


| Basic Information | |
|---|---|
| Family ID | F033894 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MAATVRGAIRELMEQTMATMDALLEASDRELAMPSSHACAQGKDVWTL |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.43 % |
| % of genes near scaffold ends (potentially truncated) | 94.89 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.068 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.341 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.045 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.47% β-sheet: 0.00% Coil/Unstructured: 60.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF03466 | LysR_substrate | 6.25 |
| PF01738 | DLH | 5.68 |
| PF00753 | Lactamase_B | 5.68 |
| PF01106 | NifU | 3.98 |
| PF01545 | Cation_efflux | 3.98 |
| PF00440 | TetR_N | 3.41 |
| PF07690 | MFS_1 | 3.41 |
| PF04116 | FA_hydroxylase | 2.84 |
| PF00376 | MerR | 1.70 |
| PF13458 | Peripla_BP_6 | 1.14 |
| PF01019 | G_glu_transpept | 1.14 |
| PF00578 | AhpC-TSA | 1.14 |
| PF04542 | Sigma70_r2 | 1.14 |
| PF00211 | Guanylate_cyc | 1.14 |
| PF12367 | PFO_beta_C | 1.14 |
| PF06348 | DUF1059 | 1.14 |
| PF08241 | Methyltransf_11 | 1.14 |
| PF13411 | MerR_1 | 1.14 |
| PF00106 | adh_short | 0.57 |
| PF00873 | ACR_tran | 0.57 |
| PF00496 | SBP_bac_5 | 0.57 |
| PF00583 | Acetyltransf_1 | 0.57 |
| PF04055 | Radical_SAM | 0.57 |
| PF09278 | MerR-DNA-bind | 0.57 |
| PF00571 | CBS | 0.57 |
| PF07859 | Abhydrolase_3 | 0.57 |
| PF01209 | Ubie_methyltran | 0.57 |
| PF09084 | NMT1 | 0.57 |
| PF00027 | cNMP_binding | 0.57 |
| PF13565 | HTH_32 | 0.57 |
| PF00557 | Peptidase_M24 | 0.57 |
| PF00005 | ABC_tran | 0.57 |
| PF00128 | Alpha-amylase | 0.57 |
| PF07110 | EthD | 0.57 |
| PF10091 | Glycoamylase | 0.57 |
| PF00239 | Resolvase | 0.57 |
| PF13546 | DDE_5 | 0.57 |
| PF02417 | Chromate_transp | 0.57 |
| PF04909 | Amidohydro_2 | 0.57 |
| PF13384 | HTH_23 | 0.57 |
| PF09822 | ABC_transp_aux | 0.57 |
| PF00857 | Isochorismatase | 0.57 |
| PF07040 | DUF1326 | 0.57 |
| PF13365 | Trypsin_2 | 0.57 |
| PF13802 | Gal_mutarotas_2 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 3.98 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 3.98 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 3.98 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 3.98 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 2.84 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.14 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.14 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.14 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.14 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.14 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.14 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.57 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.57 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.57 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.57 |
| COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.57 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.57 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.57 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.57 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.57 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.57 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.57 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.57 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.57 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.57 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.57 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.07 % |
| Unclassified | root | N/A | 11.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100361286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100366777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101511326 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300000443|F12B_11273621 | Not Available | 828 | Open in IMG/M |
| 3300000789|JGI1027J11758_12302682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300004156|Ga0062589_100641606 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 930 | Open in IMG/M |
| 3300004268|Ga0066398_10121630 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300004463|Ga0063356_105601571 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300004480|Ga0062592_102164524 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005174|Ga0066680_10344105 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 951 | Open in IMG/M |
| 3300005177|Ga0066690_10104604 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1822 | Open in IMG/M |
| 3300005177|Ga0066690_10785395 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005179|Ga0066684_10973854 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300005180|Ga0066685_10218695 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1310 | Open in IMG/M |
