Basic Information | |
---|---|
Family ID | F033830 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 176 |
Average Sequence Length | 46 residues |
Representative Sequence | MPKANLGDVEIYYEEKGQGEAVLLAPPSWWPSDTWNVGVVPFLSKR |
Number of Associated Samples | 160 |
Number of Associated Scaffolds | 176 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 95.45 % |
% of genes near scaffold ends (potentially truncated) | 99.43 % |
% of genes from short scaffolds (< 2000 bps) | 87.50 % |
Associated GOLD sequencing projects | 156 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.864 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.523 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.955 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.523 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.11% β-sheet: 10.81% Coil/Unstructured: 81.08% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 176 Family Scaffolds |
---|---|---|
PF02515 | CoA_transf_3 | 11.36 |
PF09084 | NMT1 | 11.36 |
PF03070 | TENA_THI-4 | 6.25 |
PF06041 | DUF924 | 3.98 |
PF14518 | Haem_oxygenas_2 | 3.41 |
PF00561 | Abhydrolase_1 | 3.41 |
PF04828 | GFA | 2.84 |
PF12697 | Abhydrolase_6 | 2.27 |
PF01717 | Meth_synt_2 | 1.70 |
PF00691 | OmpA | 1.70 |
PF16868 | NMT1_3 | 1.14 |
PF13620 | CarboxypepD_reg | 1.14 |
PF05534 | HicB | 1.14 |
PF02518 | HATPase_c | 1.14 |
PF13193 | AMP-binding_C | 1.14 |
PF00293 | NUDIX | 0.57 |
PF02371 | Transposase_20 | 0.57 |
PF02826 | 2-Hacid_dh_C | 0.57 |
PF01740 | STAS | 0.57 |
PF06808 | DctM | 0.57 |
PF12146 | Hydrolase_4 | 0.57 |
PF00528 | BPD_transp_1 | 0.57 |
PF02452 | PemK_toxin | 0.57 |
PF08402 | TOBE_2 | 0.57 |
PF01797 | Y1_Tnp | 0.57 |
COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 11.36 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 11.36 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 11.36 |
COG3803 | Uncharacterized conserved protein, DUF924 family | Function unknown [S] | 3.98 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 2.84 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.70 |
COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 1.14 |
COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 1.14 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.57 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.57 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.86 % |
Unclassified | root | N/A | 1.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2209111006|2214775819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 779 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101120099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 523 | Open in IMG/M |
3300000550|F24TB_10348125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 857 | Open in IMG/M |
3300000789|JGI1027J11758_12989538 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10115156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 563 | Open in IMG/M |
3300002407|C687J29651_10079564 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300003999|Ga0055469_10008609 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
3300004052|Ga0055490_10292718 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300004114|Ga0062593_101693766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 690 | Open in IMG/M |
3300004266|Ga0055457_10212937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
3300004267|Ga0066396_10011789 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300004463|Ga0063356_105774468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300004778|Ga0062383_10576413 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
3300004782|Ga0062382_10209400 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 856 | Open in IMG/M |
3300004808|Ga0062381_10207453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 683 | Open in IMG/M |
3300005294|Ga0065705_11079935 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300005295|Ga0065707_10450385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 801 | Open in IMG/M |
3300005327|Ga0070658_10341391 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300005332|Ga0066388_104594012 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300005337|Ga0070682_100227745 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300005366|Ga0070659_101159256 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300005444|Ga0070694_101275656 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300005447|Ga0066689_10746318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
3300005450|Ga0066682_10057045 | All Organisms → cellular organisms → Bacteria | 2383 | Open in IMG/M |
3300005455|Ga0070663_101422763 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300005468|Ga0070707_101651677 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300005530|Ga0070679_101802518 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300005536|Ga0070697_101390170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora hirsuta | 627 | Open in IMG/M |
