NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033898

Metagenome / Metatranscriptome Family F033898

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033898
Family Type Metagenome / Metatranscriptome
Number of Sequences 176
Average Sequence Length 45 residues
Representative Sequence KPEQYRIKVVEEAPTSVVSVQDPNGAPDKTQNSEKILALLKDQLK
Number of Associated Samples 151
Number of Associated Scaffolds 176

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.14 %
% of genes near scaffold ends (potentially truncated) 98.30 %
% of genes from short scaffolds (< 2000 bps) 92.05 %
Associated GOLD sequencing projects 142
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(10.227 % of family members)
Environment Ontology (ENVO) Unclassified
(36.932 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.636 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.18%    β-sheet: 2.74%    Coil/Unstructured: 78.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 176 Family Scaffolds
PF12706Lactamase_B_2 44.32
PF00753Lactamase_B 39.20
PF01259SAICAR_synt 10.80
PF08007JmjC_2 1.70
PF13432TPR_16 0.57
PF00583Acetyltransf_1 0.57
PF00701DHDPS 0.57
PF01740STAS 0.57
PF02754CCG 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 176 Family Scaffolds
COG0152Phosphoribosylaminoimidazole-succinocarboxamide synthaseNucleotide transport and metabolism [F] 10.80
COG2850Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domainTranslation, ribosomal structure and biogenesis [J] 1.70
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.14
COG0247Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcFEnergy production and conversion [C] 0.57
COG2048Heterodisulfide reductase, subunit BEnergy production and conversion [C] 0.57

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090009|LWAnN_F624WLL02G234GAll Organisms → cellular organisms → Bacteria504Open in IMG/M
2088090009|LWAnN_GIDYKCY01AQA8HAll Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria507Open in IMG/M
2170459017|G1E9HNB15JKYWUAll Organisms → cellular organisms → Bacteria502Open in IMG/M
3300003861|Ga0031654_10044695All Organisms → cellular organisms → Bacteria → Proteobacteria1252Open in IMG/M
3300004067|Ga0055485_10119080All Organisms → cellular organisms → Bacteria → Proteobacteria692Open in IMG/M
3300004155|Ga0066600_10116117All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1067Open in IMG/M
3300004157|Ga0062590_100419313All Organisms → cellular organisms → Bacteria → Proteobacteria1106Open in IMG/M
3300005187|Ga0066675_10609722All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria820Open in IMG/M
3300005327|Ga0070658_10756765All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria844Open in IMG/M
3300005328|Ga0070676_10145258All Organisms → cellular organisms → Bacteria → Proteobacteria1514Open in IMG/M
3300005328|Ga0070676_10395624All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria960Open in IMG/M
3300005334|Ga0068869_101779178All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales551Open in IMG/M
3300005337|Ga0070682_102017373All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300005338|Ga0068868_100591149All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria982Open in IMG/M
3300005338|Ga0068868_101090795All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria734Open in IMG/M
3300005340|Ga0070689_101228623All Organisms → cellular organisms → Bacteria → Proteobacteria673Open in IMG/M
3300005356|Ga0070674_101675878All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria575Open in IMG/M
3300005440|Ga0070705_101633725All Organisms → cellular organisms → Bacteria → Proteobacteria543Open in IMG/M
3300005458|Ga0070681_10502508All Organisms → cellular organisms → Bacteria → Proteobacteria1126Open in IMG/M
3300005458|Ga0070681_10733864All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales904Open in IMG/M
3300005530|Ga0070679_100695216All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans960Open in IMG/M
3300005543|Ga0070672_101290427All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria652Open in IMG/M
3300005546|Ga0070696_101655277All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria551Open in IMG/M
3300005548|Ga0070665_100070289All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3508Open in IMG/M
3300005553|Ga0066695_10387142All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria870Open in IMG/M
3300005563|Ga0068855_101951025All Organisms → cellular organisms → Bacteria → Proteobacteria594Open in IMG/M
3300005577|Ga0068857_101604664All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales635Open in IMG/M
3300005764|Ga0066903_102797317All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria947Open in IMG/M
