


| Basic Information | |
|---|---|
| Family ID | F033998 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MNKIYIYLILAGIVILSVSQIYLWKDQMELWYQFNLHLMLDGSKGV |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 60.80 % |
| % of genes near scaffold ends (potentially truncated) | 40.91 % |
| % of genes from short scaffolds (< 2000 bps) | 81.82 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.159 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (26.704 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.432 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.909 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.05% β-sheet: 0.00% Coil/Unstructured: 45.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF05226 | CHASE2 | 65.91 |
| PF16473 | Rv2179c-like | 2.84 |
| PF03951 | Gln-synt_N | 1.14 |
| PF13671 | AAA_33 | 0.57 |
| PF07012 | Curlin_rpt | 0.57 |
| PF04055 | Radical_SAM | 0.57 |
| PF07691 | PA14 | 0.57 |
| PF13353 | Fer4_12 | 0.57 |
| PF01041 | DegT_DnrJ_EryC1 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 65.91 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 1.14 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.57 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.57 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.57 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.57 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.84 % |
| Unclassified | root | N/A | 47.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10148440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 865 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10067616 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10128648 | Not Available | 901 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10050023 | All Organisms → Viruses → Predicted Viral | 1852 | Open in IMG/M |
| 3300000947|BBAY92_10091630 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 811 | Open in IMG/M |
| 3300000973|BBAY93_10047914 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1117 | Open in IMG/M |
| 3300001344|JGI20152J14361_10024712 | Not Available | 2099 | Open in IMG/M |
| 3300001344|JGI20152J14361_10059506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300001347|JGI20156J14371_10127482 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 752 | Open in IMG/M |
| 3300001353|JGI20159J14440_10039821 | All Organisms → Viruses → Predicted Viral | 1903 | Open in IMG/M |
| 3300001419|JGI11705J14877_10158902 | Not Available | 607 | Open in IMG/M |
| 3300001460|JGI24003J15210_10009081 | Not Available | 4087 | Open in IMG/M |
| 3300001947|GOS2218_1033692 | All Organisms → Viruses → Predicted Viral | 1975 | Open in IMG/M |
| 3300001951|GOS2249_1050768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1518 | Open in IMG/M |
| 3300001971|GOS2215_10041324 | Not Available | 1748 | Open in IMG/M |
| 3300002483|JGI25132J35274_1048560 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 921 | Open in IMG/M |
| 3300004097|Ga0055584_101056274 | Not Available | 849 | Open in IMG/M |
| 3300005430|Ga0066849_10024162 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata | 2462 | Open in IMG/M |
| 3300005433|Ga0066830_10003715 | All Organisms → Viruses → Predicted Viral | 2762 | Open in IMG/M |
| 3300005510|Ga0066825_10285918 | Not Available | 607 | Open in IMG/M |
| 3300005512|Ga0074648_1031271 | All Organisms → Viruses → Predicted Viral | 2674 | Open in IMG/M |
| 3300005747|Ga0076924_1069662 | All Organisms → Viruses → Predicted Viral | 1506 | Open in IMG/M |
| 3300006025|Ga0075474_10249365 | Not Available | 534 | Open in IMG/M |
| 3300006026|Ga0075478_10271882 | Not Available | 504 | Open in IMG/M |
| 3300006403|Ga0075514_1938770 | Not Available | 874 | Open in IMG/M |
| 3300006404|Ga0075515_10832758 | Not Available | 645 | Open in IMG/M |
| 3300006737|Ga0098037_1132088 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 848 | Open in IMG/M |
| 3300006793|Ga0098055_1024652 | All Organisms → Viruses → Predicted Viral | 2538 | Open in IMG/M |
| 3300006867|Ga0075476_10050081 | All Organisms → Viruses → Predicted Viral | 1691 | Open in IMG/M |
| 3300006868|Ga0075481_10322242 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 536 | Open in IMG/M |
| 3300006869|Ga0075477_10288403 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 654 | Open in IMG/M |
| 3300006870|Ga0075479_10183270 | Not Available | 845 | Open in IMG/M |
| 3300007113|Ga0101666_1010079 | All Organisms → Viruses → Predicted Viral | 1531 | Open in IMG/M |
| 3300007144|Ga0101670_1026453 | Not Available | 926 | Open in IMG/M |
| 3300007234|Ga0075460_10212830 | Not Available | 654 | Open in IMG/M |
| 3300007538|Ga0099851_1024021 | All Organisms → Viruses → Predicted Viral | 2460 | Open in IMG/M |