3300005617|Ga0068859_101128259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 863 | Open in IMG/M |
3300005713|Ga0066905_101380187 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300005713|Ga0066905_101446295 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300005764|Ga0066903_100686979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1800 | Open in IMG/M |
3300005878|Ga0075297_1013230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 825 | Open in IMG/M |
3300005879|Ga0075295_1022602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 747 | Open in IMG/M |
3300006031|Ga0066651_10438592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 694 | Open in IMG/M |
3300006047|Ga0075024_100644525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
3300006049|Ga0075417_10056604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1707 | Open in IMG/M |
3300006049|Ga0075417_10699254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
3300006354|Ga0075021_11129625 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300006755|Ga0079222_11850165 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300006847|Ga0075431_100085509 | All Organisms → cellular organisms → Bacteria | 3255 | Open in IMG/M |
3300006852|Ga0075433_10310181 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300006852|Ga0075433_11076029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 699 | Open in IMG/M |
3300006871|Ga0075434_101501051 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300006904|Ga0075424_102102888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 595 | Open in IMG/M |
3300009012|Ga0066710_100722770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1520 | Open in IMG/M |
3300009094|Ga0111539_11288736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 848 | Open in IMG/M |
3300009094|Ga0111539_11312187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 840 | Open in IMG/M |
3300009100|Ga0075418_10674521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1114 | Open in IMG/M |
3300009137|Ga0066709_103220808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 595 | Open in IMG/M |
3300009147|Ga0114129_12153432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
3300009157|Ga0105092_10783813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 558 | Open in IMG/M |
3300009162|Ga0075423_10037742 | All Organisms → cellular organisms → Bacteria | 4927 | Open in IMG/M |
3300009171|Ga0105101_10549130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
3300009176|Ga0105242_11375735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 732 | Open in IMG/M |
3300009545|Ga0105237_10997442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 844 | Open in IMG/M |
3300009609|Ga0105347_1003996 | All Organisms → cellular organisms → Bacteria | 5474 | Open in IMG/M |
3300009809|Ga0105089_1075505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 563 | Open in IMG/M |
3300010045|Ga0126311_11590012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
3300010166|Ga0126306_11722683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
3300010326|Ga0134065_10029433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1603 | Open in IMG/M |
3300010336|Ga0134071_10304604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 800 | Open in IMG/M |
3300010358|Ga0126370_10126108 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
3300010359|Ga0126376_12023425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 618 | Open in IMG/M |
3300010360|Ga0126372_11499923 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300010360|Ga0126372_12897650 | Not Available | 532 | Open in IMG/M |
3300010361|Ga0126378_11234372 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300010371|Ga0134125_12860315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
3300010375|Ga0105239_10146576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2633 | Open in IMG/M |
3300010391|Ga0136847_12665040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2072 | Open in IMG/M |
3300010391|Ga0136847_12821067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2488 | Open in IMG/M |
3300011271|Ga0137393_10425486 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300011402|Ga0137356_1076750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
3300011439|Ga0137432_1255843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
3300011445|Ga0137427_10140832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 989 | Open in IMG/M |
3300012199|Ga0137383_11198074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
3300012207|Ga0137381_10605785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 954 | Open in IMG/M |
3300012226|Ga0137447_1050246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 752 | Open in IMG/M |
3300012231|Ga0137465_1254353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
3300012354|Ga0137366_10238376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1351 | Open in IMG/M |
