Basic Information | |
---|---|
Family ID | F033783 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 176 |
Average Sequence Length | 43 residues |
Representative Sequence | MTDNDFPIRLAGQRLGLEATKLAGITPSEVTRRLRYQEAFPRT |
Number of Associated Samples | 125 |
Number of Associated Scaffolds | 176 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 71.75 % |
% of genes near scaffold ends (potentially truncated) | 17.61 % |
% of genes from short scaffolds (< 2000 bps) | 47.16 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.886 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (22.727 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (42.614 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 176 Family Scaffolds |
---|---|---|
PF02511 | Thy1 | 46.02 |
PF13392 | HNH_3 | 10.80 |
PF13529 | Peptidase_C39_2 | 5.11 |
PF08706 | D5_N | 5.11 |
PF12385 | Peptidase_C70 | 4.55 |
PF00589 | Phage_integrase | 1.70 |
PF03016 | Exostosin | 1.14 |
PF01612 | DNA_pol_A_exo1 | 1.14 |
PF03288 | Pox_D5 | 1.14 |
PF07728 | AAA_5 | 0.57 |
PF13578 | Methyltransf_24 | 0.57 |
PF00383 | dCMP_cyt_deam_1 | 0.57 |
PF07460 | NUMOD3 | 0.57 |
PF05050 | Methyltransf_21 | 0.57 |
PF03692 | CxxCxxCC | 0.57 |
PF14279 | HNH_5 | 0.57 |
PF00436 | SSB | 0.57 |
PF13936 | HTH_38 | 0.57 |
PF12708 | Pectate_lyase_3 | 0.57 |
COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
---|---|---|---|
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 46.02 |
COG3378 | DNA primase, phage- or plasmid-associated | Mobilome: prophages, transposons [X] | 1.14 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.57 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.45 % |
Unclassified | root | N/A | 4.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000116|DelMOSpr2010_c10022004 | All Organisms → cellular organisms → Bacteria | 3095 | Open in IMG/M |
3300001968|GOS2236_1048353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1543 | Open in IMG/M |
3300002835|B570J40625_100125512 | All Organisms → cellular organisms → Bacteria | 3033 | Open in IMG/M |
3300002835|B570J40625_100251836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1840 | Open in IMG/M |
3300003277|JGI25908J49247_10038379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1309 | Open in IMG/M |
3300003277|JGI25908J49247_10093151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 731 | Open in IMG/M |
3300004112|Ga0065166_10237646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 728 | Open in IMG/M |
3300004448|Ga0065861_1058605 | All Organisms → cellular organisms → Bacteria | 4913 | Open in IMG/M |
3300004481|Ga0069718_13494339 | Not Available | 644 | Open in IMG/M |
3300005074|Ga0070431_1135233 | Not Available | 961 | Open in IMG/M |
3300005527|Ga0068876_10056814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2378 | Open in IMG/M |
3300005527|Ga0068876_10215901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1109 | Open in IMG/M |
3300005528|Ga0068872_10646807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 558 | Open in IMG/M |
3300005581|Ga0049081_10000440 | All Organisms → cellular organisms → Bacteria | 15854 | Open in IMG/M |
3300005581|Ga0049081_10001848 | All Organisms → cellular organisms → Bacteria | 7959 | Open in IMG/M |
3300005581|Ga0049081_10010542 | All Organisms → cellular organisms → Bacteria | 3500 | Open in IMG/M |
3300005581|Ga0049081_10074479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1276 | Open in IMG/M |
3300005581|Ga0049081_10099982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1082 | Open in IMG/M |
3300005584|Ga0049082_10009812 | All Organisms → cellular organisms → Bacteria | 3220 | Open in IMG/M |
3300005613|Ga0074649_1001239 | All Organisms → cellular organisms → Bacteria | 31311 | Open in IMG/M |
3300005805|Ga0079957_1019844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 4730 | Open in IMG/M |
3300005805|Ga0079957_1023133 | All Organisms → cellular organisms → Bacteria | 4274 | Open in IMG/M |
3300005828|Ga0074475_10892238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 505 | Open in IMG/M |
3300006025|Ga0075474_10024922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2140 | Open in IMG/M |
3300006637|Ga0075461_10035278 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
3300006639|Ga0079301_1065469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1153 | Open in IMG/M |
3300006734|Ga0098073_1002112 | All Organisms → cellular organisms → Bacteria | 5115 | Open in IMG/M |
3300006734|Ga0098073_1012488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1395 | Open in IMG/M |
3300006734|Ga0098073_1013606 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
3300006734|Ga0098073_1014470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1259 | Open in IMG/M |