3300005841|Ga0068863_100096954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2799Open in IMG/M
3300005843|Ga0068860_100666714All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1048Open in IMG/M
3300005843|Ga0068860_100717824All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1010Open in IMG/M
3300005844|Ga0068862_101680857All Organisms → cellular organisms → Bacteria → Proteobacteria643Open in IMG/M
3300006047|Ga0075024_100085155All Organisms → cellular organisms → Bacteria → Proteobacteria1367Open in IMG/M
3300006175|Ga0070712_100954472All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales741Open in IMG/M
3300006354|Ga0075021_11099088All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria520Open in IMG/M
3300006358|Ga0068871_102199831All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria526Open in IMG/M
3300006578|Ga0074059_11832641All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria905Open in IMG/M
3300006881|Ga0068865_100636425All Organisms → cellular organisms → Bacteria → Proteobacteria905Open in IMG/M
3300006881|Ga0068865_101907260All Organisms → cellular organisms → Bacteria → Proteobacteria538Open in IMG/M
3300009094|Ga0111539_12780428All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300009095|Ga0079224_104558580All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300009100|Ga0075418_10579115All Organisms → cellular organisms → Bacteria → Proteobacteria1207Open in IMG/M
3300009111|Ga0115026_11593148All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300009131|Ga0115027_11290535All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300009162|Ga0075423_10401811All Organisms → cellular organisms → Bacteria → Proteobacteria1438Open in IMG/M
3300009179|Ga0115028_11693766All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010051|Ga0133939_1077241All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5833Open in IMG/M
3300010373|Ga0134128_13084435All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300010396|Ga0134126_11167794All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300010397|Ga0134124_10611891All Organisms → cellular organisms → Bacteria → Proteobacteria1068Open in IMG/M
3300010400|Ga0134122_10547235All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300012044|Ga0136636_10223448All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300012203|Ga0137399_11594177All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300012499|Ga0157350_1051651All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012519|Ga0157352_1063952All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012533|Ga0138256_10193616All Organisms → cellular organisms → Bacteria1821Open in IMG/M
3300012684|Ga0136614_10037748All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3628Open in IMG/M
3300012684|Ga0136614_11191400All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012903|Ga0157289_10412477All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300012912|Ga0157306_10420315All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300012944|Ga0137410_11087637All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300012957|Ga0164303_10703658All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300012971|Ga0126369_12391950All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300012984|Ga0164309_10839433All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300012985|Ga0164308_10662037All Organisms → cellular organisms → Bacteria → Proteobacteria896Open in IMG/M
3300012986|Ga0164304_10694024All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300013297|Ga0157378_11549836All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300013306|Ga0163162_11073066All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300013308|Ga0157375_10362873All Organisms → cellular organisms → Bacteria → Proteobacteria1615Open in IMG/M
3300013308|Ga0157375_13426253All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300014260|Ga0075307_1150568All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300014306|Ga0075346_1067807All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300014497|Ga0182008_10926045All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300014968|Ga0157379_12593383All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300015203|Ga0167650_1002713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae5318Open in IMG/M
3300015373|Ga0132257_100291530All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1959Open in IMG/M
3300015374|Ga0132255_103738333All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300019362|Ga0173479_10402167All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300020082|Ga0206353_11754632All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300022756|Ga0222622_11010236All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300022886|Ga0247746_1211056All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300025321|Ga0207656_10030072All Organisms → cellular organisms → Bacteria → Proteobacteria2241Open in IMG/M