3300012355|Ga0137369_10571029 | Not Available | 790 | Open in IMG/M |
3300012474|Ga0157356_1025654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
3300012496|Ga0157353_1033738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
3300012510|Ga0157316_1057732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 554 | Open in IMG/M |
3300012532|Ga0137373_10375803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1109 | Open in IMG/M |
3300012532|Ga0137373_10553387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 873 | Open in IMG/M |
3300012923|Ga0137359_10073042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3001 | Open in IMG/M |
3300012929|Ga0137404_10758370 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300012930|Ga0137407_10745205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 924 | Open in IMG/M |
3300012931|Ga0153915_10647774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1218 | Open in IMG/M |
3300012944|Ga0137410_10383435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1130 | Open in IMG/M |
3300012944|Ga0137410_11651106 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300012948|Ga0126375_11790764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
3300012975|Ga0134110_10014810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2981 | Open in IMG/M |
3300013102|Ga0157371_10594335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 823 | Open in IMG/M |
3300013297|Ga0157378_11088698 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300013308|Ga0157375_11782344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 730 | Open in IMG/M |
3300014154|Ga0134075_10354662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 643 | Open in IMG/M |
3300014157|Ga0134078_10302596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 688 | Open in IMG/M |
3300014262|Ga0075301_1107851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 610 | Open in IMG/M |
3300015255|Ga0180077_1024045 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300015256|Ga0180073_1126432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
3300015358|Ga0134089_10261257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 710 | Open in IMG/M |
3300015359|Ga0134085_10019946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2549 | Open in IMG/M |
3300015372|Ga0132256_100020912 | All Organisms → cellular organisms → Bacteria | 5810 | Open in IMG/M |
3300016371|Ga0182034_10122039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1910 | Open in IMG/M |
3300017654|Ga0134069_1301052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
3300017944|Ga0187786_10135812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 872 | Open in IMG/M |
3300018000|Ga0184604_10090905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 929 | Open in IMG/M |
3300018053|Ga0184626_10375047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
3300018056|Ga0184623_10006879 | All Organisms → cellular organisms → Bacteria | 4844 | Open in IMG/M |
3300018056|Ga0184623_10346496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 666 | Open in IMG/M |
3300018056|Ga0184623_10513297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
3300018063|Ga0184637_10435490 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300018074|Ga0184640_10357182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 662 | Open in IMG/M |
3300018074|Ga0184640_10426186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
3300018075|Ga0184632_10110073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1209 | Open in IMG/M |
3300018081|Ga0184625_10413203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 695 | Open in IMG/M |
3300018084|Ga0184629_10089413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1489 | Open in IMG/M |
3300018422|Ga0190265_12825687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 580 | Open in IMG/M |
3300018469|Ga0190270_10737338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 983 | Open in IMG/M |
3300018469|Ga0190270_11249435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 783 | Open in IMG/M |
3300019360|Ga0187894_10292051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 756 | Open in IMG/M |
3300020034|Ga0193753_10381118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
3300021063|Ga0206227_1027935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 962 | Open in IMG/M |
3300021073|Ga0210378_10184323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 800 | Open in IMG/M |
3300021081|Ga0210379_10056577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1573 | Open in IMG/M |
3300021432|Ga0210384_10463417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1141 | Open in IMG/M |
3300021560|Ga0126371_11174725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 905 | Open in IMG/M |
3300025160|Ga0209109_10448088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 595 | Open in IMG/M |
3300025167|Ga0209642_10387872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 783 | Open in IMG/M |