3300006734|Ga0098073_1016054 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300006790|Ga0098074_1078073 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300006802|Ga0070749_10001811 | All Organisms → cellular organisms → Bacteria | 14424 | Open in IMG/M |
3300006802|Ga0070749_10089368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1831 | Open in IMG/M |
3300006802|Ga0070749_10148534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1363 | Open in IMG/M |
3300006802|Ga0070749_10631411 | Not Available | 576 | Open in IMG/M |
3300006802|Ga0070749_10714390 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300006810|Ga0070754_10006082 | All Organisms → cellular organisms → Bacteria | 8059 | Open in IMG/M |
3300006916|Ga0070750_10447506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 534 | Open in IMG/M |
3300006917|Ga0075472_10710688 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300007202|Ga0103274_1220544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1360 | Open in IMG/M |
3300007345|Ga0070752_1029340 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
3300007363|Ga0075458_10083426 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300007363|Ga0075458_10155399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 707 | Open in IMG/M |
3300007363|Ga0075458_10202891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 608 | Open in IMG/M |
3300007538|Ga0099851_1034482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2020 | Open in IMG/M |
3300007538|Ga0099851_1094194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1144 | Open in IMG/M |
3300007539|Ga0099849_1001024 | All Organisms → cellular organisms → Bacteria | 13075 | Open in IMG/M |
3300007540|Ga0099847_1043874 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300007540|Ga0099847_1161307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 664 | Open in IMG/M |
3300007541|Ga0099848_1000148 | All Organisms → cellular organisms → Bacteria | 29368 | Open in IMG/M |
3300007541|Ga0099848_1005587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 5739 | Open in IMG/M |
3300007541|Ga0099848_1033390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2134 | Open in IMG/M |
3300007541|Ga0099848_1079747 | Not Available | 1277 | Open in IMG/M |
3300007561|Ga0102914_1020365 | Not Available | 2038 | Open in IMG/M |
3300007640|Ga0070751_1000442 | All Organisms → cellular organisms → Bacteria | 26528 | Open in IMG/M |
3300007734|Ga0104986_1936 | All Organisms → cellular organisms → Bacteria | 51064 | Open in IMG/M |
3300007735|Ga0104988_11010 | All Organisms → cellular organisms → Bacteria | 85685 | Open in IMG/M |
3300007960|Ga0099850_1006758 | All Organisms → cellular organisms → Bacteria | 5315 | Open in IMG/M |
3300008116|Ga0114350_1112146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 838 | Open in IMG/M |
3300008267|Ga0114364_1095856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 935 | Open in IMG/M |
3300008267|Ga0114364_1095895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 935 | Open in IMG/M |
3300009009|Ga0105105_10002128 | All Organisms → cellular organisms → Bacteria | 8115 | Open in IMG/M |
3300009009|Ga0105105_10743504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 587 | Open in IMG/M |
3300009149|Ga0114918_10161053 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300009152|Ga0114980_10002445 | All Organisms → cellular organisms → Bacteria | 13079 | Open in IMG/M |
3300009155|Ga0114968_10206418 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300009165|Ga0105102_10034781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2139 | Open in IMG/M |
3300009684|Ga0114958_10102096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1478 | Open in IMG/M |
3300010354|Ga0129333_10000817 | All Organisms → cellular organisms → Bacteria | 27384 | Open in IMG/M |
3300010354|Ga0129333_10000833 | All Organisms → cellular organisms → Bacteria | 27074 | Open in IMG/M |
3300010354|Ga0129333_10000914 | All Organisms → cellular organisms → Bacteria | 26053 | Open in IMG/M |
3300010354|Ga0129333_10001262 | All Organisms → cellular organisms → Bacteria | 22699 | Open in IMG/M |
3300010354|Ga0129333_10003844 | All Organisms → cellular organisms → Bacteria | 14071 | Open in IMG/M |
3300010354|Ga0129333_10023257 | All Organisms → cellular organisms → Bacteria | 5881 | Open in IMG/M |
3300010368|Ga0129324_10013897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 4148 | Open in IMG/M |
3300010370|Ga0129336_10003516 | All Organisms → cellular organisms → Bacteria | 9690 | Open in IMG/M |
3300010370|Ga0129336_10004633 | All Organisms → cellular organisms → Bacteria | 8481 | Open in IMG/M |
3300010370|Ga0129336_10057770 | All Organisms → cellular organisms → Bacteria | 2311 | Open in IMG/M |