| 3300005181|Ga0066678_10210061 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1246 | Open in IMG/M |
| 3300005332|Ga0066388_102004960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1038 | Open in IMG/M |
| 3300005332|Ga0066388_102659676 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005363|Ga0008090_15663883 | Not Available | 507 | Open in IMG/M |
| 3300005437|Ga0070710_10572115 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005440|Ga0070705_100081291 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300005441|Ga0070700_100297087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1177 | Open in IMG/M |
| 3300005444|Ga0070694_101375738 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005445|Ga0070708_100610049 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300005457|Ga0070662_101141593 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005459|Ga0068867_101642318 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 601 | Open in IMG/M |
| 3300005467|Ga0070706_100398953 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300005467|Ga0070706_100539848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1085 | Open in IMG/M |
| 3300005468|Ga0070707_100103567 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
| 3300005540|Ga0066697_10199151 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1190 | Open in IMG/M |
| 3300005540|Ga0066697_10428579 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005549|Ga0070704_101033049 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005555|Ga0066692_10349046 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 939 | Open in IMG/M |
| 3300005556|Ga0066707_10587015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 714 | Open in IMG/M |
| 3300005557|Ga0066704_10066969 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300005561|Ga0066699_10944677 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005569|Ga0066705_10338256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 951 | Open in IMG/M |
| 3300005598|Ga0066706_10950424 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
| 3300005617|Ga0068859_100039356 | Not Available | 4743 | Open in IMG/M |
| 3300005618|Ga0068864_100669689 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300005713|Ga0066905_100981113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300005764|Ga0066903_102035453 | Not Available | 1104 | Open in IMG/M |
| 3300005764|Ga0066903_103843891 | Not Available | 807 | Open in IMG/M |
| 3300005764|Ga0066903_104812575 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005842|Ga0068858_101561566 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005844|Ga0068862_101020953 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 819 | Open in IMG/M |
| 3300006034|Ga0066656_10011679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4463 | Open in IMG/M |
| 3300006047|Ga0075024_100836158 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006050|Ga0075028_100115734 | Not Available | 1384 | Open in IMG/M |
| 3300006175|Ga0070712_101331369 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 626 | Open in IMG/M |
| 3300006844|Ga0075428_101514139 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 703 | Open in IMG/M |
| 3300006852|Ga0075433_10060140 | All Organisms → cellular organisms → Bacteria | 3326 | Open in IMG/M |
| 3300006852|Ga0075433_10490994 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300006852|Ga0075433_11024761 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 719 | Open in IMG/M |
| 3300006854|Ga0075425_101827952 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300006880|Ga0075429_101416377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
| 3300006903|Ga0075426_11304725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 551 | Open in IMG/M |
| 3300006904|Ga0075424_101590366 | Not Available | 693 | Open in IMG/M |
| 3300007076|Ga0075435_100908814 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300007265|Ga0099794_10286057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300009012|Ga0066710_101765991 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 937 | Open in IMG/M |
| 3300009012|Ga0066710_104224387 | Not Available | 537 | Open in IMG/M |
| 3300009088|Ga0099830_11149125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300009090|Ga0099827_10548549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 995 | Open in IMG/M |
| 3300009094|Ga0111539_10084919 | All Organisms → cellular organisms → Bacteria | 3721 | Open in IMG/M |
| 3300009137|Ga0066709_104195966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