3300025321|Ga0207656_10475481All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300025912|Ga0207707_10342379All Organisms → cellular organisms → Bacteria → Proteobacteria1289Open in IMG/M
3300025913|Ga0207695_10687753All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300025915|Ga0207693_11220232All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300025921|Ga0207652_11440850All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300025924|Ga0207694_11565597All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300025933|Ga0207706_10725666All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300025934|Ga0207686_10282439All Organisms → cellular organisms → Bacteria → Proteobacteria1226Open in IMG/M
3300025936|Ga0207670_11655865All Organisms → cellular organisms → Bacteria → Proteobacteria544Open in IMG/M
3300025937|Ga0207669_10043330All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2635Open in IMG/M
3300025939|Ga0207665_10270311All Organisms → cellular organisms → Bacteria → Proteobacteria1262Open in IMG/M
3300025942|Ga0207689_11626179All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300025942|Ga0207689_11718139All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300025951|Ga0210066_1051538All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300025960|Ga0207651_10486461All Organisms → cellular organisms → Bacteria → Proteobacteria1064Open in IMG/M
3300025960|Ga0207651_11417816All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300025972|Ga0207668_10122221All Organisms → cellular organisms → Bacteria1973Open in IMG/M
3300025981|Ga0207640_11501491All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300025986|Ga0207658_10410837All Organisms → cellular organisms → Bacteria → Proteobacteria1191Open in IMG/M
3300025986|Ga0207658_10881684All Organisms → cellular organisms → Bacteria → Proteobacteria814Open in IMG/M
3300025986|Ga0207658_11229696All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300026035|Ga0207703_10082928All Organisms → cellular organisms → Bacteria → Proteobacteria2677Open in IMG/M
3300026070|Ga0208423_1031605All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300026088|Ga0207641_10728668All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300026089|Ga0207648_10912806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300026089|Ga0207648_11858891All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300026281|Ga0209863_10245935All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300026550|Ga0209474_10398145All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300028381|Ga0268264_10586741All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300028652|Ga0302166_10160379All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300028743|Ga0302262_10297110All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300028865|Ga0302291_10321488All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300028868|Ga0302163_10069310All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300028869|Ga0302263_10301363All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300029984|Ga0311332_10030354All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3699Open in IMG/M
3300029984|Ga0311332_10451027All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300029989|Ga0311365_10036385All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4211Open in IMG/M
3300029989|Ga0311365_10641970All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300029989|Ga0311365_10645628All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300029990|Ga0311336_10157142All Organisms → cellular organisms → Bacteria → Proteobacteria1835Open in IMG/M
3300030000|Ga0311337_10546617All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300030000|Ga0311337_11250660All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300030047|Ga0302286_10691445All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300030048|Ga0302273_1106803All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300031232|Ga0302323_101142209All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300031546|Ga0318538_10575871All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300031562|Ga0310886_10829833All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031716|Ga0310813_10723192All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300031722|Ga0311351_10273986All Organisms → cellular organisms → Bacteria → Proteobacteria1276Open in IMG/M