| 3300007778|Ga0102954_1156951 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 655 | Open in IMG/M |
| 3300009000|Ga0102960_1038713 | All Organisms → Viruses → Predicted Viral | 1765 | Open in IMG/M |
| 3300009000|Ga0102960_1092255 | Not Available | 1104 | Open in IMG/M |
| 3300009000|Ga0102960_1178946 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 760 | Open in IMG/M |
| 3300009001|Ga0102963_1071939 | Not Available | 1419 | Open in IMG/M |
| 3300009001|Ga0102963_1269045 | Not Available | 673 | Open in IMG/M |
| 3300009027|Ga0102957_1261361 | Not Available | 628 | Open in IMG/M |
| 3300009071|Ga0115566_10125866 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
| 3300009077|Ga0115552_1128556 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
| 3300009079|Ga0102814_10536403 | Not Available | 639 | Open in IMG/M |
| 3300009124|Ga0118687_10007984 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3542 | Open in IMG/M |
| 3300009193|Ga0115551_1031161 | All Organisms → Viruses → Predicted Viral | 2719 | Open in IMG/M |
| 3300009420|Ga0114994_10107897 | All Organisms → Viruses → Predicted Viral | 1894 | Open in IMG/M |
| 3300009437|Ga0115556_1157091 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 836 | Open in IMG/M |
| 3300009445|Ga0115553_1054882 | All Organisms → Viruses → Predicted Viral | 1810 | Open in IMG/M |
| 3300009476|Ga0115555_1050999 | All Organisms → Viruses → Predicted Viral | 1867 | Open in IMG/M |
| 3300009495|Ga0115571_1247613 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 717 | Open in IMG/M |
| 3300009498|Ga0115568_10018565 | All Organisms → Viruses → Predicted Viral | 4036 | Open in IMG/M |
| 3300009505|Ga0115564_10051701 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300009507|Ga0115572_10069130 | All Organisms → Viruses → Predicted Viral | 2179 | Open in IMG/M |
| 3300010300|Ga0129351_1328155 | Not Available | 576 | Open in IMG/M |
| 3300012928|Ga0163110_10113435 | Not Available | 1830 | Open in IMG/M |
| 3300012928|Ga0163110_10575568 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 867 | Open in IMG/M |
| 3300012936|Ga0163109_10141308 | All Organisms → Viruses → Predicted Viral | 1766 | Open in IMG/M |
| 3300012954|Ga0163111_10305199 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1415 | Open in IMG/M |
| 3300012954|Ga0163111_11775507 | Not Available | 617 | Open in IMG/M |
| 3300012954|Ga0163111_11912613 | Not Available | 595 | Open in IMG/M |
| 3300016741|Ga0182079_1241354 | Not Available | 557 | Open in IMG/M |
| 3300016745|Ga0182093_1029606 | Not Available | 515 | Open in IMG/M |
| 3300016747|Ga0182078_10102442 | Not Available | 816 | Open in IMG/M |
| 3300016747|Ga0182078_10829062 | Not Available | 741 | Open in IMG/M |
| 3300016762|Ga0182084_1551267 | Not Available | 702 | Open in IMG/M |
| 3300016791|Ga0182095_1891033 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
| 3300017697|Ga0180120_10052439 | All Organisms → Viruses → Predicted Viral | 1836 | Open in IMG/M |
| 3300017697|Ga0180120_10071421 | All Organisms → Viruses → Predicted Viral | 1539 | Open in IMG/M |
| 3300017744|Ga0181397_1177161 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 538 | Open in IMG/M |
| 3300017748|Ga0181393_1154664 | Not Available | 570 | Open in IMG/M |
| 3300017758|Ga0181409_1219150 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 545 | Open in IMG/M |
| 3300017781|Ga0181423_1130961 | Not Available | 972 | Open in IMG/M |
| 3300017782|Ga0181380_1109956 | Not Available | 952 | Open in IMG/M |
| 3300017949|Ga0181584_10553886 | Not Available | 701 | Open in IMG/M |
| 3300017949|Ga0181584_10674003 | Not Available | 620 | Open in IMG/M |
| 3300017950|Ga0181607_10477478 | Not Available | 669 | Open in IMG/M |
| 3300017950|Ga0181607_10597109 | Not Available | 581 | Open in IMG/M |
| 3300017951|Ga0181577_10128803 | All Organisms → Viruses → Predicted Viral | 1733 | Open in IMG/M |
| 3300017951|Ga0181577_10307732 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300017952|Ga0181583_10703665 | Not Available | 600 | Open in IMG/M |
| 3300017956|Ga0181580_11036524 | Not Available | 506 | Open in IMG/M |
| 3300017958|Ga0181582_10408206 | Not Available | 864 | Open in IMG/M |
| 3300017958|Ga0181582_10550117 | Not Available | 712 | Open in IMG/M |
| 3300017967|Ga0181590_10294405 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300017968|Ga0181587_10643605 | Not Available | 674 | Open in IMG/M |
| 3300017985|Ga0181576_10689761 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 611 | Open in IMG/M |
| 3300018036|Ga0181600_10583737 | Not Available | 523 | Open in IMG/M |
| 3300018039|Ga0181579_10343012 | Not Available | 822 | Open in IMG/M |
| 3300018410|Ga0181561_10177708 | Not Available | 1062 | Open in IMG/M |
