903222 | 3300009156 | Populus Rhizosphere | MMSQEDWANKYAAMDQRLLLKYEHLPDGEQIGKKPELSKPETKKA* |
Ga0075423_100458863 | 3300009162 | Populus Rhizosphere | MMSQEDWAKKYAAMDQRLLLKYEHLPDGEQIGKKPELSKPETKKA* |
Ga0105101_106332321 | 3300009171 | Freshwater Sediment | SMKPVDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPEAKKS* |
Ga0105249_107175172 | 3300009553 | Switchgrass Rhizosphere | MMSQEDWAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS* |
Ga0105347_10158861 | 3300009609 | Soil | MKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKPPEAPKAAAKKS* |
Ga0105347_13230302 | 3300009609 | Soil | MSQEDWAKKYAAMDRRLMLKYEHLPKGEQIGKKPVSPKPEGKKS* |
Ga0105340_10124082 | 3300009610 | Soil | MKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKAAAKKS* |
Ga0105252_10000016132 | 3300009678 | Soil | MGQEDWAKKYAAMDPRLMLKYEQLPKGEQIGKKPMAPKTPVKKS* |
Ga0105252_105310262 | 3300009678 | Soil | MKTEDWAKEYAAMDKRVDLKYQHLPNGEQIGKRPAAPKPNAKKS* |
Ga0105252_106046162 | 3300009678 | Soil | MKAEDWAKKYAAMDKRVDLKYQHLPKGEQIGKRPEAPNPQAK* |
Ga0105164_106428482 | 3300009777 | Wastewater | MKPEDWAKKYAAMDKRIDLKYQQLAKGEQIGKRPEAPKPDTKKS* |
Ga0136847_103212052 | 3300010391 | Freshwater Sediment | MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKTELSTADVKKS* |
Ga0134122_106000262 | 3300010400 | Terrestrial Soil | MKPEDWVKKYAAMDKRVGLKYQYLPKGEQIGKRSEPPKSEAKKS* |
Ga0137454_10668811 | 3300011406 | Soil | MKPADWAKKYAAMDKRLLLKYQYLPKGEQIGKKPAAPNPTAKKS* |
Ga0137442_10751791 | 3300011414 | Soil | MSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPTSAQPASKKA* |
Ga0137326_10615021 | 3300011417 | Soil | MKSEDWAKKYAAMDKRIELKYQQLAKAEQIGKRPEAPKAAAKKS* |
Ga0137314_10996002 | 3300011420 | Soil | MKTEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPAAPKPNAKKS* |
Ga0137462_11014612 | 3300011421 | Soil | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPESPKPAAKKS* |
Ga0137448_11268052 | 3300011427 | Soil | LSMKPQDWAKKYAAMDKRVGLKYQHLPKGEQIGKRPETPKPATKIS* |
Ga0137429_10830883 | 3300011437 | Soil | MSQEDWAKKYAAMDKRLMLKYQQLPKGEQIGKKPASPKPEGKKS* |
Ga0137451_10601532 | 3300011438 | Soil | MKPEDWAKKYAVMDKRIDLKYQQLAKGEQIGKRPEAPKPAAKKS* |
Ga0137452_10884732 | 3300011441 | Soil | MKTEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPQAK* |
Ga0137452_12520301 | 3300011441 | Soil | YAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS* |
Ga0137461_10013255 | 3300012040 | Soil | MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKRPELPKQELKKS* |
Ga0137461_11331741 | 3300012040 | Soil | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPETPKPATKKS* |
Ga0137430_11749732 | 3300012041 | Soil | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPNPQAK* |
Ga0137329_10077592 | 3300012133 | Soil | MSQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPVSPKPEGKKS* |
Ga0137404_101565321 | 3300012929 | Vadose Zone Soil | MSDEDWATKYAAMNGRVPQKYEHLPNGEQIGKRPEAKPQ* |
Ga0075301_10676692 | 3300014262 | Natural And Restored Wetlands | MSQEDWAKRYAAMDQRLTLKYEQLPKGEQIGKKPEVPETEAKKCSSFAS* |
Ga0075301_11534051 | 3300014262 | Natural And Restored Wetlands | MSQENWAKKYAAMDKRLMLKYEQLPKGEQIGKKPVPAKSEANKS* |
Ga0075302_11053842 | 3300014269 | Natural And Restored Wetlands | MSQEDWAKRYAAMDQRSTLKYEQLPKGKQIGKKPELPETEAKKCSSFAS* |
Ga0075306_11161571 | 3300014297 | Natural And Restored Wetlands | MKPTDWVKKYAAMDKQVELKFLYLPKGEQIGKRPVAPKPDAKKSY |