3300031731|Ga0307405_11209629All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300031771|Ga0318546_10010040All Organisms → cellular organisms → Bacteria → Proteobacteria4990Open in IMG/M
3300031784|Ga0315899_11380624All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300031784|Ga0315899_11714132All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300031793|Ga0318548_10254670All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300031819|Ga0318568_10783661All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300031834|Ga0315290_10560025All Organisms → cellular organisms → Bacteria → Proteobacteria995Open in IMG/M
3300031858|Ga0310892_11169240All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300031873|Ga0315297_10647426All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300031879|Ga0306919_10237249All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1368Open in IMG/M
3300031902|Ga0302322_103119884All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300031918|Ga0311367_10239208All Organisms → cellular organisms → Bacteria1893Open in IMG/M
3300031938|Ga0308175_100242783All Organisms → cellular organisms → Bacteria → Proteobacteria1802Open in IMG/M
3300031943|Ga0310885_10020926All Organisms → cellular organisms → Bacteria → Proteobacteria2437Open in IMG/M
3300031997|Ga0315278_11098350All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300031997|Ga0315278_11883519All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300032000|Ga0310903_10765409All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300032008|Ga0318562_10242970All Organisms → cellular organisms → Bacteria → Proteobacteria1045Open in IMG/M
3300032053|Ga0315284_10543430All Organisms → cellular organisms → Bacteria → Proteobacteria1400Open in IMG/M
3300032075|Ga0310890_10092157All Organisms → cellular organisms → Bacteria1874Open in IMG/M
3300032143|Ga0315292_10305709All Organisms → cellular organisms → Bacteria → Proteobacteria1324Open in IMG/M
3300032177|Ga0315276_12350671All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300032205|Ga0307472_102100080All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300032256|Ga0315271_11400731All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300032256|Ga0315271_11559308All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300032261|Ga0306920_101992530All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300032397|Ga0315287_11950290All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300032516|Ga0315273_10124756All Organisms → cellular organisms → Bacteria → Proteobacteria3528Open in IMG/M
3300032516|Ga0315273_12371371All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300033408|Ga0316605_10212100All Organisms → cellular organisms → Bacteria → Proteobacteria1637Open in IMG/M
3300033414|Ga0316619_10904172All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria762Open in IMG/M
3300033414|Ga0316619_12058698All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300033419|Ga0316601_101517368All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300033419|Ga0316601_102280262All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales545Open in IMG/M
3300033475|Ga0310811_11156067All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300033480|Ga0316620_10300966All Organisms → cellular organisms → Bacteria → Proteobacteria1404Open in IMG/M
3300033482|Ga0316627_100077232All Organisms → cellular organisms → Bacteria2176Open in IMG/M
3300033557|Ga0316617_102234092All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300034115|Ga0364945_0226522All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300034127|Ga0370489_0222585All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300034149|Ga0364929_0095878All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300034176|Ga0364931_0181485All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300034354|Ga0364943_0260713All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300034354|Ga0364943_0408531All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300034358|Ga0370485_0124632All Organisms → cellular organisms → Bacteria760Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen10.23%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment6.