3300025289|Ga0209002_10082005 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
3300025313|Ga0209431_10981357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 599 | Open in IMG/M |
3300025313|Ga0209431_11093310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 555 | Open in IMG/M |
3300025318|Ga0209519_10327528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 885 | Open in IMG/M |
3300025319|Ga0209520_10587548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 642 | Open in IMG/M |
3300025325|Ga0209341_10161565 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
3300025791|Ga0210115_1021123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1475 | Open in IMG/M |
3300025792|Ga0210143_1076881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
3300025912|Ga0207707_10493780 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300025936|Ga0207670_11260817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 626 | Open in IMG/M |
3300025938|Ga0207704_10761887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 806 | Open in IMG/M |
3300026045|Ga0208535_1013850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 763 | Open in IMG/M |
3300026075|Ga0207708_11612655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
3300026089|Ga0207648_12120939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
3300026111|Ga0208291_1075902 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300026116|Ga0207674_10648736 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300026307|Ga0209469_1003957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6498 | Open in IMG/M |
3300026327|Ga0209266_1039149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2432 | Open in IMG/M |
3300026328|Ga0209802_1027755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3012 | Open in IMG/M |
3300026329|Ga0209375_1008332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6621 | Open in IMG/M |
3300027277|Ga0209846_1027194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 922 | Open in IMG/M |
3300027654|Ga0209799_1100851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 655 | Open in IMG/M |
3300027873|Ga0209814_10000509 | All Organisms → cellular organisms → Bacteria | 12826 | Open in IMG/M |
3300027873|Ga0209814_10200031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 863 | Open in IMG/M |
3300027886|Ga0209486_10802590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 616 | Open in IMG/M |
3300027907|Ga0207428_10328157 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300027956|Ga0209820_1050727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
3300029636|Ga0222749_10650731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
3300031720|Ga0307469_10623648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 967 | Open in IMG/M |
3300031912|Ga0306921_12461170 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300031962|Ga0307479_10055473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3815 | Open in IMG/M |
3300032005|Ga0307411_12148954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 523 | Open in IMG/M |
3300032013|Ga0310906_10885315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
3300032144|Ga0315910_10116024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1974 | Open in IMG/M |
3300032180|Ga0307471_100008094 | All Organisms → cellular organisms → Bacteria | 6836 | Open in IMG/M |
3300032180|Ga0307471_103852536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 530 | Open in IMG/M |
3300032421|Ga0310812_10171405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 931 | Open in IMG/M |
3300032782|Ga0335082_10905226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 745 | Open in IMG/M |
3300032828|Ga0335080_10905670 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300032828|Ga0335080_12015531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 559 | Open in IMG/M |
3300032829|Ga0335070_10816111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 867 | Open in IMG/M |
3300033433|Ga0326726_10101497 | All Organisms → cellular organisms → Bacteria | 2575 | Open in IMG/M |
3300034115|Ga0364945_0005918 | All Organisms → cellular organisms → Bacteria | 3213 | Open in IMG/M |
3300034149|Ga0364929_0050655 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300034150|Ga0364933_202281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 522 