| 3300009147|Ga0114129_10553812 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300009147|Ga0114129_11029105 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300009162|Ga0075423_13192048 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300009792|Ga0126374_10164162 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1364 | Open in IMG/M |
| 3300009792|Ga0126374_11141313 | Not Available | 620 | Open in IMG/M |
| 3300009820|Ga0105085_1128306 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300010046|Ga0126384_11256052 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 685 | Open in IMG/M |
| 3300010046|Ga0126384_12008105 | Not Available | 553 | Open in IMG/M |
| 3300010303|Ga0134082_10423477 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 572 | Open in IMG/M |
| 3300010358|Ga0126370_11623933 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300010359|Ga0126376_12195602 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010360|Ga0126372_12139321 | Not Available | 608 | Open in IMG/M |
| 3300010366|Ga0126379_12299742 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300010366|Ga0126379_13508760 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300010373|Ga0134128_12855949 | Not Available | 532 | Open in IMG/M |
| 3300010397|Ga0134124_11764271 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010398|Ga0126383_10111560 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2469 | Open in IMG/M |
| 3300010398|Ga0126383_12013667 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300010398|Ga0126383_12679832 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300011270|Ga0137391_10615451 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300012189|Ga0137388_11032964 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 758 | Open in IMG/M |
| 3300012189|Ga0137388_11382050 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300012199|Ga0137383_10520915 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 870 | Open in IMG/M |
| 3300012349|Ga0137387_10094348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2076 | Open in IMG/M |
| 3300012351|Ga0137386_11258736 | Not Available | 515 | Open in IMG/M |
| 3300012353|Ga0137367_10479162 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300012361|Ga0137360_10309158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1314 | Open in IMG/M |
| 3300012362|Ga0137361_11825595 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012363|Ga0137390_10629418 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300012363|Ga0137390_11214639 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012532|Ga0137373_10044587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4174 | Open in IMG/M |
| 3300012918|Ga0137396_10058565 | All Organisms → cellular organisms → Bacteria | 2663 | Open in IMG/M |
| 3300012922|Ga0137394_10156025 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300012922|Ga0137394_11582990 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300012929|Ga0137404_11031688 | Not Available | 753 | Open in IMG/M |
| 3300012929|Ga0137404_12040296 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012930|Ga0137407_10180697 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
| 3300012930|Ga0137407_10828656 | Not Available | 874 | Open in IMG/M |
| 3300012948|Ga0126375_10018650 | All Organisms → cellular organisms → Bacteria | 3178 | Open in IMG/M |
| 3300012948|Ga0126375_12108076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300013306|Ga0163162_13019505 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300014262|Ga0075301_1083205 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300014881|Ga0180094_1152341 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300015254|Ga0180089_1027424 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300015357|Ga0134072_10273272 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300015372|Ga0132256_102566792 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 610 | Open in IMG/M |
| 3300015374|Ga0132255_105027027 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 560 | Open in IMG/M |
| 3300017656|Ga0134112_10197121 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 786 | Open in IMG/M |
| 3300017656|Ga0134112_10226833 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 736 | Open in IMG/M |
| 3300017792|Ga0163161_11768579 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300017997|Ga0184610_1068386 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1081 | Open in IMG/M |
| 3300018028|Ga0184608_10518156 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 509 | Open in IMG/M |