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.11%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.11%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.41%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.84%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.27%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.70%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.70%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.70%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.70%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment1.14%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.14%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.14%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.14%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.14%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.14%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.14%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.14%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.14%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.14%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.14%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.57%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.57%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.57%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil0.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.57%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.57%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.57%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.57%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.57%
Industrial WastewaterEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090009Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrateEnvironmentalOpen in IMG/M
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004155Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300010051Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196EngineeredOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012044Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ852 (21.06)EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012499Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610EnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012533Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MGEngineeredOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014260Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014306Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015203Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025951Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026070Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028652Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3EnvironmentalOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028865Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030048Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034127Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034358Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LWAnN_055603002088090009Freshwater SedimentAESQPPAIVTVQDSTGAPDKSANGEKILALLKEQLK
LWAnN_025367702088090009Freshwater SedimentVEKVEQYRITVADATPRSLVTVQDPNGAPDKSATGEKILSLLRDQLK
4ZMR_048833502170459017Switchgrass, Maize And Mischanthus LitterAEADPRSLVTVQDAAGAPDKSPASEKILTLLKDQLK
Ga0031654_1004469513300003861Freshwater Lake SedimentPEQYRITVAAADPRSLVTVQDPNGAPLKSANGEKILSLLKDQLK*
Ga0055485_1011908023300004067Natural And Restored WetlandsGILDKLQFWKTDVEKVEQYRITVAEANPRSLVTVQDPSGAPDKSATGEKILSLLRDQLK*
Ga0066600_1011611713300004155FreshwaterTTEKPEQYRIKVVDTPPTSIVTVQDPKGEPDRSPSAEKILGLLRDQLK*
Ga0062590_10041931323300004157SoilEKPEQYRIVVAEADPRSLVTVQDAAGAPDKSPASEKILTLLKDQLK*
Ga0066675_1060972213300005187SoilSKDEKPEQYRITIAQSDPRSVVTVQDPGGAPDKSVTGEKILTLLKDQLK*
Ga0070658_1075676513300005327Corn RhizosphereKDKPEQYRIKVIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK*
Ga0070676_1014525813300005328Miscanthus RhizosphereDEKDKPEQYRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK*
Ga0070676_1039562423300005328Miscanthus RhizosphereIKISEVAPQSVVSVQDATGAPEVSKNSEKILALLKEQLK*
Ga0068869_10177917823300005334Miscanthus RhizosphereKPEQYRIKVVETAPQSTVSVQDPNGAPDRTQASDKILALLRDQLK*
Ga0070682_10201737323300005337Corn RhizosphereRIKVIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK*
Ga0068868_10059114923300005338Miscanthus RhizosphereGEKPEQYRIAVVESSPRSLVTVQDPKGAPDKTPASDRILALLKDQLK*
Ga0068868_10109079513300005338Miscanthus RhizosphereTDEKDKPEQYRIKVAEFAPASVVSVQDPNGSPDKTQNSEKILALLKDQLK*
Ga0070689_10122862313300005340Switchgrass RhizospherePNIEQYRITVAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK*
Ga0070674_10167587823300005356Miscanthus RhizosphereEKPEQYRIAVVESSPRSLVTVQDPKGVPDKTPASDRILALLKDQLK*
Ga0070705_10163372513300005440Corn, Switchgrass And Miscanthus RhizosphereTDVEKPEQYRITVAQADPNSLVTVEDPNGAPDKSANSEKILALLKDQLK*
Ga0070681_1050250833300005458Corn RhizosphereEQYRIKVVETAPQSTVSVQDPKGEPDRSQASDRILALLRDQLK*
Ga0070681_1073386413300005458Corn RhizospherePEQYRIKIIETSPQSTVSVQDPTGNPDKSPASDRILALLRDQLK*
Ga0070679_10069521613300005530Corn RhizosphereKDKPEQYRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK*
Ga0070672_10129042723300005543Miscanthus RhizosphereQYRIKVVETAPQSTVSVQDPNGAPDRTQASDKILALLRDQLK*