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.52% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.82% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.11% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.41% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.41% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.27% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.27% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.27% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.70% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.70% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.70% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.70% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.70% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.14% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.14% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.14% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.14% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.14% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.14% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.14% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.14% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.14% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.14% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.14% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.57% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.57% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.57% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.57% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.57% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.57% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.57% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.57% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.57% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004266 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026045 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026111 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2213796948 | 2209111006 | Arabidopsis Rhizosphere | MPSAKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKVSVVPFLSKRYRTIIFDCR |
INPhiseqgaiiFebDRAFT_1011200991 | 3300000364 | Soil | MPKANLGDVEIYYEEQGKGEPILLAPASWWPSDTWNVTVVPFLSQSFKT |
F24TB_103481251 | 3300000550 | Soil | MPKANLGDIEIYYEEQGQGEPILLAPASWWSLETW |
JGI1027J11758_129895382 | 3300000789 | Soil | MPKANLGDVEIYYEEQGKGEPILLAPASWWPSXTWXVTVVPFLSXXFKT |
AF_2010_repII_A001DRAFT_101151562 | 3300000793 | Forest Soil | MPTADLGDLRIYYETQGEGEAILLVPPSWWPSDTWNVG |
C687J29651_100795643 | 3300002407 | Soil | MPTAALKDIELYYEEHGRGEPVLLVPPSWWPCDAWKVVVLSVVSQ |
Ga0055469_100086093 | 3300003999 | Natural And Restored Wetlands | MPAAKIGDIDIYYEEQGQGEPVLLAPPSWWPCDTWKVGVVPFLSKRFRTILFDC |
Ga0055490_102927182 | 3300004052 | Natural And Restored Wetlands | MAKANLGDVEIYYEEQGKGEPILLAPASWWPSDAWNVGVV |
Ga0062593_1016937662 | 3300004114 | Soil | MPAADLGEVTIYYESAGAGEAVLLCPPSWWPCDTWNVGVVPFLSQKFRTIIFDCRGTGYSSK |
Ga0055457_102129371 | 3300004266 | Natural And Restored Wetlands | MPTAELGDVTIYYESQGTGDAVLLCPPSWWPCDTWNVGVVPFLA |
Ga0066396_100117891 | 3300004267 | Tropical Forest Soil | MPTADLGDLKIYYETQGEGEAVLLVQPSWWPSDTWNVGVTQRLSQ |
Ga0063356_1057744681 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPTAKIGDVDIYYEEQGQGEPVLLAPPSWWPSDTWKVGVVP |
Ga0062383_105764132 | 3300004778 | Wetland Sediment | MPTANLADIEIYYEERGSGDTVLLCPPSWWPCDTWNVGVVPF |
Ga0062382_102094002 | 3300004782 | Wetland Sediment | MPTANLADIEIYYEERGSGDTVLLCPPSWWPCDTWNVGVV |
Ga0062381_102074532 | 3300004808 | Wetland Sediment | MATAKLADLEIYYEVQGNGEPVLLAPASWWPAATWNVGVVPFLSQRFKTIVF |
Ga0065705_110799351 | 3300005294 | Switchgrass Rhizosphere | MPKTNLGDIEIYYEERGQGESILLAPASWWPSDTWNVGVVP |
Ga0065707_104503851 | 3300005295 | Switchgrass Rhizosphere | MATATLNGVDTYYEVQGQGEPVLLVPASWWPSDTWNVGAVPFLSQRFKTIVFDCRGTG |
Ga0070658_103413911 | 3300005327 | Corn Rhizosphere | MPTALLNDVEVYYETEGNGETVLLVPPSWWPSDTWKVGVVP |
Ga0066388_1045940122 | 3300005332 | Tropical Forest Soil | VPKVNLRAIEIYYEEQGKGEPILLVPASWWPSDTWNVSVVPFLSKRFTTIT |
Ga0070682_1002277452 | 3300005337 | Corn Rhizosphere | MPTALLNDVELYCETEGNGEPVLLVPPSWWPSATWKVGVVPALSKRYR |
Ga0070659_1011592561 | 3300005366 | Corn Rhizosphere | MPTALLNDVELYYETEGNGEPVLLVPPSWWPSDTWKVGVVPALSKRYR |
Ga0070694_1012756561 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTADLGDVKIYYESQGGGEAVLLCPPSWWPSDTWNVGVVPFLAKRFRTII |
Ga0066689_107463181 | 3300005447 | Soil | MPKANLGEIEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRF |
Ga0066682_100570453 | 3300005450 | Soil | MPKANLGEIEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFKTI |
Ga0070663_1014227632 | 3300005455 | Corn Rhizosphere | MPTALLNDVELYYETEGNGEPVLLVPPSWWPSDTWKVGVVPAL |
Ga0070707_1016516771 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VPKAQLAGIDIYYEENGQGEPVLLVPASWWPSDTWNVGVVPF |
Ga0070679_1018025181 | 3300005530 | Corn Rhizosphere | MPTAKIGDVEIYYEEQGQGEPVLLAPPSWWPSDTWKVGVVPFLSK |
Ga0070697_1013901701 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTADLGDLKLYYETQGEGEAVLLVPPSWWPSDTWNVGVTQRLS |
Ga0068859_1011282592 | 3300005617 | Switchgrass Rhizosphere | MPTAKIGDVEIYHEEQGQGEPVLLAPPSWWPSDTWKVGVVP |
Ga0066905_1013801872 | 3300005713 | Tropical Forest Soil | MPTADLGDLKIYYETHGEGEAILLVPPSWWPGDTWNVGVTQRLSQRYRT |
Ga0066905_1014462952 | 3300005713 | Tropical Forest Soil | MPKANLGDVEIYYEQRGKGEPILLVPASWWPSDTWNVAVVPFLSKRFTTI |
Ga0066903_1006869791 | 3300005764 | Tropical Forest Soil | MPTADLGDLKIYYETQGEGEAILLVPPSWWPSDTWN |