| 3300018415|Ga0181559_10245564 | Not Available | 1012 | Open in IMG/M |
| 3300018415|Ga0181559_10295643 | Not Available | 904 | Open in IMG/M |
| 3300018418|Ga0181567_10334212 | Not Available | 1013 | Open in IMG/M |
| 3300018421|Ga0181592_10691598 | Not Available | 682 | Open in IMG/M |
| 3300018423|Ga0181593_10127587 | Not Available | 2062 | Open in IMG/M |
| 3300018423|Ga0181593_10222503 | Not Available | 1475 | Open in IMG/M |
| 3300018423|Ga0181593_10853695 | Not Available | 634 | Open in IMG/M |
| 3300018423|Ga0181593_10879027 | Not Available | 622 | Open in IMG/M |
| 3300018423|Ga0181593_11217026 | Not Available | 507 | Open in IMG/M |
| 3300018428|Ga0181568_10450731 | Not Available | 1030 | Open in IMG/M |
| 3300019277|Ga0182081_1563322 | Not Available | 1393 | Open in IMG/M |
| 3300019280|Ga0182068_1074272 | Not Available | 749 | Open in IMG/M |
| 3300019280|Ga0182068_1496864 | Not Available | 807 | Open in IMG/M |
| 3300019281|Ga0182077_1078148 | Not Available | 619 | Open in IMG/M |
| 3300019282|Ga0182075_1365224 | Not Available | 972 | Open in IMG/M |
| 3300019283|Ga0182058_1458215 | Not Available | 759 | Open in IMG/M |
| 3300020165|Ga0206125_10102131 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300020175|Ga0206124_10054376 | All Organisms → Viruses → Predicted Viral | 1748 | Open in IMG/M |
| 3300020178|Ga0181599_1022533 | All Organisms → Viruses → Predicted Viral | 3638 | Open in IMG/M |
| 3300020194|Ga0181597_10128304 | All Organisms → Viruses → Predicted Viral | 1340 | Open in IMG/M |
| 3300020278|Ga0211606_1037952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 996 | Open in IMG/M |
| 3300020349|Ga0211511_1126924 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 581 | Open in IMG/M |
| 3300020377|Ga0211647_10040777 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1745 | Open in IMG/M |
| 3300020379|Ga0211652_10013401 | All Organisms → Viruses → Predicted Viral | 2460 | Open in IMG/M |
| 3300020403|Ga0211532_10228633 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 733 | Open in IMG/M |
| 3300020421|Ga0211653_10000752 | Not Available | 18749 | Open in IMG/M |
| 3300020421|Ga0211653_10048558 | Not Available | 1929 | Open in IMG/M |
| 3300020438|Ga0211576_10010078 | Not Available | 6011 | Open in IMG/M |
| 3300020438|Ga0211576_10014824 | All Organisms → Viruses → Predicted Viral | 4836 | Open in IMG/M |
| 3300020438|Ga0211576_10253860 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 923 | Open in IMG/M |
| 3300020469|Ga0211577_10420457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300021356|Ga0213858_10568839 | Not Available | 518 | Open in IMG/M |
| 3300021957|Ga0222717_10010474 | Not Available | 6455 | Open in IMG/M |
| 3300021957|Ga0222717_10122933 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
| 3300021957|Ga0222717_10337085 | Not Available | 851 | Open in IMG/M |
| 3300021957|Ga0222717_10382879 | Not Available | 782 | Open in IMG/M |
| 3300021958|Ga0222718_10000942 | Not Available | 29510 | Open in IMG/M |
| 3300021958|Ga0222718_10025317 | All Organisms → Viruses | 4047 | Open in IMG/M |
| 3300021958|Ga0222718_10106083 | All Organisms → Viruses → Predicted Viral | 1648 | Open in IMG/M |
| 3300021958|Ga0222718_10133561 | All Organisms → Viruses → Predicted Viral | 1420 | Open in IMG/M |
| 3300021958|Ga0222718_10145198 | All Organisms → Viruses → Predicted Viral | 1345 | Open in IMG/M |
| 3300021958|Ga0222718_10400035 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 686 | Open in IMG/M |
| 3300021958|Ga0222718_10550465 | Not Available | 549 | Open in IMG/M |
| 3300021959|Ga0222716_10766212 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 504 | Open in IMG/M |
| 3300021960|Ga0222715_10361158 | Not Available | 806 | Open in IMG/M |
| 3300021964|Ga0222719_10039137 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3673 | Open in IMG/M |
| 3300021964|Ga0222719_10150898 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1638 | Open in IMG/M |
| 3300021964|Ga0222719_10164069 | All Organisms → Viruses → Predicted Viral | 1554 | Open in IMG/M |
| 3300021964|Ga0222719_10532964 | Not Available | 697 | Open in IMG/M |
| 3300021964|Ga0222719_10593021 | Not Available | 646 | Open in IMG/M |
| 3300022198|Ga0196905_1015266 | All Organisms → Viruses → Predicted Viral | 2472 | Open in IMG/M |
| 3300022914|Ga0255767_1244923 | Not Available | 693 | Open in IMG/M |
| 3300023115|Ga0255760_10142107 | All Organisms → Viruses → Predicted Viral | 1366 | Open in IMG/M |
| 3300023116|Ga0255751_10043101 | All Organisms → Viruses | 3166 | Open in IMG/M |
| 3300023170|Ga0255761_10456315 | Not Available | 616 | Open in IMG/M |
| 3300023170|Ga0255761_10506593 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 568 | Open in IMG/M |