Ga0070696_10165527723300005546Corn, Switchgrass And Miscanthus RhizosphereDEKDKPEQFQIVIAGAAQNSVVSVQDPGGVPDRTATSEKILALLKDQLK*
Ga0070665_10007028913300005548Switchgrass RhizosphereWKTDDKGKPEQYQIMVAEATPISVVSVQDPGGVPDKSATSEKILTMLKDQLK*
Ga0066695_1038714213300005553SoilPEQYRITIAQSDPRSVVTVQDPGGAPDKSVTGEKILTLLKDQLK*
Ga0068855_10195102523300005563Corn RhizosphereIKIVETAPQSTVSVQDPAGNPDKSQASERILALLREQLK*
Ga0068857_10160466423300005577Corn RhizospherePEQYRIKVAQETTPQSTVSVQDPSGNPDKTQASERILALLRDQLK*
Ga0066903_10279731723300005764Tropical Forest SoilKPEQYKISVAQSDPRSIVTVQDPNGKPDKTPTGEKILSLLKDQLK*
Ga0068863_10009695463300005841Switchgrass RhizospherePEQYQIVVAESAQTSVVSVQDPGGAPDRTPTSEKILALLKDQLK*
Ga0068860_10066671433300005843Switchgrass RhizosphereAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK*
Ga0068860_10071782423300005843Switchgrass RhizosphereYRIKVVEVAPTSVVSVQDPNGTPDRTQNSDKILALLKDQLK*
Ga0068862_10168085713300005844Switchgrass RhizosphereKPEQYRITVAQADPNSLVTVQDPEGAPDKSANGEKILALLKDQLK*
Ga0075024_10008515513300006047WatershedsVAEASPISVVSVQDPGGIPDKSATSEKILTMLKDQLK*
Ga0070712_10095447223300006175Corn, Switchgrass And Miscanthus RhizosphereKDKPEQYRIKVVETAPQSTVSVQDPKGEPDRSQASDRILALLRDQLK*
Ga0075021_1109908823300006354WatershedsDKDKPEQYQIVVAETQQVSVVSVQDPGGIPDRTSASEKILSLLRDQLK*
Ga0068871_10219983123300006358Miscanthus RhizosphereTDEKDKPEQYQIVVAESAQNSVVSVQDPGGIPDRTATSEKILALLKDQLK*
Ga0074059_1183264113300006578SoilVVAETAQTSVVSVQDPGGGPDKTPASEKILSLLKDQLK*
Ga0068865_10063642513300006881Miscanthus RhizosphereDKLMFWKSDAPNIEQYRITVAEANPRSLVTVQDPNGSPDKSATGEKILSLLRDQLK*
Ga0068865_10190726023300006881Miscanthus RhizosphereDKLMFWKTDTEKVEQYRIYIAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK*
Ga0111539_1278042813300009094Populus RhizosphereVAEASPRSLVTVQDPNGSPDKSATGEKILSLLRDQLK*
Ga0079224_10455858013300009095Agricultural SoilKDEVEKPEQYRIAVVEAAPTSLVTVQDPSGAPDKSPTSDRILALLKDQLK*
Ga0075418_1057911513300009100Populus RhizosphereKPEQYRIKVVEEAPTSVVSVQDPNGAPDKTQNSEKILALLKDQLK*
Ga0115026_1159314813300009111WetlandTGERPEQYRILVAESAPPALVTVQDSNGAPDKTANGEKILSLLKDQLK*
Ga0115027_1129053513300009131WetlandKDKTGDKPEQYRIFVAESPPPSIVTVHDPNGATDKSPNSEKILSLLRDQLK*
Ga0075423_1040181113300009162Populus RhizosphereEKDKPEQFQIVIAEAAQSSVVSVQDPGGVPDRTSTSEKILALLKDQLK*
Ga0115028_1169376613300009179WetlandYRILVAESAPPALVTVQDSNGAPDKTANGEKILSLLKDQLK*
Ga0133939_107724113300010051Industrial WastewaterEAARTSLVSVQDPKGAPDKSPTSDRILALLKEQLK*
Ga0134128_1308443523300010373Terrestrial SoilQYRIKIIETSPQSTVSVQDPTGNPDKSPASDRILALLRDQLK*
Ga0134126_1116779423300010396Terrestrial SoilIKVVETAPQSTVSVQDPKGEPDRSQASDRILALLRDQLK*
Ga0134124_1061189113300010397Terrestrial SoilPEQYRIAVVESSPRSLVTVQDPKGAPDKTPASDRILALLKDQLK*
Ga0134122_1054723513300010400Terrestrial SoilMFWKTDVEKPEQYRITVAQADPNSLVTVEDPNGAPDKSANSEKILALLKDQLK*
Ga0136636_1022344823300012044Polar Desert SandAESAQASVVSVQDPGGAPDRTANSEKILGLLKEQLK*
Ga0137399_1159417713300012203Vadose Zone SoilRITVAQADPNSLVTVQDPDGAPDKSANGEKILALLKDQLK*
Ga0157350_105165133300012499Unplanted SoilFWKDKGEKPEQYKITVAQSDPRSIVTVQDPSGAPDKTATGEKILTLLKDQLK*
Ga0157352_106395213300012519Unplanted SoilTKLMFWKDKGEKPEQYKITVAQSDPRSIVTVQDPSGAPDKTATGEKILTLLKDQLK*
Ga0138256_1019361643300012533Active SludgeSEKPEQYRIAVVEAPPSSVVTVQDTKGAPDKSPASDRILALLKDQLK*
Ga0136614_1003774863300012684Polar Desert SandVAETAQTSVVSVQNPSGAPDRTPASERILSLLKDQLK*
Ga0136614_1119140023300012684Polar Desert SandYQIVVAETAQTSVVSVQNPSGAPDRTPASERILSLLKDQLK*
Ga0157289_1041247713300012903SoilQYRIYIAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK*
Ga0157306_1042031513300012912SoilASPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK*
Ga0137410_1108763713300012944Vadose Zone SoilKDEKDKPEQYRIKIVETAPQSTVSVQDPAGNPDRSPASERILALLRDQLK*
Ga0164303_1070365823300012957SoilWKTDEKDKPEQYRIKVVETAPQSTVSVQDPNGAPDRTQASDKILALLRDQLK*
Ga0126369_1239195023300012971Tropical Forest SoilEQYKITVAQSDPRSIVTVQDPNGAPDKTATGEKILTLLKDQLK*
Ga0164309_1083943313300012984SoilQYQIMVAEATPISVVSVQDPGGVPDKSATSEKILTMLKDQLK*
Ga0164308_1066203723300012985SoilLMFWKTGDTEKVEQYRINIAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK*
Ga0164304_1069402413300012986SoilRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK*
Ga0157378_1154983623300013297Miscanthus RhizospherePAPQSTCSVHYPSVNPYKSQASERILALLREQLK*
Ga0163162_1107306623300013306Switchgrass RhizosphereNIEQYRITVAEASPRSLVTVQDPNGTPDKSAAGEKILSLLRDQLK*
Ga0157375_1036287313300013308Miscanthus RhizosphereEQYRITVAQADPNSLVTVQDPEGAPDKSANGEKILALLKDQLK*
Ga0157375_1342625313300013308Miscanthus RhizosphereYRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK*
Ga0075307_115056813300014260Natural And Restored WetlandsAAQNSVVVVQDPGGVPDRSPTSEKILALLKEQLK*
Ga0075346_106780723300014306Natural And Restored WetlandsFWKTDVEKVEQYRITVAESNPRSLVTVQDPSGAPDKSATGEKILSLLRDQLK*