Ga0075297_10132302 | 3300005878 | Rice Paddy Soil | MPAAKIGDIDIYYEEQGQGEPVLLAPPSWWPCDTWKVGVVPFLSKR |
Ga0075295_10226022 | 3300005879 | Rice Paddy Soil | MPSGKIGDIDIYFEEHGGGEPILLAPPSWWPSDTWKVGVVPFLSKRYRTIIFDCR |
Ga0066651_104385922 | 3300006031 | Soil | MTKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVG |
Ga0075024_1006445252 | 3300006047 | Watersheds | MPTAKLAELELYYEVQGNGEPLLLAPASWWPSATWNVGVVPTLSKRFKTITFD |
Ga0075417_100566043 | 3300006049 | Populus Rhizosphere | MPTANLGDVSLCYEETGQGEPVLLVPPSWWPAATWNVGVVPVLSQRYRTIIFDC |
Ga0075417_106992542 | 3300006049 | Populus Rhizosphere | MPKAQIGEIEIYYEQRGNGEPVLLVPPSWWPSDTWN |
Ga0075021_111296251 | 3300006354 | Watersheds | VPLANLGDLQIYYEERGGGEVVLLGPPSWWPCDTWSVRVVPSLSSRYRTIIFDCRGTG |
Ga0079222_118501651 | 3300006755 | Agricultural Soil | MPTALLNDVELYYETKGNGEAVLLVPPSWWPSDTWKIGVVPALSKRY |
Ga0075431_1000855093 | 3300006847 | Populus Rhizosphere | MPTANLNDVQIYYEDSGEGEVVLLAPPSWWPCDTWKI |
Ga0075433_103101812 | 3300006852 | Populus Rhizosphere | MPTALLNDVELYYETEGNGEPVLLVPPSWWPSDTWK |
Ga0075433_110760291 | 3300006852 | Populus Rhizosphere | MPKAKIGEIEIYYEQRGSGEPVLLVPPSWWPSDTW |
Ga0075434_1015010511 | 3300006871 | Populus Rhizosphere | MPTANLGDLKIYYETQGEGEAILLVPPSWWPSDTWNVG |
Ga0075424_1021028881 | 3300006904 | Populus Rhizosphere | MPTADLGDLKIYYETQGEGEVILLVPPSWWPSDTW |
Ga0066710_1007227703 | 3300009012 | Grasslands Soil | MPKANLGEIEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVP |
Ga0111539_112887361 | 3300009094 | Populus Rhizosphere | MPSVKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKVSVVPFL |
Ga0111539_113121871 | 3300009094 | Populus Rhizosphere | MPTANLGDVQLYYEDSGEGEAVLLSQPSWWPCDTWKINV |
Ga0075418_106745213 | 3300009100 | Populus Rhizosphere | MAKATLNGVEIYYEAEGRGEAVLLVPASWWPSDTWN |
Ga0066709_1032208081 | 3300009137 | Grasslands Soil | MAKATLNGVEIYYETQGQGEPVLLVPASWWPSDTWNVGVVPFLSRRFKTIV |
Ga0114129_121534322 | 3300009147 | Populus Rhizosphere | MAKATLNGVEIYYEAEGRGEAMLLAPASWWPSDTWNVGVVPFLS |
Ga0105092_107838131 | 3300009157 | Freshwater Sediment | MPTADLDDVKIYYESEGDGEPVLLAPPSWWPCDTWK |
Ga0075423_100377421 | 3300009162 | Populus Rhizosphere | MPKAKIGEIEIYYEQRGSGEPVLLVPPSWWPSDTWNVAVVPFLSKRYRSIIFD |
Ga0105101_105491301 | 3300009171 | Freshwater Sediment | MPTAKIGEIEIHYEERGEGEPVLLAPPSWWPSDTWKVGVVPF |
Ga0105242_113757351 | 3300009176 | Miscanthus Rhizosphere | MPKEKLADLELYYEDHGSGEAVLLTPASWWPSDTWNVGVVPFLSRR |
Ga0105237_109974421 | 3300009545 | Corn Rhizosphere | MPTALLNDVEVYYETEGNGETVLLVPPSWWPSDTWKVGVVPALAKRYRTII |
Ga0105347_10039967 | 3300009609 | Soil | MPIANLGDVSLYYEGSGQGEPVLLVPPSWWPAATWNVGVVPALIQRYRAIIFDC |
Ga0105089_10755052 | 3300009809 | Groundwater Sand | MPKAQIGEVEIYYEERGNGDPVLLVPPSWWPSDTWN |
Ga0126311_115900121 | 3300010045 | Serpentine Soil | MAIAELASLKMYYEVQGSGEPVLLAPASWWPSGTWNVGVVPYLSKSFKTIV |
Ga0126306_117226831 | 3300010166 | Serpentine Soil | MAIAELASLKIYYEAHGSGEPVLLAPASWWPSSTWN |
Ga0134065_100294333 | 3300010326 | Grasslands Soil | MPKANLGEIEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFK |
Ga0134071_103046042 | 3300010336 | Grasslands Soil | MPKAQIGEIEIYYEQRGNGEPVLLVPPSWWPSDTWNVGVVPFLSKRYRTI |
Ga0126370_101261081 | 3300010358 | Tropical Forest Soil | MPTAHMGDVSLYFEEKGQGEPVLLVPPSWWPAATWNVG |
Ga0126376_120234252 | 3300010359 | Tropical Forest Soil | MPTAHIGDISLYYEATGQGEPVLLVPPSWWPAATW |
Ga0126372_114999231 | 3300010360 | Tropical Forest Soil | MPTADLGDLKIYYETPGEGEAILLVPPSWWPSDTWNVGVTPRLSQRYRTI |
Ga0126372_128976501 | 3300010360 | Tropical Forest Soil | MPTADLGDLKIYYETQSEGEAVLLVQPSWWPSDTWNVGVTQRLS |
Ga0126378_112343721 | 3300010361 | Tropical Forest Soil | VPKTNLGEIEIYYEQQGKGEPILLVPASWWPSDTWN |
Ga0134125_128603151 | 3300010371 | Terrestrial Soil | MLNEVEIYFEENGQGDPVLLVPASWWPSDTWNVGAVPFLS |
Ga0105239_101465761 | 3300010375 | Corn Rhizosphere | MPTALLNDVEVYYETEGNGETVLLVPPSWWPSDTWKVGVVPA |
Ga0136847_126650401 | 3300010391 | Freshwater Sediment | MTVAKLGDLDLYYEVKSSGEAILLAPASWWPSDTWN |
Ga0136847_128210671 | 3300010391 | Freshwater Sediment | LIIIGLGGRVKVPLANLGDIQIYYEERGSGEAVLLAPPSWWPCDTWNVGVVPFLSRRYRT |
Ga0137393_104254862 | 3300011271 | Vadose Zone Soil | MPTADLGDLKIYYETQGEGEAILLVPPSWWPSTTWNVGVVPVLAKKYRTIIF |
Ga0137356_10767501 | 3300011402 | Soil | MQSMGCVMAIARLAELEIYYEVQGSGEPVLLTPASWWPSATWNVGVVPFLSKRFKTIT |
Ga0137432_12558432 | 3300011439 | Soil | MQSMGWVMAIARLAELEIYYEVQGSGEPVLLTPASWWPSATWNVGVVPFMSKRFRT |
Ga0137427_101408322 | 3300011445 | Soil | MPTADLGEVKIYYESQGGGEAVLLCPPSWWPSDTWNVSFVPFLAKRFRTIIFD |
Ga0137383_111980741 | 3300012199 | Vadose Zone Soil | VPKTQLAGIDIYYEENGQGEPVLLVPASWWPSDTWNVGVVPF |
Ga0137381_106057851 | 3300012207 | Vadose Zone Soil | MPTAKIGAVDIYYEEQGQGDPVLLAPPSWWPCDTWKVSVVPFLSKR |
Ga0137447_10502461 | 3300012226 | Soil | MPIAKLAELEMYYEAQGRGDAVLLAPASWWPSDTWNVGVVPF |
Ga0137465_12543531 | 3300012231 | Soil | MQSMGWVMAIARLAELEIYYEVQGSGEPVLLTPASWWPSATWNVGVVPFLSKRF |
Ga0137366_102383761 | 3300012354 | Vadose Zone Soil | MTKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGV |
Ga0137369_105710292 | 3300012355 | Vadose Zone Soil | MPKAKLSEIEIYYEVAGSGEPILLVPPSWWPSDTW |