| 3300018056|Ga0184623_10445357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300018075|Ga0184632_10210310 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300019259|Ga0184646_1646611 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300019883|Ga0193725_1113577 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300020002|Ga0193730_1122129 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 712 | Open in IMG/M |
| 3300021432|Ga0210384_10476732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1124 | Open in IMG/M |
| 3300022694|Ga0222623_10415152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
| 3300025325|Ga0209341_10248504 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1476 | Open in IMG/M |
| 3300025899|Ga0207642_10188770 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300025915|Ga0207693_10923207 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300025917|Ga0207660_10352212 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300025919|Ga0207657_10300101 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300025922|Ga0207646_11857276 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300025923|Ga0207681_11848258 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300025925|Ga0207650_10259280 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300025930|Ga0207701_10236200 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1598 | Open in IMG/M |
| 3300025938|Ga0207704_11250550 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 634 | Open in IMG/M |
| 3300025981|Ga0207640_11151863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 688 | Open in IMG/M |
| 3300026035|Ga0207703_10454363 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300026075|Ga0207708_10882890 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300026088|Ga0207641_10593169 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300026089|Ga0207648_12144147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300026296|Ga0209235_1060701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1769 | Open in IMG/M |
| 3300026296|Ga0209235_1264811 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300026306|Ga0209468_1042072 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300026313|Ga0209761_1178212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 968 | Open in IMG/M |
| 3300026314|Ga0209268_1001344 | All Organisms → cellular organisms → Bacteria | 12014 | Open in IMG/M |
| 3300026328|Ga0209802_1114197 | Not Available | 1196 | Open in IMG/M |
| 3300026335|Ga0209804_1189472 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300026358|Ga0257166_1001099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2425 | Open in IMG/M |
| 3300026537|Ga0209157_1216407 | Not Available | 792 | Open in IMG/M |
| 3300026538|Ga0209056_10576704 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300026540|Ga0209376_1003414 | All Organisms → cellular organisms → Bacteria | 14399 | Open in IMG/M |
| 3300026542|Ga0209805_1118572 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1252 | Open in IMG/M |
| 3300027643|Ga0209076_1104823 | Not Available | 801 | Open in IMG/M |
| 3300027655|Ga0209388_1231265 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300027671|Ga0209588_1054180 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300027874|Ga0209465_10072246 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300027915|Ga0209069_10906895 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300028380|Ga0268265_12329494 | Not Available | 542 | Open in IMG/M |
| 3300028589|Ga0247818_10939754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 609 | Open in IMG/M |
| 3300028673|Ga0257175_1007377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1568 | Open in IMG/M |
| 3300028792|Ga0307504_10333123 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300028792|Ga0307504_10336534 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
| 3300030336|Ga0247826_10645962 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 816 | Open in IMG/M |
| 3300031716|Ga0310813_11993433 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031720|Ga0307469_10571605 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300031769|Ga0318526_10375003 | Not Available | 582 | Open in IMG/M |
| 3300031781|Ga0318547_10034861 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
| 3300031820|Ga0307473_10416023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 885 | Open in IMG/M |
| 3300031890|Ga0306925_10997348 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031897|Ga0318520_11048732 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 516 | Open in IMG/M |
| 3300031954|Ga0306926_10009736 | All Organisms → cellular organisms → Bacteria | 10588 | Open in IMG/M |
| 3300032075|Ga0310890_11160317 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300032075|Ga0310890_11231024 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 610 | Open in IMG/M |