| 3300023176|Ga0255772_10369490 | Not Available | 733 | Open in IMG/M |
| 3300023176|Ga0255772_10498776 | Not Available | 587 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10359861 | Not Available | 540 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10010633 | Not Available | 7436 | Open in IMG/M |
| 3300024346|Ga0244775_11089684 | Not Available | 627 | Open in IMG/M |
| 3300024428|Ga0233396_1038071 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300025151|Ga0209645_1071102 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
| 3300025483|Ga0209557_1007777 | All Organisms → Viruses → Predicted Viral | 4346 | Open in IMG/M |
| 3300025508|Ga0208148_1008567 | All Organisms → Viruses → Predicted Viral | 3216 | Open in IMG/M |
| 3300025641|Ga0209833_1087103 | Not Available | 934 | Open in IMG/M |
| 3300025666|Ga0209601_1023425 | Not Available | 2325 | Open in IMG/M |
| 3300025699|Ga0209715_1043787 | All Organisms → Viruses → Predicted Viral | 1977 | Open in IMG/M |
| 3300025759|Ga0208899_1193275 | Not Available | 653 | Open in IMG/M |
| 3300025759|Ga0208899_1211615 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 607 | Open in IMG/M |
| 3300025771|Ga0208427_1047830 | All Organisms → Viruses → Predicted Viral | 1586 | Open in IMG/M |
| 3300025816|Ga0209193_1040099 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
| 3300025818|Ga0208542_1136685 | Not Available | 676 | Open in IMG/M |
| 3300025869|Ga0209308_10080133 | All Organisms → Viruses → Predicted Viral | 1630 | Open in IMG/M |
| 3300025880|Ga0209534_10152453 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
| 3300025881|Ga0209309_10016935 | All Organisms → Viruses → Predicted Viral | 4986 | Open in IMG/M |
| 3300025886|Ga0209632_10168655 | Not Available | 1187 | Open in IMG/M |
| 3300026136|Ga0208763_1004417 | All Organisms → Viruses → Predicted Viral | 2306 | Open in IMG/M |
| 3300026183|Ga0209932_1055529 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 943 | Open in IMG/M |
| 3300026257|Ga0208407_1025360 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Stylophora → Stylophora pistillata | 2084 | Open in IMG/M |
| 3300027780|Ga0209502_10194596 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 938 | Open in IMG/M |
| 3300027859|Ga0209503_10210321 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 936 | Open in IMG/M |
| 3300028196|Ga0257114_1031934 | All Organisms → Viruses → Predicted Viral | 2464 | Open in IMG/M |
| 3300032088|Ga0315321_10872504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 505 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 26.70% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 10.23% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.09% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.09% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.95% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.25% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.98% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.98% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.41% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.84% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.27% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.70% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.70% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.14% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.14% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.14% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.14% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.57% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.57% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.57% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.57% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.57% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.57% |
| Volcanic Co2 Seep | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep | 0.57% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.57% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.57% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.57% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
| 3300001971 | Marine microbial communities from the Sargasso Sea - GS000c | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006404 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007144 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', waterEBic1 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016741 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016745 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016762 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019277 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019280 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019282 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020278 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556076-ERR599151) | Environmental | Open in IMG/M |