Ga0157356_10256542 | 3300012474 | Unplanted Soil | MPSAKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKVSVVPFLSKHYR |
Ga0157353_10337382 | 3300012496 | Unplanted Soil | MPSAKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKV |
Ga0157316_10577321 | 3300012510 | Arabidopsis Rhizosphere | MPSAKIDDINIYYEEQGQGEPVLLAPPSWWPSDT* |
Ga0137373_103758031 | 3300012532 | Vadose Zone Soil | MPKANLSDVEIYYEEQGQGEPILLAPASWWPSDTWKVSVVPFLSKRFKTII |
Ga0137373_105533871 | 3300012532 | Vadose Zone Soil | MPKAQIGEIEIYYEQRGNGEPVLLVPPSWWPSDTWNV |
Ga0137359_100730424 | 3300012923 | Vadose Zone Soil | VPKAELAGIDIYYEENGQGEPVLLVPASWWPSDTWNVGVVPFLSRRF |
Ga0137404_107583701 | 3300012929 | Vadose Zone Soil | VPKAELAGIDIYYEENGQGEPVLLVPASWWPSDTWNVGVVPFLSRRFKTIVFDCRGTG |
Ga0137407_107452051 | 3300012930 | Vadose Zone Soil | VPKAELAGIDIYYEENGQGEPVLLVPASWWPSDTWNVGVVPFLSRRFKTIVFDCRGT |
Ga0153915_106477742 | 3300012931 | Freshwater Wetlands | LPKANLSDVEIYYEEEGQGDPVLIAPPSWWPCDTWKVGVVPTLSRRYRTIIF |
Ga0137410_103834351 | 3300012944 | Vadose Zone Soil | MPSAKIGDIDIYYEEHGQGEPVLLAPPSWWPCDTWNVKAVPFLSKRY |
Ga0137410_116511062 | 3300012944 | Vadose Zone Soil | MPKANLGDVEIYYEVQGEGEPVLFAPASWWPSDTWNVTVV |
Ga0126375_117907641 | 3300012948 | Tropical Forest Soil | MPKADVGDIEIYYEERGSGEAVLLVPASWWRSDTWNVG |
Ga0134110_100148101 | 3300012975 | Grasslands Soil | MPKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFKTII |
Ga0157371_105943351 | 3300013102 | Corn Rhizosphere | MPTALLNDVELYYETEGNGEPVLLVPPSWWPSDTWKVGVVPA |
Ga0157378_110886982 | 3300013297 | Miscanthus Rhizosphere | MPLAKLNDIELYYEDNGSGEAVLLCPPSWWPSDAWNVAVVPFLSRRFRTI |
Ga0157375_117823442 | 3300013308 | Miscanthus Rhizosphere | MAKATLNGIEIYYEAEGRGEAVLLVPASWWPSDTWNDGAVPFLSQRFKTIVFDCRGTGR |
Ga0134075_103546621 | 3300014154 | Grasslands Soil | MPKANLGDVEIYYEEKGQGEAVLLAPPSWWPSDTWNVGVVPFLSKR |
Ga0134078_103025962 | 3300014157 | Grasslands Soil | MTKANLGNVEIYYEEKGQGEAVLLAPPSWWPSDTWNVGVVPFLSKRFKT |
Ga0075301_11078511 | 3300014262 | Natural And Restored Wetlands | MPTAELADVKIYYESQGDGEAVLLCPPSWWPSDTWNVAIVPRLSKRFRT |
Ga0180077_10240451 | 3300015255 | Soil | MPKANLDDVEIYYEEQGEGEPILLAPASWWPSDTWNV |
Ga0180073_11264322 | 3300015256 | Soil | MQSMGWVMAIARLAELEIYYEVQGSGEPVLLTPASWWPSATWNVGVVPILSKRFKTITFDCR |
Ga0134089_102612572 | 3300015358 | Grasslands Soil | MPKANLGEIEIYYEEKGQGEAVLLAPPSWWPCDTWNVGVVPFLSKRFKTIIFDCRGTGR |
Ga0134085_100199461 | 3300015359 | Grasslands Soil | MPKANLGEIEIYYEEKGQGEAVLLVPPSWWPSDTWN |
Ga0132256_1000209128 | 3300015372 | Arabidopsis Rhizosphere | MPKANLADFEIYYEVQGEGEPVLLAPASWWPSDTWNVSVVPFLSKRF |
Ga0182034_101220395 | 3300016371 | Soil | MPTALLNDVELYYEENGNGDTILLVPPSWWPSDTWKVGVGPFLS |
Ga0134069_13010522 | 3300017654 | Grasslands Soil | MPKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFKTI |
Ga0187786_101358121 | 3300017944 | Tropical Peatland | MAKTNLTDLEMYYEEKGNGEALLLCPPSWWPCDAWNVGVVPFLSKRFRTIIFDCRG |
Ga0184604_100909051 | 3300018000 | Groundwater Sediment | MPTTKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKVGVVP |
Ga0184626_103750471 | 3300018053 | Groundwater Sediment | MPKAQLENLDMYYEEHGSGEAVLLAPASWWPSNTWNVGVVPFL |
Ga0184623_100068791 | 3300018056 | Groundwater Sediment | MPIASVNGIEIYFEEQGSGEAVLLVPASWWPGATWNVGVVPVLSPRYRTIVFD |
Ga0184623_103464961 | 3300018056 | Groundwater Sediment | MPKAKLCDLEFYYEEEGQGEPVLLAPPSWWPCDTWNIAVVPFLSKQYRTII |
Ga0184623_105132972 | 3300018056 | Groundwater Sediment | MPNAKIGDIEIYYEEQGQGEPVLLAPPSWWPCDTWNVGVVPFLSKRFRTI |
Ga0184637_104354901 | 3300018063 | Groundwater Sediment | MPTADLDDVKIYYESQGDGEAVLLCPPSWWPSDTWNVAVVPFLSKRFRTIIFDCRGT |
Ga0184640_103571822 | 3300018074 | Groundwater Sediment | MPKANLGDQEIYYEEEGQGEPVLLAPPSWWPCDTWNVGVVPFLSKRFRTIIFDC |
Ga0184640_104261862 | 3300018074 | Groundwater Sediment | MPSAKIGDIDIYYEEQGRGEPVLLAPPSWWPSDTWKVSV |
Ga0184632_101100731 | 3300018075 | Groundwater Sediment | MPKANLGDQEIYYEEEGQGEPVLLAPPSWWPSDTWNVGVVPYLSK |
Ga0184625_104132031 | 3300018081 | Groundwater Sediment | MPKANLGDVEIYYEVQGEGDPVLFAPASWWPSDTWNVTVVPFLEQRFR |
Ga0184629_100894133 | 3300018084 | Groundwater Sediment | VPLANLGDIQIFYEELGSGEVVLLAPPSWWPCDTWNVGVVPFLS |
Ga0190265_128256871 | 3300018422 | Soil | MPMASLNGIELYFEEQGNGEAVLLIPASWWPSDTWKVGVVPVLSRHYRT |
Ga0190270_107373382 | 3300018469 | Soil | MPTAELGSVTIYYESQGEGEAVLLCPPSWWPCDTWNVGVVPFLSKNFRTIIFDCRGTGNS |
Ga0190270_112494352 | 3300018469 | Soil | MPTAKIGDVEIYYEEQGQGEPVLLAPPSWWPSDTWKVGVVPFLSKRYRT |
Ga0187894_102920512 | 3300019360 | Microbial Mat On Rocks | MPNANLGDVSLYFEETGRGEPVLLVPPSWWPAATWN |
Ga0193753_103811181 | 3300020034 | Soil | MPTSKIGDVEIYHEEQGQGEAVLLAPPSWWPSDTWKVGVVPFLSKRYRT |
Ga0206227_10279352 | 3300021063 | Deep Subsurface Sediment | MATADLGDVKIYYESQGDGEALLLCPPSWWPSDTWNVAVVPFLSKRFRTIIFDCRGT |
Ga0210378_101843232 | 3300021073 | Groundwater Sediment | MPNAKIGDIEIYYEEQGQGEPVLLAPPSWWPCDTWNVD |
Ga0210379_100565773 | 3300021081 | Groundwater Sediment | MPTADLGDVKIYFESQGSGEAVLLCPPSWWPSDTWNVA |
Ga0210384_104634171 | 3300021432 | Soil | MPTTELGDLKLYYETQGEGEAILLVPPSWWPSDTWN |