| 3300032180|Ga0307471_100252979 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300032180|Ga0307471_101849438 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
| 3300032782|Ga0335082_10999328 | Not Available | 701 | Open in IMG/M |
| 3300032828|Ga0335080_11413590 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.34% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.70% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.14% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.57% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.57% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.57% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1003612861 | 3300000364 | Soil | MAATVREAIRELLEQTIVTMDALLEASDHELPMSSSHA |
| INPhiseqgaiiFebDRAFT_1003667772 | 3300000364 | Soil | MAATVREAIRELLEQTIVTMDALLEASDQELAMPSSHACAQGKD |
| INPhiseqgaiiFebDRAFT_1015113263 | 3300000364 | Soil | MAATVRGAVQDLLEQTMVTMDALLAXSDRELXXXSSHA |
| F12B_112736212 | 3300000443 | Soil | MAATVRGAVRELLEQTIATMDALLAASDRELPLSSSHACAQ |
| JGI1027J11758_123026821 | 3300000789 | Soil | MAATVREAIRELLEQTIVTMDALLEASDHELPMSSSHACAQGKDVWTLITNDI |
| Ga0062589_1006416061 | 3300004156 | Soil | MAATVREAIRELLEQTMVRMDALLEASDRELAMPSSHACAQ |
| Ga0066398_101216301 | 3300004268 | Tropical Forest Soil | MAATVRGAIRELLEQTMTTIETLLAATDRELPMSSSHVCAQGKDVWTL |
| Ga0063356_1056015712 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAATVREAIRELMTQTMATMDVLLEASDRELTTASSHACA |
| Ga0062592_1021645241 | 3300004480 | Soil | MAATVRGAIRELMEQTMATMDALIEASDRELAAPSSHACAQGKDVWTLITND |
| Ga0066680_103441051 | 3300005174 | Soil | MAATVHGAIRELIEQTMITMGALLEASDRELSVPSSHGCAQGKDVW |
| Ga0066690_101046041 | 3300005177 | Soil | MAATVRGAIRELMEQTMRTVDALLEASARELAMSSSHACAQGKDVWTLITN |
| Ga0066690_107853951 | 3300005177 | Soil | MAATVRGAIRELLEQTMVTIDALLEASDRELAMPSSHGCAQGKDAW |
| Ga0066684_109738541 | 3300005179 | Soil | MAASVREAIRELTRQTMATIETLLEAPDRELTMASSHVCAQGKDV |
| Ga0066685_102186951 | 3300005180 | Soil | MAASVREAIRELTRQTMATIETLLEAPDRELTMASSHVCAQG |
| Ga0066678_102100613 | 3300005181 | Soil | MAETVREAIRELMEQTMGTMDALLEASDRELAMSSSHPCAQGKDVWTLITN |
| Ga0066388_1020049601 | 3300005332 | Tropical Forest Soil | MAATVRGTVRELLEQTIATMDALLEASDRELPLPSSHACAQGKDLW |
| Ga0066388_1026596761 | 3300005332 | Tropical Forest Soil | MAATVREAIRELLEQTIATTEALLDASDRELPRSSSHACAQ |
| Ga0008090_156638831 | 3300005363 | Tropical Rainforest Soil | MAATVRETVRELLEQTIATMDVLLEASDRELPLSSSHVCAQGKDL |
| Ga0070710_105721153 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVREAIRELLEQTAATIDTLLQAPDGELAMPSSHGCA |
| Ga0070705_1000812913 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VAATTREAIRELLQQTISTMDALLKASDEELVMPSSHVCAQGKD |
| Ga0070700_1002970871 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVRGAIRELLEQTMVTVDALLEASDQELTMPSSHVCAQGKDVWT |
| Ga0070694_1013757381 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVHGAIRELMEQTMATMDALLEASDRELAAPSSHSCAQGKD |
| Ga0070708_1006100491 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVRGAIRELLEQTMVTIDALLEASDRELAMPSSHGCAQGKDAWTL |
| Ga0070662_1011415932 | 3300005457 | Corn Rhizosphere | MAPTVRAAIRELMEQTMATMDALLEASDRELAMSSSHGCAQGKDVWTLITNDID |
| Ga0068867_1016423181 | 3300005459 | Miscanthus Rhizosphere | MAATVQGAIRELMEQTMGTMDALLEASDRELAMPSSHACAQGKDVW |
| Ga0070706_1003989532 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVREAIRELMTQTMATMDALLEAPDPELTMASSHACA |
| Ga0070706_1005398481 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVRGAMRELLEQTMATMDALLEASDRELAMPSSHGCA |
| Ga0070707_1001035673 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVREAIRELMTQTMATMDALLEASDRELTAAASHACAQGKDL* |
| Ga0066697_101991512 | 3300005540 | Soil | MAATVRGAIRELLEQTMVTIDALLETSDSELAMPSSHACAQRKDAWTLIT |
| Ga0066697_104285791 | 3300005540 | Soil | MAATVREAVRELLEQTIATMDALLEASDRELAMPSSHACAQGKDAWTLITND |
| Ga0070704_1010330492 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVREAIRELLTQTMTTMETLLDAADGELAMPSSHGCAQ |
| Ga0066692_103490462 | 3300005555 | Soil | MAATVRGAIRELIEQTMVTMGALLEASERELSVPSSHGCAQGKDVWTLITND |
| Ga0066707_105870152 | 3300005556 | Soil | MAATVRGAIRELMEQTMRTVDALLEASARELAMSSSHACAQGKDVWTLITNDID |
| Ga0066704_100669691 | 3300005557 | Soil | MAATVREAIRELTRETMATMDILVEASDRELTMPSSHVCAQGKDVWTLLT |
| Ga0066699_109446772 | 3300005561 | Soil | MAATVRGAIRELLEQTMVTIDALLEASDRELAMPSSHG |
| Ga0066705_103382561 | 3300005569 | Soil | MAETVREAIRELMEQTMGTMDALLEASDRELAMSSSHPCAQG |
| Ga0066706_109504242 | 3300005598 | Soil | MAASVREAIRELTRQTMATIETLLEAPDRELTMASSHVCA |
| Ga0068859_1000393564 | 3300005617 | Switchgrass Rhizosphere | MAATVRGAVRELFEQTMATMDALLAASDRELPMASSHACAQGKDVWTLITND |
| Ga0068864_1006696892 | 3300005618 | Switchgrass Rhizosphere | MAATVQAAVRELLEQTIVTMDALLEASDRELAMPSSHGCAQGKD |