Ga0182008_1092604523300014497RhizosphereKVAEASPQSAVTVEDTTGKPDRSPASERILALLRDQLK*
Ga0157379_1259338313300014968Switchgrass RhizosphereKLMFWKPDAPNVEQYRITVAEASPRSLVTVQDPNGAPDKSATGEKILSLLRDQLK*
Ga0167650_100271313300015203Glacier Forefield SoilDVEKVEQYRIAIADAVPRSFVSVQDPNGAPDKSAASEKILSLLRDQLK*
Ga0132257_10029153023300015373Arabidopsis RhizosphereMFWKSKDEKPEQYRITIAQSDPRSVVTVQDPGGAPDKSATGEKILTLLKDQLK*
Ga0132255_10373833313300015374Arabidopsis RhizosphereLAKLMFWKDTTEKPEQYRILVAESAPPALVTVQDVNGAPDKTPNSEKILALLKDQLK*
Ga0173479_1040216713300019362SoilEGEKPEQYRIAVVESSPRSLVTVQDPKGTPDKTPASDRILALLKDQLK
Ga0206353_1175463213300020082Corn, Switchgrass And Miscanthus RhizosphereQYRIKVAQETAPQSTVSVQDPSGNPDKTQASERILALLRDQLK
Ga0222622_1101023613300022756Groundwater SedimentKPEQYQIVVAETAQASVISVQDPGGTPDRTATSEKILSMLKDQLK
Ga0247746_121105613300022886SoilKPEQYRIAVVESSPRSLVTVQDPKGAPDKTPASDRILALLKDQLK
Ga0207656_1003007213300025321Corn RhizosphereYRIKVVEVAPNSVVSVQDNTGQPEKSQNGEKILALLKDQLK
Ga0207656_1047548113300025321Corn RhizosphereKPEQYRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK
Ga0207707_1034237933300025912Corn RhizosphereIKVVETAPQSTVSVQDPKGEPDRSQASDRILALLRDQLK
Ga0207695_1068775323300025913Corn RhizosphereSKITNLFRKDDEKDKPEQYRIKVAETSPQSAVTVQDTTGKPDHSPASERILTLLRDQLK
Ga0207693_1122023223300025915Corn, Switchgrass And Miscanthus RhizosphereKPEQYRIKVVETAPQSTVSVQDPKGEPDRSQASDRILALLRDQLK
Ga0207652_1144085023300025921Corn RhizosphereVEVAPNSVVSVQDTTGQPEKTQTGEKILALLKDQLK
Ga0207694_1156559723300025924Corn RhizosphereQYRIKVAEVAPNSVVSVQDTTGAPEKSQNSEKILALLKEQLK
Ga0207706_1072566613300025933Corn RhizosphereQIVIAEAAQSSVVSVQDPGGVPDRTSTSEKILALLKDQLK
Ga0207686_1028243913300025934Miscanthus RhizosphereEQYRINVAEAVPRSLISVQDPNGAPDKSATSEKILSLLRDQLK
Ga0207670_1165586523300025936Switchgrass RhizosphereLLDKLMFWKSDTPNIEQYRITVAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK
Ga0207669_1004333053300025937Miscanthus RhizosphereEATPISVVSVQDPGGVPDKSATSEKILTMLKDQLK
Ga0207665_1027031133300025939Corn, Switchgrass And Miscanthus RhizosphereDKPEQYRIKVAEAAPQSVVSVQDAAGAPEVSKNGEKILALLKEQLK
Ga0207689_1162617923300025942Miscanthus RhizosphereTVAEATPRSLVTVQDPNGAPDKSATSEKILSLLRDQLK
Ga0207689_1171813913300025942Miscanthus RhizosphereEKDKPEQYRIKVVETAPQSTVSVQDPNGAPDRTQASDKILALLRDQLK
Ga0210066_105153813300025951Natural And Restored WetlandsGILDKLQFWKTDVEKVEQYRITVAEANPRSLVTVQDPSGAPDKSATGEKILSLLRDQLK
Ga0207651_1048646113300025960Switchgrass RhizospherePEQYRIKVIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK
Ga0207651_1141781613300025960Switchgrass RhizosphereKPEQYRIKVVEATPTSVVSVQDPKGEPDRTQNSEKILALLKDQLK
Ga0207668_1012222113300025972Switchgrass RhizosphereEQYQIVVAESAQNSIVSVQDPGGIPDRTATSEKILALLKDQLK
Ga0207640_1150149123300025981Corn RhizosphereRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK
Ga0207658_1041083713300025986Switchgrass RhizosphereWKTDEKDKPEQYRIKVIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK
Ga0207658_1088168423300025986Switchgrass RhizosphereDKLAFWKSDAPNIEQYRITVAEASPRSLVTVQDPNGTPDKSAAGEKILSLLRDQLK
Ga0207658_1122969623300025986Switchgrass RhizosphereIKIVETAPQSTVSVQDPAGNPDKSQASERILALLREQLK
Ga0207703_1008292843300026035Switchgrass RhizosphereETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK
Ga0208423_103160523300026070Natural And Restored WetlandsEQYRIIVADKSTKSFVSVEDPNGAPDKSQNGEKILSLLQGQLK
Ga0207641_1072866813300026088Switchgrass RhizosphereYRIAVVESSPRSLVTVQDPKGAPDKTPASDRILALLKDQLK
Ga0207648_1091280613300026089Miscanthus RhizospherePEQYQIVVAESAQNSVVSVQDPGGVPDRTATSEKILALLKDQLK
Ga0207648_1185889123300026089Miscanthus RhizosphereVAEATPRSLVTVQDPNGAPDKSATSEKILSLLRDQLK
Ga0209863_1024593513300026281Prmafrost SoilNKPEQYQILVAEASPISVVSVQDPGGIPDKSATSEKILTLLKDQLK
Ga0209474_1039814513300026550SoilEKDKPEQYRIKVVEIAPASIVSVQDPQGQPDRTQNSEKILALLKDQLK
Ga0268264_1058674113300028381Switchgrass RhizosphereYRIKVVEVAPTSVVSVQDPNGTPDRTQNSDKILALLKDQLK
Ga0302166_1016037913300028652FenMVAEATPISVVSVQDPGGIPDKTATGEKILTMLKDQLK
Ga0302262_1029711023300028743FenWKTDEKGKPEQYQIMVAEATPISVVSVQDPGGIPDKSATGQKILTMLKDQLK
Ga0302291_1032148813300028865FenYQIMVAEATPISVVSVQDPGGIPDKSATGEKILTMLKDQLK
Ga0302163_1006931013300028868FenMVAEATPISVVSVQDPGGIPDKSATGQKILTMLKDQLK
Ga0302263_1030136323300028869FenYQIMVAEATPISVVSVQDPGGIPDKSANGEKILTMLKDQLK
Ga0311332_1003035413300029984FenKGKPEQYQIMVAEATPISVVSVQDPGGIPDKSATGQKILTMLKDQLK
Ga0311332_1045102723300029984FenIMVAEATPISVVSVQDPGGIPDKSANGEKILTMLKDQLK
Ga0311365_1003638573300029989FenWKTDDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKTATGEKILTMLKDQLK
Ga0311365_1064197023300029989FenDDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKTATGEKILTMLKDQLK
Ga0311365_1064562823300029989FenPEQYQIMVAEATPISVVSVQDPGGIPDKSATGEKILTMLKDQLK