Ga0126371_111747252 | 3300021560 | Tropical Forest Soil | MPKADLGDIEMYYEERGSGEAVLLVPASWWPSDTW |
Ga0209109_104480881 | 3300025160 | Soil | MPLLNLGDIQIYYEERGSGEAVLLAPPSWWPCDTWNVGVVPFLSQRYRTII |
Ga0209642_103878721 | 3300025167 | Soil | MPSANLDGIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRTII |
Ga0209002_100820051 | 3300025289 | Soil | MPSANLDDIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRTI |
Ga0209431_109813571 | 3300025313 | Soil | MPSANLDGIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRTIIF |
Ga0209431_110933101 | 3300025313 | Soil | MPSANLDDIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRT |
Ga0209519_103275282 | 3300025318 | Soil | MPSANLDDIQIYYEERGDGETLLLAPPSWWPCDTWNVA |
Ga0209520_105875481 | 3300025319 | Soil | MPSANLDDIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRTIIFD |
Ga0209341_101615654 | 3300025325 | Soil | MPSANLDGIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRTIIFDCRG |
Ga0210115_10211233 | 3300025791 | Natural And Restored Wetlands | MPAAKIGDIDIYYEEQGQGEPVLLAPPSWWPCDTWKVGVVPFLSKRFR |
Ga0210143_10768812 | 3300025792 | Natural And Restored Wetlands | MPTAKIGDVDIYYEEQGQGEPVLLAPPSWWPSDTWKVGV |
Ga0207707_104937801 | 3300025912 | Corn Rhizosphere | MPTALLNDVEVYYETEGNGETVLLVPPSWWPSDNWKV |
Ga0207670_112608172 | 3300025936 | Switchgrass Rhizosphere | MPTAMLNEVEIYFEENGQGDPVLLVPASWWPSDTWNVGAVPFLSRRFKTITL |
Ga0207704_107618872 | 3300025938 | Miscanthus Rhizosphere | MPTVDLGEVKIYYESQGGGEAVLLCPPSWWPSDTWNVAVVPFLAKRFRTIIFDCRGTGHS |
Ga0208535_10138502 | 3300026045 | Natural And Restored Wetlands | MPNTNIDDIEIYYEEHGQGEPVLLAPPSWWPSDTWKVSVVP |
Ga0207708_116126551 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MATATLNGVDTYYEVQGQGEPVLLVPASWWPSDTWNVGV |
Ga0207648_121209391 | 3300026089 | Miscanthus Rhizosphere | MPTALLNDVELHYETEGNGEPVLLVPLSSWPTDAWKVGVVPAL |
Ga0208291_10759021 | 3300026111 | Natural And Restored Wetlands | MPKANLGDVEIYYEVQGEGEPILLAPASWWPSDTWNVAVVPLLSQRFRTIAF |
Ga0207674_106487361 | 3300026116 | Corn Rhizosphere | MPTALLNDVELYYETEGNGEPVLLVPPSWWPSDTWKVGVVPALSKRY |
Ga0209469_10039571 | 3300026307 | Soil | MTKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSK |
Ga0209266_10391493 | 3300026327 | Soil | MTKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFKTIV |
Ga0209802_10277551 | 3300026328 | Soil | MPKANLGEIEIYYEEKGQGEPVLLAPPSWWPCDTWN |
Ga0209375_10083326 | 3300026329 | Soil | MTKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFKTIVFDCRGTGR |
Ga0209846_10271941 | 3300027277 | Groundwater Sand | MPKANLGEVEIYYEEQGNGEPILLAPASWWPSDTWNV |
Ga0209799_11008511 | 3300027654 | Tropical Forest Soil | MPKADVGDIEIYYEERGSGEAVLLVPASWWPSDTWNVGVVPF |
Ga0209814_1000050911 | 3300027873 | Populus Rhizosphere | MPTANLGDVSLCYEETGQGEPVLLVPPSWWPAATWNG |
Ga0209814_102000312 | 3300027873 | Populus Rhizosphere | MPKAQIGEIEIYYEQRGNGEPVLLVPPSWWPSDTWKVSVVPFLSKRFKTI |
Ga0209486_108025902 | 3300027886 | Agricultural Soil | MPTANLNDVQIYYEDSGEGKVVLFASPSWWPCDTWKINVVPFLSRRYRTIIFDCRGTG |
Ga0207428_103281572 | 3300027907 | Populus Rhizosphere | MQTALLNGVELYYETEGNGEPVLLVPPSWWPSATWKVGVVPALAKRYQ |
Ga0209820_10507273 | 3300027956 | Freshwater Sediment | MPKANLGDVEIYYEEHGKGEPILLAPASWWPSDAWKVSVVQFLSKR |
Ga0222749_106507312 | 3300029636 | Soil | MPKADLCDIEMYYEEKGSGEAVLLVPASWWPSDTWNVSIV |
Ga0307469_106236481 | 3300031720 | Hardwood Forest Soil | MPIAKLGDIEMYYEEKGSGEAVLLVPASWWPSDTWKVGVVPFLS |
Ga0306921_124611701 | 3300031912 | Soil | MPKANLGDVEIYYEVQGEGEPVLLAPASWWPSHTWN |
Ga0307479_100554732 | 3300031962 | Hardwood Forest Soil | MPTADLGDLKLYYETQGEGEAILLVPPSWWPSDTWNVGVTQRLSQRYRT |
Ga0307411_121489542 | 3300032005 | Rhizosphere | VPTAELGNVKIYYESQGEGDAVLLCPPSWWPCDTWNVGVVPFLSKNFR |
Ga0310906_108853152 | 3300032013 | Soil | MAKATLNGVEIYYEAEGRGEAVLLVPASWWPSDTWNVGVVPFL |
Ga0315910_101160243 | 3300032144 | Soil | MPTAKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKVAVVPFLA |
Ga0307471_1000080941 | 3300032180 | Hardwood Forest Soil | MPKAKLGDIEMYYEEKGSGEAVLLVAASWWPSDTW |
Ga0307471_1038525361 | 3300032180 | Hardwood Forest Soil | VPTADLGDLKLYYETQGEGQVILMVPPSWWPSDTWNVGITQRLSQRYRTIIFDCRGT |
Ga0310812_101714052 | 3300032421 | Soil | MPSAKIGDIDMYYEEAGQGEPVLLAPPSWWPSDTWKVGVVPFL |
Ga0335082_109052261 | 3300032782 | Soil | MPTADLGDLKIYYETQGAGEAILLVPPSWWPSDTWNIGVTQ |
Ga0335080_109056701 | 3300032828 | Soil | MPIADLGDLKIYYETQGEGEAILLVPPSWWPSDTWNIGVTQRLSQRYR |
Ga0335080_120155311 | 3300032828 | Soil | MPTADLGDLKIYYATQGAGEAILLVPPSWWPSDTWNIGVTQR |
Ga0335070_108161112 | 3300032829 | Soil | VPVANLSDVEIYYEDQGEGEPVFLAPPSWWPCDTWKVGVVPALSRRYRTIIFDPRGT |
Ga0326726_101014974 | 3300033433 | Peat Soil | MPIAKLAGLEIYYEAQGSGEPVLLAPASWWPSDTWNVGVVPFLSKRFRTIV |
Ga0364945_0005918_3049_3213 | 3300034115 | Sediment | MPKANLGDIEIYHEEQGEGEPILLVPASWWPSDTWNVTVVPFFSRRFKTIIFDCR |
Ga0364929_0050655_3_134 | 3300034149 | Sediment | MPRAAVNGVEIYFEENGQGEPVLLVPASWWPSNTWNVGAVPFLS |
Ga0364933_202281_1_114 | 3300034150 | Sediment | MPTAAVNGCEIYFEENGQGEPVLLVPASWWPSNTWNVG |
⦗Top⦘ |