| Ga0066905_1009811131 | 3300005713 | Tropical Forest Soil | MAATVREAIRELVAQTMATMDALLDASDGELAQPSSHACAQGKDVWTLITND |
| Ga0066903_1020354533 | 3300005764 | Tropical Forest Soil | MAATVRETVRELLEQTIATMDVLLEASDRELPLSSSHVCAQGKDLWAL |
| Ga0066903_1038438912 | 3300005764 | Tropical Forest Soil | MAATVRGTVRELLEQTIATMDSLLEASDPELPLPSSHGCAQG |
| Ga0066903_1048125752 | 3300005764 | Tropical Forest Soil | MAATVRGAIRELLEQTIVTIDALLEASDRELAMPSSHGCAQGKDVW |
| Ga0068858_1015615662 | 3300005842 | Switchgrass Rhizosphere | MAATVHSAIRELMEQTMTTMDTLLEASDRELAAPSSH |
| Ga0068862_1010209531 | 3300005844 | Switchgrass Rhizosphere | MAATVREAIRELMSQTLVTMDTLLEASDRELTMGSSHGC |
| Ga0066656_100116796 | 3300006034 | Soil | MAETVREAIRELMEQTMRTMDALLEASDRELAMSSSHPCAQGKD |
| Ga0075024_1008361581 | 3300006047 | Watersheds | MAGTVREAVRELLEQTMATMDALLQASDRELAMPSSHACA |
| Ga0075028_1001157342 | 3300006050 | Watersheds | MAATVREAIRELMTQTMATMDALLEASDGELTAASSHACAQGKDLW |
| Ga0070712_1013313691 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVREAIRELLEQTAATIDTLLQAPDGELAMPSSHGCAQGKDVWTLLT |
| Ga0075428_1015141391 | 3300006844 | Populus Rhizosphere | MAETVRGAIRELMEQTMRTMDALLEASDRELAMASSHPCAQGKD |
| Ga0075433_100601404 | 3300006852 | Populus Rhizosphere | MAATVRGAIRELLEQTMVTIDALLEASDRELAMPSSHGC |
| Ga0075433_104909943 | 3300006852 | Populus Rhizosphere | MAATVRAAIRELLEQTIATMDVLLDASDRELPLPSSHACAQGKD |
| Ga0075433_110247611 | 3300006852 | Populus Rhizosphere | MAETVRGAIRELMEQTMRTMDALLEASDRELAMSSSHPCAQGKDVWTL |
| Ga0075425_1018279521 | 3300006854 | Populus Rhizosphere | MAATVRGAIRELLEQTMVTIDALLEASDGELAMPSSHGCAQGKDAWTLITND |
| Ga0075429_1014163771 | 3300006880 | Populus Rhizosphere | MAATVRGAIRELMEQTMETMDALLEASDRELAMPSSHGCAQGKDVW |
| Ga0075426_113047252 | 3300006903 | Populus Rhizosphere | MAATVREAIRELMTQTMATMDALLEASDRELTTPSSH |
| Ga0075424_1015903661 | 3300006904 | Populus Rhizosphere | MAATVRGAVRELLEQTIATMDTLLAASDRELPLSSSHA |
| Ga0075435_1009088141 | 3300007076 | Populus Rhizosphere | MAATVRGAIRELLEQTMVTIDALLEASDGELAMPSSHGCAQGKDAWTLITNDI |
| Ga0099794_102860573 | 3300007265 | Vadose Zone Soil | MAATVRGAIRELMEQTMTTMDALLEASDRELAMPSSHGCAQGKDVWTLIAND |
| Ga0066710_1017659913 | 3300009012 | Grasslands Soil | MAETVREAIRELMEQTMGTMDALLEASDRELAMSSSHPCAQGKDVWTLITNDIDH |
| Ga0066710_1042243872 | 3300009012 | Grasslands Soil | MAATVREAIRELLEQTMATMDRLLEASDRELPMPSSHACAQGKDV |
| Ga0099830_111491252 | 3300009088 | Vadose Zone Soil | MAATVREAIRELMTQTMATMDALLEASDRELTMSSSHACAQGKDLWTLMTNDIDH |
| Ga0099827_105485491 | 3300009090 | Vadose Zone Soil | MAASVREAIRELLEQTMATMDKLLEASDRELPMPSSHACAQGKNVW |
| Ga0111539_100849193 | 3300009094 | Populus Rhizosphere | MAATVRETVRELLEQTIATMDALLEASDRELPLPSSHVCAQSKDYT* |
| Ga0066709_1041959662 | 3300009137 | Grasslands Soil | MAATVRGAIRELIEQTMVTMGALLEASDPELSVPSSHGCAQGK |
| Ga0114129_105538121 | 3300009147 | Populus Rhizosphere | MAETVRAAIRELMEQTMRTMDALLEASDRELAMASSHP |
| Ga0114129_110291051 | 3300009147 | Populus Rhizosphere | MAATVRGAIRELLEQTMVTIDALLEASDRELAMPSSHGCAQGKDAWT |
| Ga0075423_131920481 | 3300009162 | Populus Rhizosphere | MAATVRAAIRELLEQTMTTIDILLSASDRELPMASSHGCAQGKDLWT |
| Ga0126374_101641621 | 3300009792 | Tropical Forest Soil | MAATVREAIRELLEQTIATMEALLDASDRELPRSSSHACAQGK |
| Ga0126374_111413131 | 3300009792 | Tropical Forest Soil | MAATVRETIRELLEQTIATMDALLEASDRELPLASSHAC |
| Ga0105085_11283063 | 3300009820 | Groundwater Sand | MAATVRGAIRELLEQTMLTMDALLEASDRELSMPSSHGCAQGKDVWALITN |
| Ga0126384_112560521 | 3300010046 | Tropical Forest Soil | MTPTVSGAIRELLEQTMTTIDALLAAIDRELPMPSSHVCAQGKDV |
| Ga0126384_120081051 | 3300010046 | Tropical Forest Soil | MASTVRGAVRELLEQTIATMDALLEASDRELPLASSHARAQGKDLWT |
| Ga0134082_104234772 | 3300010303 | Grasslands Soil | MAATVRGAIRELMEQTMRTVDALVEASDRELAMSSSHACAQGKDVWTL |
| Ga0126370_116239331 | 3300010358 | Tropical Forest Soil | MAATVREAIRELLEQTIATMEALLDASDRELPRSSSHACAQGKDL |
| Ga0126376_121956022 | 3300010359 | Tropical Forest Soil | MAATVRGAVRELLEQTIATMDALLEASDRELPLSSSH |
| Ga0126372_121393212 | 3300010360 | Tropical Forest Soil | MAATVRDTVRQLLEQTIATMDALLEATDRELPLPSSHVCAQG |
| Ga0126379_122997421 | 3300010366 | Tropical Forest Soil | MAATVREAVRELLEQTIATMDALLDASDRELPRSSSHACAQGKDLW |
| Ga0126379_135087601 | 3300010366 | Tropical Forest Soil | MAATVREAVRELLQQTMATMEALLEASDRELPLPSSHG |
| Ga0134128_128559492 | 3300010373 | Terrestrial Soil | MAETVRQTIHELLDQTRATIDALLDAGDPELPMASSHVCAQGRDAW |
| Ga0134124_117642711 | 3300010397 | Terrestrial Soil | MAATVRDAIRELMAQTTATMDALLEASDRELTMPSSHACAQGKDVWTL |
| Ga0126383_101115601 | 3300010398 | Tropical Forest Soil | MAATARGAIRELLEQTMTTIDALLAATDRELPMSSSHVCAQGKDV |
| Ga0126383_120136671 | 3300010398 | Tropical Forest Soil | MATTVRGAVRELLEQTIATMDALLEASDRELPLAS |