Ga0311336_1015714213300029990FenDDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKTANGEKILTMLKDQLK
Ga0311337_1054661713300030000FenTNDKDKPEQYQIVVAETQQTSVVSVQDPGGIPDRTSASEKILSLLRDQLK
Ga0311337_1125066023300030000FenEATPISVVSVQDPGGIPDKSATGEKILTMLKDQLK
Ga0302286_1069144513300030047FenVAEAAPISVVSVQDPGGITDKSATSEKILTMLKDQLK
Ga0302273_110680323300030048BogDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKSATGQKILTMLKDQLK
Ga0302323_10114220913300031232FenLVAEASPISVVSVQDPGGITDKTATSEKILTMLKDQLK
Ga0318538_1057587123300031546SoilEQYRITVAEANPNSLVTVQDPDGAPDKSVNGEKILALLKDQLK
Ga0310886_1082983313300031562SoilKVVEEAPASIVSVQDPNGAPDKTQTGEKILALLKDQLK
Ga0310813_1072319213300031716SoilIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK
Ga0311351_1027398613300031722FenYQILVAEAAPISVVSVQDPGGITDKSATSEKILTMLKDQLK
Ga0307405_1120962913300031731RhizosphereIVVAESAQNSVVSVQDPGGIPDRTATSEKILALLKDQLK
Ga0318546_1001004013300031771SoilLMFWKKDDKEKVENYRIKIAEAQQQSVVSVQDTNGSPDKSQTSERILALLKDQLK
Ga0315899_1138062423300031784FreshwaterYRIAVAQADPRSVVTVEAPNGAPDKSPTGEKILGLLKDQLK
Ga0315899_1171413213300031784FreshwaterADATPRSLVTVQDTNGAPDKSATGEKILSLLRDQLK
Ga0318548_1025467023300031793SoilKDDKEKVENYRIKIAEAQQQSVVSVQDTNGSPDKSQTSERILALLKDQLK
Ga0318568_1078366113300031819SoilIAEAQQQSVVSVQDTNGSPDKSQTSERILALLKDQLK
Ga0315290_1056002513300031834SedimentPEQYQIVIAEAAQTSVVSVQDPGGTPDRTATSEKILTMLKDQLK
Ga0310892_1116924013300031858SoilDEKDKPEQYRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK
Ga0315297_1064742623300031873SedimentKTDVEKVEQYRITVADATPRSLVTVQDPSGAPDKSAIGEKILSLLRDQLK
Ga0306919_1023724933300031879SoilKLMFWKKDDKEKVENYRIKIAEAQQQSVVSVQDTNGSPDKSQTSERILALLKDQLK
Ga0302322_10311988423300031902FenDDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKSATGEKILTMLKDQLK
Ga0311367_1023920833300031918FenKDKPEQYQILVAEAAPISVVSVQDPGGITDKSATSEKILTMLKDQLK
Ga0308175_10024278313300031938SoilIKVAEASPQSTVVVEDTTGKPDRSPASERILALLRDQLK
Ga0310885_1002092653300031943SoilADKPEQYRIAVVEAAPSSLVTVQDPKGAPDKTPASDRILALLKDQLK
Ga0315278_1109835023300031997SedimentAETPPPSVVVVQDPNGVTDTTANGEKILALLKDQLK
Ga0315278_1188351913300031997SedimentAEAAPISVVSVQDPGGITDKSATSEKILTMLKDQLK
Ga0310903_1076540913300032000SoilEEADKPEQYRIAVVEAAPSSLVTVQDPKGAPDKTPASDRILALLKDQLK
Ga0318562_1024297033300032008SoilTTTEKVEQYRITITEVDPKSVVTVQDPNGAPDKSQNGEKILALLKDQLQ
Ga0315284_1054343013300032053SedimentKGFLDKLQFWKTDAEKVEQYRITVADATPRSLVTVQDPSGAPDKSAIGEKILSLLRDQLK
Ga0310890_1009215743300032075SoilEQYRIAVVEAAPSSLVTVQDPKGAPDKTPASDRILALLKDQLK
Ga0315292_1030570913300032143SedimentKPEQFQIVVAEAAPNSVVSVQDPGGTPDRTATSEKILALLKDQLK
Ga0315276_1235067113300032177SedimentTVADATPRSLVTVQDPNGAPDKSAIGEKILSLLRDQLK
Ga0307472_10210008013300032205Hardwood Forest SoilTPEQYQITVAQADPNSLVTVQDPNGAPDKSANGEKILALLKDQLK
Ga0315271_1140073123300032256SedimentKLQFWKTDVEKVEQYRITVADATPRSLVTVQDPNGAPDKSATGEKILSLLRDQLK
Ga0315271_1155930823300032256SedimentEQYQILVAEAAPISVVSVQDPGGVTDKSATSERILTMLKDQLK
Ga0306920_10199253013300032261SoilQYKITVAQSDPRSIVTVQDPNGAPDKTATGEKILTLLKDQLK
Ga0315287_1195029013300032397SedimentDKLQFWKTDVEKVEQYRITVADATPRSLVTVQDPNGAPDKSATGEKILSLLRDQLK
Ga0315273_1012475653300032516SedimentYRIFMAETPPPSVVVVQDPNGVTDTTANGEKILALLKDQLK
Ga0315273_1237137123300032516SedimentYRITVADATPRSLVTVQDPNGAPDKSATGEKILSLLRDQLK
Ga0316605_1021210013300033408SoilRILVAESAPPALVTVQDNNGAPDKTPNGEKILSLLKDQLK
Ga0316619_1090417223300033414SoilKDTTEKPEQYRILVAQADPRSVVSVQDPNGAPDKSANGGKILGLLKDQLK
Ga0316619_1205869823300033414SoilTEKVEQYRISIAESAPPTVVVVQDVNGAPDRTPNADRILALLKDQLK
Ga0316601_10151736823300033419SoilTEKPEQYRIKVEESPPASLVTVQDPKGVPDKAPSAERILGLLRDQLK
Ga0316601_10228026213300033419SoilMFWKDTGERPEQYRILVAESAPPALVTVQDTNGAPDKTPNGEKILSLLKDQLK
Ga0310811_1115606713300033475SoilKTDEKDKPEQYRIKVIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK
Ga0316620_1030096613300033480SoilISIVETASRSVVSVLDPDGKPDRTQASEKILGLLQEQLK
Ga0316627_10007723243300033482SoilYQIVVAEAAPNSVVSVQDPGGTPDRTATSEKILALLKDQLK
Ga0316617_10223409213300033557SoilKDKTGDKPEQYRIFIAESPPPSIVTVQDPNGAPDKSPNSEKILALLKDQLK
Ga0364945_0226522_9_1253300034115SedimentMVAEATPISVVSVQDPGGIPDKSATSEKILTMLKDQLK
Ga0370489_0222585_437_5623300034127Untreated Peat SoilYQIVVAEVAQTSVVSVQDPGGVPDRSTNGEKILGLLKDQLK
Ga0364929_0095878_1_1653300034149SedimentQFWKTDDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKSATSEKILTMLKDQLK
Ga0364931_0181485_2_1513300034176SedimentDTAEKPEQYRILVAESAPPALVTVQDANGAPDKTPNSEKILALLKDQLK
Ga0364943_0260713_499_6483300034354SedimentETTEKPEQYQITVAQADPRSLVTVQDPSGAPDKTANGEKILSLLKDQLK
Ga0364943_0408531_2_1453300034354SedimentTEKIEQYQITVAQADPRSLVTVQDPTGAPDKTANGEKILSLLKDQLK
Ga0370485_0124632_612_7583300034358Untreated Peat SoilEKDKPDQYQIVVAEVAQTSVVSVQDPGGAPDRSTNSEKILGLLKDQLK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.