| 3300020349 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022914 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG | Environmental | Open in IMG/M |
| 3300023115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101484403 | 3300000101 | Marine | MYLLLAGIVVLSVSQMFLWMDQMQLWQQLNLHLMLSNNPS |
| DelMOSum2011_100676163 | 3300000115 | Marine | MNKIYTYLILAGIVILSVSQIYLWKDQMELWQQLNLHMMLDVSK |
| DelMOSpr2010_101286481 | 3300000116 | Marine | MKKIYTALILISIVVLSVSQMYLWKDQRQMWQQFDLHLKL |
| DelMOWin2010_100500232 | 3300000117 | Marine | MNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV* |
| BBAY92_100916303 | 3300000947 | Macroalgal Surface | MNKIYMYLILVGIVVLSVSQIYLWKDQMELWYQLNLHLM |
| BBAY93_100479143 | 3300000973 | Macroalgal Surface | MNKIYMYLILVGIVVLSVSQIYLWKDQMELWYQLNLHLMLDGSKGV* |
| JGI20152J14361_100247124 | 3300001344 | Pelagic Marine | MNKIYLYLILAGIIVLSVSQMFLWLDQMEMWKQFNLHLMIDGSQSV* |
| JGI20152J14361_100595063 | 3300001344 | Pelagic Marine | VNKIYMYLILAGIVVLSISQVFLWMDQIQLWQQLNLHLMLTINPSTPI* |
| JGI20156J14371_101274822 | 3300001347 | Pelagic Marine | VNKIYMYLLLAGIVVLSVSQMFLWMDQMQLWQQLNLHLMLSNNPSTPI* |
| JGI20159J14440_100398212 | 3300001353 | Pelagic Marine | MYLILAGIVVLSISQMFLWMDQIQLWQQLNLHLMLTNNPSTPI* |
| JGI11705J14877_101589022 | 3300001419 | Saline Water And Sediment | MKRIYLILILLSLVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV* |
| JGI24003J15210_100090817 | 3300001460 | Marine | MNKIYLYLILASIVVLSVSQMFLWMDQMQLWQQLNLHLMLSNNPSTPI* |
| GOS2218_10336924 | 3300001947 | Marine | MNKIYTYLILAGIVILSVSQIYLWKDQMELWQQLNLHMMLDVSKSV* |
| GOS2249_10507683 | 3300001951 | Marine | VNKIYLFLILAGIVVLSVSQIFLWMDQMEMWEQFNLHLMVDGSKPV* |
| GOS2215_100413243 | 3300001971 | Marine | VNKIYLFLILAGIVVLSVSQIFLWMDQMEMWEHFNLHLMIDGSKPV* |
| JGI25132J35274_10485602 | 3300002483 | Marine | MNKIYLYLILAGIVVLSVSQMFLWMDQMEMWKQFNLHLMLEGATAI* |
| Ga0055584_1010562742 | 3300004097 | Pelagic Marine | MKRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV* |
| Ga0066849_100241624 | 3300005430 | Marine | MNKIYLYLILVGIVVLSLSQIYLWKDQMEMWYEFNLHLMLDGSKPV* |
| Ga0066830_100037152 | 3300005433 | Marine | MKKIYLYLILAGIFILSVSQIFLWMDQMEMWHHFNLHLMLEGSKPV* |
| Ga0066825_102859181 | 3300005510 | Marine | VNKYDIKEKLMNKIYLYLILVGIVVLSLSQIYLWKDQMEMWHQFNLHLMLDGSKSV* |
| Ga0074648_10312712 | 3300005512 | Saline Water And Sediment | MKRIYLILILLSVVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV* |
| Ga0076924_10696622 | 3300005747 | Marine | MNKIYIYLILAGIVILSVSQIYLWKDQMELWYQFNLHLMLDGSKGV* |
| Ga0075474_102493652 | 3300006025 | Aqueous | GMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV* |
| Ga0075478_102718822 | 3300006026 | Aqueous | HQGMNKIYIYLILAGIVILSVSQIYLWKDQIELWYQLNLHLMLDGSKGV* |
| Ga0075514_19387702 | 3300006403 | Aqueous | MRRTYLILNLLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV* |
| Ga0075515_108327582 | 3300006404 | Aqueous | PVRQVQEMRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV* |
| Ga0098037_11320882 | 3300006737 | Marine | MNKIYMYLILAGIVVLSVSQIFLWMDQMQLWQQLNLHLMLSNNPSTPV* |
| Ga0098055_10246522 | 3300006793 | Marine | MNKIYTYLILAGIVILSVSQIYLWKDQMQLWYQLNLHMMLDGSKSV* |
| Ga0075476_100500811 | 3300006867 | Aqueous | MKRIYLILILFSIVVLSISNIYLWKDRQQMWHQFNLHLMLDGSKGV* |
| Ga0075481_103222421 | 3300006868 | Aqueous | MNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLH |
| Ga0075477_102884032 | 3300006869 | Aqueous | MNKIYIYLILVGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV* |
| Ga0075479_101832701 | 3300006870 | Aqueous | NRGHQGMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV* |
| Ga0101666_10100793 | 3300007113 | Volcanic Co2 Seep Seawater | MNKIYIYLILAGIVVLYVSQMFLWMAQIEMWKQFNLHLMLEGATAI* |
| Ga0101670_10264532 | 3300007144 | Volcanic Co2 Seep | MNKIYIYLILAGIVVLSVSQMFLWMDQIEMWKQFNLHLMLEGATAI* |
| Ga0075460_102128303 | 3300007234 | Aqueous | MKRIYLILILLSVVVLSISNIYLWKDRQQMWYQFNLH |
| Ga0099851_10240214 | 3300007538 | Aqueous | MNKIYIYLILAGIVILSVSQIYLWKDQMQLWYQLNLHLMLDGSKGV* |
| Ga0102954_11569512 | 3300007778 | Water | MNKIYTYLILVGIVVLSVSQIFLWMDQMELWQQFNLHLMLDGSKGV* |
| Ga0102960_10387132 | 3300009000 | Pond Water | MKRIYLILILFSIVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV* |
| Ga0102960_10922553 | 3300009000 | Pond Water | MRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV* |
| Ga0102960_11789462 | 3300009000 | Pond Water | MNKIDMYLILVGIVVLSVSQIFLWMDQMELWQQFNLHLMLDGSKGV* |
| Ga0102963_10719392 | 3300009001 | Pond Water | MKRIYLILILLSIVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV* |