Ga0075345_10310472 | 3300014312 | Natural And Restored Wetlands | MKSDNWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS* |
Ga0157380_110749192 | 3300014326 | Switchgrass Rhizosphere | MKPTDWVKKYAAMDKRVELKYQHLPKGEQIGKRLAAPTADVKKS* |
Ga0180078_10122772 | 3300014865 | Soil | MKSEDWAKKYAAMDKRIELKYQQLAKGEQNGKRPEAPKPAAKKS* |
Ga0180095_11088731 | 3300014871 | Soil | KPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS* |
Ga0180087_10350622 | 3300014872 | Soil | MSQEDWAKNYAAMDKRLMLKYEHLPKGEQIGKKPEAPKREATNS* |
Ga0180074_10380082 | 3300014877 | Soil | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS* |
Ga0180069_11389672 | 3300014882 | Soil | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKV* |
Ga0180086_10828291 | 3300014883 | Soil | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPAAPKPEAKKS* |
Ga0173478_104475151 | 3300015201 | Soil | MKSTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKKS* |
Ga0132255_1048279692 | 3300015374 | Arabidopsis Rhizosphere | MSQIDWAKKYAIMDKRLMLKYEYLPKGEQVGKKPQLPKPEAKKS* |
Ga0187775_100195283 | 3300017939 | Tropical Peatland | MSQEDWVKKYAAMDKRLMLKYEHLPKGEQIGKKPVQPKQGETKSSQAERLR |
Ga0187776_100902013 | 3300017966 | Tropical Peatland | MSQEDWVKKYAAMDKRLMLKYEHLPKGEQIGKKPVQPKQG |
Ga0184608_102564322 | 3300018028 | Groundwater Sediment | MSQIDWAKKYAAMDRRVTLKYQQVPKGEQIGKRLEAEAPKTKKS |
Ga0184634_102815522 | 3300018031 | Groundwater Sediment | MSQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPDLPKHELKKS |
Ga0184626_100933302 | 3300018053 | Groundwater Sediment | MSQVDWAKKYAAMDKRLMLKYEHLPNGEQICKKPVALKTEVKKS |
Ga0184623_104024842 | 3300018056 | Groundwater Sediment | MSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPLPKPTA |
Ga0184637_100608714 | 3300018063 | Groundwater Sediment | MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPKLPKQE |
Ga0184618_102338642 | 3300018071 | Groundwater Sediment | MTQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS |
Ga0184633_100966333 | 3300018077 | Groundwater Sediment | MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIVRKPELPKQEAKKS |
Ga0184633_104050062 | 3300018077 | Groundwater Sediment | MSQVDWVKKYAAMEKQLMLKYEHLPKGEQIGKKPELAKQEAKKP |
Ga0184612_100291542 | 3300018078 | Groundwater Sediment | MSQVDWAKKYAAMDKRLMLKYEQLPNGEQIGKKPVALKTEAKKS |
Ga0184627_101372712 | 3300018079 | Groundwater Sediment | MSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEAPKSEAKQS |
Ga0184628_100220242 | 3300018083 | Groundwater Sediment | MKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS |
Ga0184628_100385102 | 3300018083 | Groundwater Sediment | MSQEDWAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS |
Ga0184629_100493982 | 3300018084 | Groundwater Sediment | MSQEDWAKKYAAMDKRLMLKYQQLPKGEQIGKKPVPQKSEGKKS |
Ga0184629_101879772 | 3300018084 | Groundwater Sediment | MKPEDWAKKYAAMDKRIDLKYQQLAKGEQIGKRPEAPKPEAKKS |
Ga0184629_104398321 | 3300018084 | Groundwater Sediment | MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKRPELPKQELKKS |
Ga0184629_104950951 | 3300018084 | Groundwater Sediment | MSQEDWAKKYAAMDKRLILKYEQLPKGEQVGKKPVPPAANVKKA |
Ga0190265_103062602 | 3300018422 | Soil | MQPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPDAPKPQPKKS |
Ga0190272_105218802 | 3300018429 | Soil | MNQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS |
Ga0190275_100248464 | 3300018432 | Soil | MQPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPDAPKTQPKKS |
Ga0190270_100331174 | 3300018469 | Soil | MSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPQLPKSEAKKS |
Ga0190270_105125442 | 3300018469 | Soil | MKPEDWAKKYAAMDKRIELKYQQLAKGEQNGKRPEAPKPAAKKS |
Ga0190270_115564082 | 3300018469 | Soil | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEASKPTAKKS |
Ga0190270_134011052 | 3300018469 | Soil | YAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS |
Ga0190274_101629523 | 3300018476 | Soil | MKPTDWVKKYAAMDTRVELKYQHLPKGEQIGKRPAAPKPEVKKS |
Ga0190274_115256982 | 3300018476 | Soil | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPPPKKS |
Ga0190274_116920391 | 3300018476 | Soil | MKSTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKNS |
Ga0190271_104577982 | 3300018481 | Soil | MKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKAAAKKS |
Ga0066669_102426333 | 3300018482 | Grasslands Soil | MSDEDWATKYAAMNGRVTQKYEHLPKGEQIGKRPEAKPQ |
Ga0190273_113233062 | 3300018920 | Soil | MQPEDWAKKYAAMDKRIEIKYQQLAKGEQIGKRPDAPKPQPKKA |
Ga0193744_10482851 | 3300019874 | Soil | MSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKA |
Ga0193707_10558262 | 3300019881 | Soil | MSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS |
Ga0193741_10438542 | 3300019884 | Soil | MSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKPEAKKS |
Ga0193752_12372731 | 3300020027 | Soil | KKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS |
Ga0193753_103633862 | 3300020034 | Soil | MSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKHLEAEAPEAKKS |
Ga0193716_100285411 | 3300020061 | Soil | MSQFDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS |
Ga0206224_10085422 | 3300021051 | Deep Subsurface Sediment | MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPQPQKTEAKKS |
Ga0206224_10574182 | 3300021051 | Deep Subsurface Sediment | MKPEDWAKKYAAMDKRIALKYQLLAKGEQIGKRPAAPKPEAKKS |
Ga0210379_100198982 | 3300021081 | Groundwater Sediment | MSQEDWAKKYAAMDRRLMLKYEHLPKGEQIGKKPVSPKPEGKKS |
Ga0210339_14450192 | 3300021332 | Estuarine | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEASKAEAKKS |
Ga0224495_101409182 | 3300022208 | Sediment | MKPTDWVKKYAAMDKRVGFKYQFLPKGEQIGKRPEAPKTDAKKS |
Ga0224497_100289552 | 3300022209 | Sediment | MNQTDWAKLYAAMDERLVLKYEHLPNGEQIRKRPENPPRPAERKRT |
Ga0233392_10101522 | 3300024241 | Deep Subsurface Sediment | MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKSEPANTEAKKS |
Ga0209640_103261533 | 3300025324 | Soil | MSQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPMAP |
Ga0210068_10190932 | 3300025953 | Natural And Restored Wetlands | MKSEDWAKKYEAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS |
Ga0210102_10127394 | 3300025971 | Natural And Restored Wetlands | RLWMKSEDWAKKYEAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS |
Ga0207676_119547342 | 3300026095 | Switchgrass Rhizosphere | KKYAAMDRRVTLKYQQLPNGEQIGKRLEAQAPKTKKS |
Ga0209131_11353423 | 3300026320 | Grasslands Soil | MSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPTPAQPAPKKA |
Ga0208454_100002050 | 3300027573 | Soil | MGQEDWAKKYAAMDPRLMLKYEQLPKGEQIGKKPMAPKTPVKKS |
Ga0209592_12797352 | 3300027731 | Freshwater Sediment | MKPVDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPEAKKS |
Ga0209464_100526012 | 3300027778 | Wetland Sediment | MKPADWVKKYAAMDKRVDLKYQFLPKGEQIGKRPEAPKPNAKKS |
Ga0209726_100172896 | 3300027815 | Groundwater | MGQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPELSKLEVKKS |
Ga0209726_103186622 | 3300027815 | Groundwater | MKPEDWAKKYAAMDKRIELKYQQLAKGEQTGKRPEAPKPEAKKS |
Ga0209726_103244171 | 3300027815 | Groundwater | MSQVDWAKKYAAMDKRLLLKYEHLPKGEQIGKKPALPTPEAKKS |
Ga0209706_104841891 | 3300027818 | Freshwater Sediment | MKAEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPDAKKS |
Ga0209797_100686403 | 3300027831 | Wetland Sediment | VKKNAAMDKRVDLKYQFLPKGEQIGKRPEAPKPDAKKS |
Ga0209683_101063103 | 3300027840 | Wetland Sediment | MKPTDWVKKYSAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS |
Ga0209798_100739282 | 3300027843 | Wetland Sediment | MKPTDWVKKYAAMDKRVDLKYQFLPKGEQIGKRPEAPKPDAKKS |
Ga0209798_101565071 | 3300027843 | Wetland Sediment | MKPTDWVKKYAAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS |
Ga0209382_110967272 | 3300027909 | Populus Rhizosphere | MSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKSEAKKS |
Ga0209382_112506702 | 3300027909 | Populus Rhizosphere | MSQEDWAKKYAAMDQRLLLKYEHLPDGEQIGKKPAPAQPEAKKS |
Ga0247663_10867471 | 3300028145 | Soil | LISDGERKQTMSQVDWAKKYSAMDKRLMLKYEQLPKGEQIGKKPVAVKQETKKV |
Ga0268264_122114812 | 3300028381 | Switchgrass Rhizosphere | MSQEDSAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS |
(restricted) Ga0255312_11177332 | 3300031248 | Sandy Soil | MKSEDWAKKYAAMDKRVDLKYQHLPKGEQIGKRPDAPKPQAK |
Ga0307408_1004567022 | 3300031548 | Rhizosphere | MKPTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKKS |
Ga0310813_102175582 | 3300031716 | Soil | MSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKQPTSALPASKKA |
Ga0307410_101754473 | 3300031852 | Rhizosphere | MKPTDWVKKYAAMDKRVELKYLHLPKNEQIGKRPAAPKPEVKKS |
Ga0326597_1000163535 | 3300031965 | Soil | MSQEDWAKKYAAMDKRLLLKYEHLPNGEQIGGKPIAPNSEAKKS |
Ga0315910_106166861 | 3300032144 | Soil | MSQTDWVKKYAAMDKRLILKYEQLPKGEQIGKRPLVVKAEEKRS |
Ga0315912_107372181 | 3300032157 | Soil | MKPTDWVKKYAAMDKRVELKYQHLPNGEQIGKRPEAPKPEAKKS |
Ga0315912_109105431 | 3300032157 | Soil | PMKPEDWARKYAAMDKRVDLKFQHLPNGEQIGKRPAAPKPNAKKS |
Ga0315281_103157752 | 3300032163 | Sediment | MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPETPKADVKKT |
Ga0316605_104567382 | 3300033408 | Soil | MKPEDWAKKYAAMDRRVDLKYQHLPNGEQIGKRSPAPKPDAKKS |
Ga0316601_1000270862 | 3300033419 | Soil | MKPEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRSPAPKPDAKKS |
Ga0326726_100920252 | 3300033433 | Peat Soil | MKTEDWAKKYAAMDKRVDLKYQYLPKGEQIGKRPVAPKPDAKKS |
Ga0316626_121808602 | 3300033485 | Soil | MSQEDWAKKYAAMDKRLMLKYQHLPKGEQIGKKPVPPKS |
Ga0364946_105037_11_145 | 3300033815 | Sediment | MSKEDWAKKYAAMDKRLLLKYEHLPNGEQIGKKPELPKQEAKKS |
Ga0364945_0107620_478_612 | 3300034115 | Sediment | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKAAAKKS |
Ga0364929_0264002_150_287 | 3300034149 | Sediment | MMSQEDWAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS |
Ga0370498_039795_855_1004 | 3300034155 | Untreated Peat Soil | MEDGSMSAIDWAKKYAAMDGRVTLKYQQLPKGEQIGKHLAPAAPEAKKS |
Ga0364932_0114587_51_218 | 3300034177 | Sediment | MVKQIERGGSPMSQTDWAKKYAAMDKRLQLKYEQLPKGEQIGKRPQAPKPQAQKS |
Ga0370495_0167491_16_150 | 3300034257 | Untreated Peat Soil | MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKA |
⦗Top⦘ |