| Ga0126383_126798322 | 3300010398 | Tropical Forest Soil | MADTVRGTVRELLEQTIATMDALLDASDRELPLPSSHACAQGKDLW |
| Ga0137391_106154511 | 3300011270 | Vadose Zone Soil | MAATVRGAIRELMEQTMATMDALLEASDRELTMPSSHVCAQGKDVWTLI |
| Ga0137388_110329641 | 3300012189 | Vadose Zone Soil | MRELLEQTMATMDALLEASDRELAMPSSHGCAQGKDVWTLITND |
| Ga0137388_113820502 | 3300012189 | Vadose Zone Soil | MAATVREAIRELMTQTMATVDALLEAPDPELTMASSHACAQGKDLWTLITNDIDH |
| Ga0137383_105209151 | 3300012199 | Vadose Zone Soil | MAATVREAIRELMSQTLVTMDTLLEASDRELTMGSSHG |
| Ga0137387_100943483 | 3300012349 | Vadose Zone Soil | MAATVREAVRELLEQATAMMDALLAASDRELTMPSSHACAQGKDVWTLIT |
| Ga0137386_112587361 | 3300012351 | Vadose Zone Soil | MAATVRGTIRELLEETMTTIDALLATPEGELAMPSSHACAQGKDL |
| Ga0137367_104791621 | 3300012353 | Vadose Zone Soil | MAATVRGTIRDLLGQTMATIDTLLATPEGELAMPSSHVCAQGKDLWT |
| Ga0137360_103091584 | 3300012361 | Vadose Zone Soil | MAATVRGAIRELMEQTMRTVDALLEASDQELAMSSSHACAQGKDVWT |
| Ga0137361_118255952 | 3300012362 | Vadose Zone Soil | MAATVREAIRELTRETMATMDILVEASDRELTMPSSHVCA |
| Ga0137390_106294183 | 3300012363 | Vadose Zone Soil | MAATVRAAIRELLEQTMTTIVTLLAASDRELAMPSSH* |
| Ga0137390_112146392 | 3300012363 | Vadose Zone Soil | MAATVREAIRELMTQTMVTIDALLEASDRELTMSSSHACAQGKTFGR* |
| Ga0137373_100445871 | 3300012532 | Vadose Zone Soil | MAATVRGAVRELLEQTIATMDALLEASDRELAMASSHGCAHGKD |
| Ga0137396_100585651 | 3300012918 | Vadose Zone Soil | MAATVREAVRELMAQTMATIDALLEASDHELAMPSSHACAQGKDV |
| Ga0137394_101560251 | 3300012922 | Vadose Zone Soil | MAATTREAIRELLLQTASTIDTLLQASDGELSMPSSHGCAQGKDVWTLLTND |
| Ga0137394_115829902 | 3300012922 | Vadose Zone Soil | MAATVLEAIRELLEQTMGTMDALLEASDRELAMSSSHACA |
| Ga0137404_110316883 | 3300012929 | Vadose Zone Soil | MMAATVRGAIRELMEQTMTTMDALLEASDRELAMPSSHACA |
| Ga0137404_120402961 | 3300012929 | Vadose Zone Soil | MAATVRGAVRELLEQTIATMQALLEASDRELAMPSSH |
| Ga0137407_101806973 | 3300012930 | Vadose Zone Soil | MAATVRGAIRELMEQTMATMDALVEASDRELSMPSSHACAQGKDVWTLIAND |
| Ga0137407_108286561 | 3300012930 | Vadose Zone Soil | MAATVRGAVRELLEQTIATMDALLEASDREVAMPSSHACAQGKDLWT |
| Ga0126375_100186504 | 3300012948 | Tropical Forest Soil | MAATVRDAIRELLEQTMTTIETLLAATERELPMSSSHACAQGKDVW |
| Ga0126375_121080762 | 3300012948 | Tropical Forest Soil | MAATAREAIRELLEQTIVTMDALLEASDHELAMSSS |
| Ga0163162_130195051 | 3300013306 | Switchgrass Rhizosphere | MAATVHSAIRELMEQTMTTMDALLEASDRELAAPSSHSC |
| Ga0075301_10832052 | 3300014262 | Natural And Restored Wetlands | MAETVRAAIRELLEQTIATMDALLEASDRELPRPSSHTCAQGKDVWALIT |
| Ga0180094_11523412 | 3300014881 | Soil | MASTVRGAIRELMEQTMATVDTLLEASDRELAMPSSHACA |
| Ga0180089_10274241 | 3300015254 | Soil | MAATVRGAIRELMEQTMATMDALLEASDRELAMPSSHACAQGKDVWTL |
| Ga0134072_102732721 | 3300015357 | Grasslands Soil | MAATVRGAIRELLEQTMVTIDALLEASDRELAMPSS |
| Ga0132256_1025667922 | 3300015372 | Arabidopsis Rhizosphere | MAETVRGAIRQLMEQTMRTMDALLEASDRELAMSSSHACAQGKDVWTLIT |
| Ga0132255_1050270271 | 3300015374 | Arabidopsis Rhizosphere | MAATVRGAIRELLEQTMTTIDALLAATDRELPMSSSHTCA |
| Ga0134112_101971212 | 3300017656 | Grasslands Soil | MAATVRGAIRELIEQTMVTMAALLEASDRELSVPSSHGCAQGKDVWT |
| Ga0134112_102268332 | 3300017656 | Grasslands Soil | MAATVRGAIRELIEQTMVTMGALLEASDRELSVPSSHGCAQGKDVWTLIT |
| Ga0163161_117685792 | 3300017792 | Switchgrass Rhizosphere | MAPTVRAAIRELMEQTMATMDALLEASDRELAMSSSHGCAQGKDVWTLI |
| Ga0184610_10683863 | 3300017997 | Groundwater Sediment | MAATVRGAIRELIEQTMLTMGALLEAPDRELSVPSSHGCAQGKDVWTLITNARGTL |
| Ga0184608_105181562 | 3300018028 | Groundwater Sediment | MAATVREAIRELLQQTASTIDTLRQASDGELAMPS |
| Ga0184623_104453572 | 3300018056 | Groundwater Sediment | MAATVRGAVRELLEQTMATMDALLAASDDELTMPSSHGCAQGKDLWTLLTNDI |
| Ga0184632_102103102 | 3300018075 | Groundwater Sediment | MAATVRGAIRELMEQTMATMDALLEASDRELTMPSSHVCAQG |
| Ga0184646_16466112 | 3300019259 | Groundwater Sediment | MAATVRGATRELIEQTMLTMGARLEAPDRELSVPSSHGCAQGKDVWTLITNARGTL |
| Ga0193725_11135771 | 3300019883 | Soil | MAATVRGAIRELLEQTMTTMDALLEASDRELPMPSSHVCAQGK |
| Ga0193730_11221292 | 3300020002 | Soil | MAATTREAIRELLQQTASTIDTLLQASDGELSMPSSHGCAQGKDV |
| Ga0210384_104767321 | 3300021432 | Soil | MAATVRGAIRELMEQTMATMDALVEASDRELSMPSSHACAQGKDVWTLI |
| Ga0222623_104151522 | 3300022694 | Groundwater Sediment | MAATVREAIRELLQQTASTIDTLLQASDGELAMPSSHGCAQGKDVWTL |
| Ga0209341_102485041 | 3300025325 | Soil | MAATVRGAIRELMEQTMATMDALLEASDGELPMSSSHVCAQGKDVWTLI |
| Ga0207642_101887701 | 3300025899 | Miscanthus Rhizosphere | MAATVHSAIRELMEQTMTTMDALLEASDRELAAPSSHSCAQGKDVWTLITNDI |
| Ga0207693_109232072 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVREAIRELLEQTAATIDTLLQAPDGELAMPSSHG |
| Ga0207660_103522123 | 3300025917 | Corn Rhizosphere | MAATVREAIRELMTQTMATMDALLEASDRELTTPSSHACAQ |
| Ga0207657_103001011 | 3300025919 | Corn Rhizosphere | MAATVREAIRELMTQTMATMDALLEASDRELTTASSHACAQGKDLWTLIT |