| Ga0102963_12690451 | 3300009001 | Pond Water | MKRIYLILILLSVVVLSVSNIYLWKDRQQMWYQFNLHLML |
| Ga0102957_12613612 | 3300009027 | Pond Water | MKRIYLILILLSVVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV* |
| Ga0115566_101258662 | 3300009071 | Pelagic Marine | MNKIYTYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV* |
| Ga0115552_11285562 | 3300009077 | Pelagic Marine | MNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHMMLDDSKGV* |
| Ga0102814_105364031 | 3300009079 | Estuarine | MKRIYLILILLSIVVLSVSNIYMWKDRQQMWYQFNLHLMLDGSK |
| Ga0118687_100079843 | 3300009124 | Sediment | MKRIYLILILLSIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV* |
| Ga0115551_10311612 | 3300009193 | Pelagic Marine | MYLLLAGIVVLSVSQMFLWMDQMQLWQQLNLHLMLSNNPSTPI* |
| Ga0114994_101078973 | 3300009420 | Marine | MNKIYMYLILASIVVLSVSQMFLWMDQMQLWQQLNLHLMLGGSKPV* |
| Ga0115556_11570913 | 3300009437 | Pelagic Marine | MNKIYTYLILAGIVILSVSQIYLWKDQMQLWYELNLHMMLDG |
| Ga0115553_10548822 | 3300009445 | Pelagic Marine | MYLILAGIVVLSISQIFLWMDQMQLWQQLNLHLMLSNNPSTPI* |
| Ga0115555_10509993 | 3300009476 | Pelagic Marine | MNKIYTYLILAGIVILSVSQIYLWKDQMQLWYELNLHMMLDGSKSV* |
| Ga0115571_12476131 | 3300009495 | Pelagic Marine | MNKIYTYLILAGIVILSVSQIYLWKDQMQLWYELN |
| Ga0115568_100185652 | 3300009498 | Pelagic Marine | MNKIYTYLILAGIVILSMSQIYLWKDQMQLWYQLNLHMMLDGSKSV* |
| Ga0115564_100517015 | 3300009505 | Pelagic Marine | VNKIYMYLILAGIVVLSISQMFLWMDQIQLWQQLNLHLMLTNNPSTPI* |
| Ga0115572_100691302 | 3300009507 | Pelagic Marine | MNKIYLYLILAGIIVLSVSQMFLWLDQMEMWKQFNLHLMIDGRQSV* |
| Ga0129351_13281552 | 3300010300 | Freshwater To Marine Saline Gradient | MRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLD |
| Ga0163110_101134353 | 3300012928 | Surface Seawater | MKKIYLYLILAGIFILSVSQIFLWMDQMEMWHHFNLHLMLEGSTPV* |
| Ga0163110_105755681 | 3300012928 | Surface Seawater | MKKIYLYLILAGIVILSVSQIFLWMDQMEMWKQFN |
| Ga0163109_101413083 | 3300012936 | Surface Seawater | MKKIYLYLILAGIVVLSVSQIFLWMDQMEMWKQFNLHLMLDGSQPV* |
| Ga0163111_103051992 | 3300012954 | Surface Seawater | MKKIYLYLILASIFILSVSQIFLWMDQMEMWHHFNLHLMLEGSKPV* |
| Ga0163111_117755071 | 3300012954 | Surface Seawater | MNKIYLYLILAGIVILSVSQIFLWMDQMEMWKQFNLHLMLDGSQPV* |
| Ga0163111_119126131 | 3300012954 | Surface Seawater | RMNKIYTYLILAGIVILSMSQIYLWKDQMQLWHQLNLHMMLDGSKSA* |
| Ga0182079_12413542 | 3300016741 | Salt Marsh | MKRIYLILILLSVVVLSISNIYLLKDRQQMWYQFNLHLMLDGSKGV |
| Ga0182093_10296061 | 3300016745 | Salt Marsh | SNRGHQGMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0182078_101024422 | 3300016747 | Salt Marsh | LILLSILVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0182078_108290621 | 3300016747 | Salt Marsh | MRRTYLILILIGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKHI |
| Ga0182084_15512672 | 3300016762 | Salt Marsh | RIYLILILFSIVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0182095_18910331 | 3300016791 | Salt Marsh | EMRRTYLILILIGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0180120_100524392 | 3300017697 | Freshwater To Marine Saline Gradient | MNKIYTYLILAGIVILSVSQIYLWKDQMELWQQLNLHMMLDGSKSV |
| Ga0180120_100714212 | 3300017697 | Freshwater To Marine Saline Gradient | QGMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQFNLHLMLDGSKGV |
| Ga0181397_11771612 | 3300017744 | Seawater | MNKIYLYLILASIVVLSVSQMFLWMDQMQLWQQLNLHLMLSN |
| Ga0181393_11546641 | 3300017748 | Seawater | PVHEESNRGYKRMNKIYTYLILAGIVILSVSQIYLWKDQMQLWYELNLHMMLDGSKSV |
| Ga0181409_12191502 | 3300017758 | Seawater | MNKIYLYLILASIVVLSVAQMFFWMDQMQLWQQLNLHLMLSNNPSTPI |
| Ga0181423_11309611 | 3300017781 | Seawater | NKIYTYLILAGIVILSVSQIYLWKDQMQLWYQLNLHMMLDGSKSV |
| Ga0181380_11099561 | 3300017782 | Seawater | KRMNKIYTYLILAGIVILSVSQIYLWKDQMQLWHQLNLHMMLDGSKSV |
| Ga0181584_105538862 | 3300017949 | Salt Marsh | MKRIYLILILLSVVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0181584_106740031 | 3300017949 | Salt Marsh | MKRIYLILILLSVVVLSISNIYLWKDRQQMWYQFNLHLMLDGGKGV |
| Ga0181607_104774783 | 3300017950 | Salt Marsh | MRRTYLILILLGIMVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0181607_105971092 | 3300017950 | Salt Marsh | YLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0181577_101288032 | 3300017951 | Salt Marsh | MNKIYIYLILAGIVILSVSQIYLWKDQMELWHQLNLHLMLDGSKGV |
| Ga0181577_103077322 | 3300017951 | Salt Marsh | MNKIYMYLILAGIVVLSVSQIFLWMDQMELWQQFNLHLMLEGSKPV |
| Ga0181583_107036652 | 3300017952 | Salt Marsh | MNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0181580_110365241 | 3300017956 | Salt Marsh | LLPRQVQPKNCVNKYDIKEKLMNKIYLYLILVGIVVLSLSQIYLWKDQMEMWHQFNLHLMLDGSKPV |