| Ga0207646_118572761 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVREAIRELMTQTMATMDALLEASDRELTAAASHACAQGKDL |
| Ga0207681_118482582 | 3300025923 | Switchgrass Rhizosphere | MAATVQAAVRELLEQTIVTMDALLEASDRELAMPSSHGCA |
| Ga0207650_102592801 | 3300025925 | Switchgrass Rhizosphere | MAATVREAIRELMTQTMATMDALLEASDRELTAASSHACA |
| Ga0207701_102362001 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVQAAVRELLEQTIVTMDALLEASDRELAMPSSHGCAQGKDV |
| Ga0207704_112505502 | 3300025938 | Miscanthus Rhizosphere | MAATVREAIRELISQTLVTMDTLLEASDRELTMGSSHGCAQGKDLWTL |
| Ga0207640_111518632 | 3300025981 | Corn Rhizosphere | MAATVRGAIRELLEQTMVTVDALLEASDQELTMPSSHVCA |
| Ga0207703_104543631 | 3300026035 | Switchgrass Rhizosphere | MAETVQAAIRELLEQTMATMGALLEESDRELAMPSSHACAQGKDVWTLIT |
| Ga0207708_108828902 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAATVHSAIRELMEQTMTTMDALLEASDRELAAPSSHSCAQGKDVWTLITND |
| Ga0207641_105931692 | 3300026088 | Switchgrass Rhizosphere | MAATVREAIRELMTQTMATMDALLEASDRELTTASSHACAQGKDLWTLITNDI |
| Ga0207648_121441472 | 3300026089 | Miscanthus Rhizosphere | MAPTVRAAIRELMEQTMATMDALLEASDRELAMSSSHGCAQGKD |
| Ga0209235_10607013 | 3300026296 | Grasslands Soil | MAATVRGAIRELIEQTMLTMGALLEAPERELSVPSS |
| Ga0209235_12648112 | 3300026296 | Grasslands Soil | MAATVRAAIRELIEQTMVTMDALLEASDRELAMRSSHGCAQGKDVWALIT |
| Ga0209468_10420723 | 3300026306 | Soil | MAATVRGAIRELLEQTMVTIDALLEASDRELAMPSSHGCAQG |
| Ga0209761_11782121 | 3300026313 | Grasslands Soil | MAATVRAAIRELIEQTMVTMDALLEASDRELAMRSSHGCAQGKDVWALITNDT |
| Ga0209268_100134411 | 3300026314 | Soil | MAATVREAARELLEQATAMMDALLAASDRELTMASSH |
| Ga0209802_11141971 | 3300026328 | Soil | MAATVREAARELLEQAMAMMDALLAASDRELTMPS |
| Ga0209804_11894722 | 3300026335 | Soil | MAATVRGAIRELLEQTMVTIDALLEASDRELAMPSSHGCAQGKD |
| Ga0257166_10010991 | 3300026358 | Soil | MAATVRGAIRELIEQTMLTMGALLEASDRELSVPSSH |
| Ga0209157_12164071 | 3300026537 | Soil | MAATVRDAIRELLEQTMATMDALLVASDRELPMPSSHACAQGKDVWTLLSND |
| Ga0209056_105767042 | 3300026538 | Soil | MAATVREAIRELTRETMATMDILVEASDRELTMPSSHVCAQGKDV |
| Ga0209376_10034141 | 3300026540 | Soil | MAETVREAIRELMEQTMRTMDALLEASDRELAMSSSHPCAQGKDVWTLITND |
| Ga0209805_11185723 | 3300026542 | Soil | MAETVREAIRELMEQTMRTMDALLEASDRELAMSSSHACAQGKDVWTLI |
| Ga0209076_11048231 | 3300027643 | Vadose Zone Soil | MAATVRGAIRELLEQTMVTIDALLETSDRELAMPSSHACAQGKEAWTLI |
| Ga0209388_12312652 | 3300027655 | Vadose Zone Soil | MAATVRGAIRELLEQTRATMDALLEASDRELVAPSSHACA |
| Ga0209588_10541802 | 3300027671 | Vadose Zone Soil | MAATVRGAIRELLEQTRATMDALLEASDRELVAPSSHACAQGKDVWTLITN |
| Ga0209465_100722461 | 3300027874 | Tropical Forest Soil | MAATVRETVRELLEQTIATMDALLEASDRELPLPSSHACAQGKDLWTLI |
| Ga0209069_109068952 | 3300027915 | Watersheds | MAGTVREAVRELLEQTMATMDALLQASDRELAMPSSHACAQGKDVW |
| Ga0268265_123294942 | 3300028380 | Switchgrass Rhizosphere | MAATTVREAVRELLEQTMATMDALLAASDRELGMPSSHVCA |
| Ga0247818_109397541 | 3300028589 | Soil | MAATVRETVRELLEQTIATMDALLEASDRELPLPSSHVCAQSKDYT |
| Ga0257175_10073773 | 3300028673 | Soil | MAATVRGAIRELIEQTMLTMGALLEASDRELSVPSSHGCAQGKDVWTLI |
| Ga0307504_103331231 | 3300028792 | Soil | MAETVREAIRELMEQTTRTMDALLEASDRELAMSSSHPCAQGKDVWTLIT |
| Ga0307504_103365342 | 3300028792 | Soil | MAATVRGAIRELLEQTMATIDTLLATPDDELAMPSSHACAQGRDLRTLL |
| Ga0247826_106459621 | 3300030336 | Soil | MAATVRETVRELLEQTIATMDALLEASDRELPLPSSHVCAQRSLL |
| Ga0310813_119934332 | 3300031716 | Soil | MAATVREAIRELMTQTMATMDALLEASDRELTTPSSHACAQGKDLWTLITN |
| Ga0307469_105716051 | 3300031720 | Hardwood Forest Soil | MAATVREAIRELMTQTMATMDALLEAPDPELTMASSHAC |
| Ga0318526_103750032 | 3300031769 | Soil | MAATVRATIRELLEQTIATMDTLLEASDRELPLPSSHV |
| Ga0318547_100348611 | 3300031781 | Soil | MAATVRGAVRELLEQTIATIDALLEASDRELPLSSSHACAQGKDLWTLITND |
| Ga0307473_104160232 | 3300031820 | Hardwood Forest Soil | MAATVRGAIRELMEQTMTTMDALLEASDRELTMPS |
| Ga0306925_109973481 | 3300031890 | Soil | MAATVRGAVRELLEQTIATIDALLEASDRELPLSSSHACAQGKDLWTL |
| Ga0318520_110487321 | 3300031897 | Soil | MAATVHGAIRELLEQTMTTIDALLAATDRELPMSSSHGCAQGKDVWTLLTND |
| Ga0306926_100097361 | 3300031954 | Soil | MAATVRGAIRELLEQTMTTIDALLAATDRELPMFSSHG |
| Ga0310890_111603171 | 3300032075 | Soil | MAATVRGAIRELLEQTMTTIDTLLAATERELPMSSSHACAQ |
| Ga0310890_112310243 | 3300032075 | Soil | MAAIVREAVRELLEQTMVTMEALLTASDEELVMPSSHACAQGKDV |
| Ga0307471_1002529791 | 3300032180 | Hardwood Forest Soil | MAETVRESIRELMEQTMRTMDALLEASDRELAMSSSHPCAQ |
| Ga0307471_1018494382 | 3300032180 | Hardwood Forest Soil | MAATVREAIRELMTQTMATVDALLEASDPELTMASSHVCAQGKDLWTLI |
| Ga0335082_109993282 | 3300032782 | Soil | MAATVRATIRGLLEQTMATMDALLDASDRELPLPSSHVCAQGKDLWT |
| Ga0335080_114135901 | 3300032828 | Soil | MAATVRGAIRELLDQTIATMDALLEASDRELALPSSHVC |
| ⦗Top⦘ |