| Ga0181582_104082064 | 3300017958 | Salt Marsh | MKRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0181582_105501172 | 3300017958 | Salt Marsh | LGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0181590_102944051 | 3300017967 | Salt Marsh | ILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKHI |
| Ga0181587_106436051 | 3300017968 | Salt Marsh | NRGHQGMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0181576_106897611 | 3300017985 | Salt Marsh | MMNKIYMYLILAGIVVLSVSQIFLWMDQMELWQQFNLHLMLEGSKPV |
| Ga0181600_105837372 | 3300018036 | Salt Marsh | EESNRGHQGMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQFNLHLMLDGSKGV |
| Ga0181579_103430121 | 3300018039 | Salt Marsh | ILILLSVVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0181561_101777083 | 3300018410 | Salt Marsh | MRHTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0181559_102455641 | 3300018415 | Salt Marsh | MRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGGKGV |
| Ga0181559_102956432 | 3300018415 | Salt Marsh | MNKIYIYLILAGIVILSVSQIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0181567_103342123 | 3300018418 | Salt Marsh | MKRIYLILILLSVVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKHI |
| Ga0181592_106915983 | 3300018421 | Salt Marsh | MKRIYLILILLSILVLSVSNIYLWKDRQQMWYQFNLHLMLEGSKGV |
| Ga0181593_101275871 | 3300018423 | Salt Marsh | IYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0181593_102225031 | 3300018423 | Salt Marsh | ILLSVVVLSISNIYLWKDRQQMWYQFNLHLMLDGGKGV |
| Ga0181593_108536951 | 3300018423 | Salt Marsh | TYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKHI |
| Ga0181593_108790272 | 3300018423 | Salt Marsh | NKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0181593_112170262 | 3300018423 | Salt Marsh | MRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSK |
| Ga0181568_104507312 | 3300018428 | Salt Marsh | GIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0182081_15633223 | 3300019277 | Salt Marsh | MRRTYLILILIGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0182068_10742722 | 3300019280 | Salt Marsh | MRRTYLILILFGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0182068_14968641 | 3300019280 | Salt Marsh | NGNLRHADSIPIRQVQEMRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0182077_10781483 | 3300019281 | Salt Marsh | MRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFN |
| Ga0182075_13652243 | 3300019282 | Salt Marsh | MRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0182058_14582152 | 3300019283 | Salt Marsh | GHQGMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0206125_101021311 | 3300020165 | Seawater | MNKIYTYLILAGIVILSMSQIYLWKDQMQLWYQLNLHMMLDG |
| Ga0206124_100543762 | 3300020175 | Seawater | MNKIYLYLILAGIIVLSVSQMFLWLDQMEMWKQFNLHLMIDGSQSV |
| Ga0181599_10225335 | 3300020178 | Salt Marsh | MNKIYIYLILAGIVILSVSQIYLWKDQMELWYQFNLHLMLDGSKGV |
| Ga0181597_101283042 | 3300020194 | Salt Marsh | ILAGIVILSVSQIYLWKDQMELWYQFNLHLMLDGSKGV |
| Ga0211606_10379522 | 3300020278 | Marine | VNKIYLFLILAGIVVLSVSQIFLWMDQMEMWEQFNLHLMVDGSKPV |
| Ga0211511_11269242 | 3300020349 | Marine | MNKIYLYLILASIVVLSVSQMFLWMDQMQLWQQLNLHLMLSNNPSTPI |
| Ga0211647_100407772 | 3300020377 | Marine | MKKIYLYLILAGIFILSVSQIFLWMDQMEMWHHFNLHLMLEGSTPV |
| Ga0211652_100134014 | 3300020379 | Marine | MNKIYMYLILAGIVVLSVSQIFLWMDQIEMWKQFNLHLMLDGSQPV |
| Ga0211532_102286332 | 3300020403 | Marine | MKKIYLYLILAGIVVLSVSQIFLWMDQMEMWHHFNLHLMLEGSKPV |
| Ga0211653_100007521 | 3300020421 | Marine | LAGIVVLSVSQIFLWMDQIEMWKQFNLHLMLDGSQPV |
| Ga0211653_100485581 | 3300020421 | Marine | KRMNKIYMYLILAGIVVLSVSQIFLWMDQMEMWKQFNLHLMIEGSQPV |
| Ga0211576_1001007812 | 3300020438 | Marine | ESNRGDKRMNKIYTYLILAGIVILSVSQIYLWKDQMQLWYELNLHMMLDGSKSV |
| Ga0211576_100148249 | 3300020438 | Marine | MNKIYTYLILAGIVILSVSQIYLWKDQMQLWYELNLHMMLDGSKSV |
| Ga0211576_102538602 | 3300020438 | Marine | ESNRGDKRMNKIYTYLILAGIVILSVSQIYLWKDQMQLWYQLNLHMMLDGSKSV |
| Ga0211577_104204571 | 3300020469 | Marine | MYLILAGIVVLSVSQMFLWMDQMQLWQQLNLHLMLSNNPSTPI |
| Ga0213858_105688392 | 3300021356 | Seawater | MKRIYLILILLSVVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0222717_100104749 | 3300021957 | Estuarine Water | MNKIYTYLILAGIVILSVSQIYLWKDQMQLWYQLNLHMMLDGSKSV |
| Ga0222717_101229332 | 3300021957 | Estuarine Water | MNKIYMYLILVGIVVLSVSQIFLWMDQMELWQQFNLHLMLDGSKGV |
| Ga0222717_103370854 | 3300021957 | Estuarine Water | MRRTYLILILLSIVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0222717_103828793 | 3300021957 | Estuarine Water | MKRIYLILILFSIVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0222718_1000094246 | 3300021958 | Estuarine Water | MKRIYLILILLSIVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKPV |
| Ga0222718_100253173 | 3300021958 | Estuarine Water | MRRIYLILILLSILVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0222718_101060831 | 3300021958 | Estuarine Water | MNKIYMYLILVGIVVLSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0222718_101335613 | 3300021958 | Estuarine Water | MKRIYLILILLSIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0222718_101451981 | 3300021958 | Estuarine Water | HQRMNKIYMYLILVGIVVLSVSQIFLWMDQMELWQQFNLHLMLEGSKPV |
| Ga0222718_104000352 | 3300021958 | Estuarine Water | MNKIYMYLILVGIVVLSVSQIYLWMDQMELWQQFNLHLMLEGSKPV |
| Ga0222718_105504652 | 3300021958 | Estuarine Water | MKRIYLILILFSIVVLSISNIYLWKDRQQMWHQFNLHLMLDGSKGV |
| Ga0222716_107662121 | 3300021959 | Estuarine Water | YLILILLSIVVLSISNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0222715_103611581 | 3300021960 | Estuarine Water | MKRIYLILILLSVVVLSISNIYLWKDRQQMWYQFNLHLML |
| Ga0222719_100391373 | 3300021964 | Estuarine Water | LVGDEVQTKNVGGHQRMKKIYLYLILAGIVVLSVSQIFLWMDQMEMWHHFNLHLMLEGSKPV |
| Ga0222719_101508982 | 3300021964 | Estuarine Water | MNKIYLYLILAGIIVLSVSQIFLWMDQMELWQQFNLHLMLEGSKPV |
| Ga0222719_101640692 | 3300021964 | Estuarine Water | MNKIYIYLILAGIVILSVSQIYLWKDQIELWHQLNLHLMLDGSKGV |
| Ga0222719_105329643 | 3300021964 | Estuarine Water | MKHRYLILILLSVVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0222719_105930211 | 3300021964 | Estuarine Water | NKIYTYLILAGIVILSVSQIFLWMDQMELWQQFNLHLMLDGSKGV |
| Ga0196905_10152662 | 3300022198 | Aqueous | MNKIYIYLILAGIVILSVSQIYLWKDQMQLWYQLNLHLMLDGSKGV |
| Ga0255767_12449233 | 3300022914 | Salt Marsh | MRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKHI |
| Ga0255760_101421071 | 3300023115 | Salt Marsh | ESNRGHQGMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0255751_100431011 | 3300023116 | Salt Marsh | HQGMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0255761_104563153 | 3300023170 | Salt Marsh | MKRIYLILILLSVVVLSISNIYLWKDRQQMWYQFN |
| Ga0255761_105065932 | 3300023170 | Salt Marsh | MNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGS |
| Ga0255772_103694901 | 3300023176 | Salt Marsh | MRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNLHLM |
| Ga0255772_104987762 | 3300023176 | Salt Marsh | LILLGIVVLSVSNIYLWKDRQQMWYQFNLHLMLDGSKHI |
| (restricted) Ga0233438_103598612 | 3300024255 | Seawater | IYMYLILAGIVVLSISQVFLWMDQIQLWQQLNLHLMLTNNPSTPI |
| (restricted) Ga0233444_100106332 | 3300024264 | Seawater | MNKIYTYLILAGIVILSISQIYLWKDQMQLWHELNLHMMLDGSKSA |
| Ga0244775_110896842 | 3300024346 | Estuarine | MKRTYLILILLSIVVLSVSNIYMWKDRQQMWYQFNLHLMLDGSKGV |
| Ga0233396_10380711 | 3300024428 | Seawater | MNKIYLYLILASIVVLSVSQMFLWMDQMQLWQQLNLHLML |
| Ga0209645_10711023 | 3300025151 | Marine | MNKIYLYLILAGIVVLSVSQMFLWMDQMEMWKQFNLHLMLEGATAI |
| Ga0209557_10077777 | 3300025483 | Marine | MNKIYMYLILAGIVVLSISQVFLWMDQIQLWQQLNLHLMLTNNPSTPI |
| Ga0208148_10085675 | 3300025508 | Aqueous | MNKIYMYLILAGIVVLSISQIFLWLDQVEMWHQFNLHLMLEGSKPV |
| Ga0209833_10871032 | 3300025641 | Pelagic Marine | MNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDDSKGV |
| Ga0209601_10234253 | 3300025666 | Pelagic Marine | MYLILAGIVVLSISQMFLWMDQIQLWQQLNLHLMLTNNPSTPI |
| Ga0209715_10437875 | 3300025699 | Pelagic Marine | MYLILAGIVVLSISQMFLWMDQIQLWQQLNLHLMLTINPSTPI |
| Ga0208899_11932752 | 3300025759 | Aqueous | HEESNRGHQGMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQFNLHLMLDGSKGV |
| Ga0208899_12116151 | 3300025759 | Aqueous | MNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLML |
| Ga0208427_10478302 | 3300025771 | Aqueous | NRGHQGMNKIYIYLILVGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0209193_10400991 | 3300025816 | Pelagic Marine | QGMNKIYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0208542_11366853 | 3300025818 | Aqueous | MRRTYLILILLGIVVLSVSNIYLWKDRQQMWYQFNL |
| Ga0209308_100801332 | 3300025869 | Pelagic Marine | MNKIYTYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0209534_101524532 | 3300025880 | Pelagic Marine | MNKTYIYLILAGIVILSVSQIYLWKDQMELWYQLNLHLMLDGSKGV |
| Ga0209309_100169353 | 3300025881 | Pelagic Marine | MNKIYTYLILAGIVILSMSQIYLWKDQMQLWYQLNLHMMLDGSKSV |
| Ga0209632_101686552 | 3300025886 | Pelagic Marine | NRRSRVNKIYMYLILAGIVVLSISQIFLWLDQVEMWHQFNLHLMLEGSKPV |
| Ga0208763_10044172 | 3300026136 | Marine | MKKIYLYLILAGIFILSVSQIFLWMDQMEMWHHFNLHLMLEGSKPV |
| Ga0209932_10555292 | 3300026183 | Pond Water | MNKIYMYLILVGIVVLSVSQIFLWMDQMELWQQFNLHLMLEGSKPV |
| Ga0208407_10253603 | 3300026257 | Marine | MNKIYLYLILVGIVVLSLSQIYLWKDQMEMWYEFNLHLMLDGSKPV |
| Ga0209502_101945962 | 3300027780 | Marine | MNKIYMYLILASIVVLSVSQMFLWMDQMQLWQQLNLHLMLGGSKPV |
| Ga0209503_102103212 | 3300027859 | Marine | MNKIYMYLILAGIVVLSVSQIFLWMDQMQLWQQLNLHLMLSNNPSTPV |
| Ga0257114_10319342 | 3300028196 | Marine | VNKIYLYLILAGIVVLSISQMFLWMDQMQLWQQLNLHMMLDGSKSV |
| Ga0315321_108725042 | 3300032088 | Seawater | MKKIYIYLILLSIIVLSISQIYLWKDNMEMWYQFNLHLMVDGSKSVXKK |
| ⦗Top⦘ |