3300010370|Ga0129336_10696206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 538 | Open in IMG/M |
3300010370|Ga0129336_10752525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 514 | Open in IMG/M |
3300010389|Ga0136549_10037405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2635 | Open in IMG/M |
3300011268|Ga0151620_1006841 | All Organisms → cellular organisms → Bacteria | 4166 | Open in IMG/M |
3300012000|Ga0119951_1047815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1243 | Open in IMG/M |
3300012017|Ga0153801_1000460 | All Organisms → cellular organisms → Bacteria | 9816 | Open in IMG/M |
3300013006|Ga0164294_10003809 | All Organisms → cellular organisms → Bacteria | 13357 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10011097 | All Organisms → cellular organisms → Bacteria | 9583 | Open in IMG/M |
3300013372|Ga0177922_10819675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 557 | Open in IMG/M |
3300014819|Ga0119954_1000202 | All Organisms → cellular organisms → Bacteria | 21313 | Open in IMG/M |
3300014819|Ga0119954_1001995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 6376 | Open in IMG/M |
3300015050|Ga0181338_1000336 | All Organisms → cellular organisms → Bacteria | 9515 | Open in IMG/M |
3300017701|Ga0181364_1041703 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300017723|Ga0181362_1063723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 754 | Open in IMG/M |
3300017736|Ga0181365_1010970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2255 | Open in IMG/M |
3300017774|Ga0181358_1133523 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300017777|Ga0181357_1227353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 656 | Open in IMG/M |
3300017778|Ga0181349_1143205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 864 | Open in IMG/M |
3300017784|Ga0181348_1006494 | All Organisms → cellular organisms → Bacteria | 5151 | Open in IMG/M |
3300017784|Ga0181348_1208567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 696 | Open in IMG/M |
3300017784|Ga0181348_1266259 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300017785|Ga0181355_1007990 | All Organisms → cellular organisms → Bacteria | 4674 | Open in IMG/M |
3300017788|Ga0169931_10013827 | All Organisms → cellular organisms → Bacteria | 10982 | Open in IMG/M |
3300017952|Ga0181583_10648776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 631 | Open in IMG/M |
3300019756|Ga0194023_1117320 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300019781|Ga0181360_100842 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
3300019781|Ga0181360_103155 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300019784|Ga0181359_1083478 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300020055|Ga0181575_10138950 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
3300020074|Ga0194113_10107684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2421 | Open in IMG/M |
3300020109|Ga0194112_10042702 | All Organisms → cellular organisms → Bacteria | 4645 | Open in IMG/M |
3300020179|Ga0194134_10181999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 920 | Open in IMG/M |
3300020183|Ga0194115_10071485 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
3300020221|Ga0194127_10199766 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300020494|Ga0208326_100022 | All Organisms → cellular organisms → Bacteria | 7957 | Open in IMG/M |
3300021323|Ga0210295_1143038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 665 | Open in IMG/M |
3300021368|Ga0213860_10205432 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300021376|Ga0194130_10047629 | All Organisms → cellular organisms → Bacteria | 3104 | Open in IMG/M |
3300021961|Ga0222714_10008073 | All Organisms → cellular organisms → Bacteria | 9483 | Open in IMG/M |
3300021963|Ga0222712_10001171 | All Organisms → cellular organisms → Bacteria | 33454 | Open in IMG/M |
3300021963|Ga0222712_10002401 | All Organisms → cellular organisms → Bacteria | 21463 | Open in IMG/M |
3300021964|Ga0222719_10139464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1723 | Open in IMG/M |
3300022063|Ga0212029_1025773 | Not Available | 809 | Open in IMG/M |
3300022183|Ga0196891_1014423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1533 | Open in IMG/M |
3300022187|Ga0196899_1005126 | All Organisms → cellular organisms → Bacteria | 5609 | Open in IMG/M |
3300022198|Ga0196905_1014075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2592 | Open in IMG/M |
3300022198|Ga0196905_1014240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2573 | Open in IMG/M |
3300022198|Ga0196905_1035254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1483 | Open in IMG/M |
3300022198|Ga0196905_1048180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1221 | Open in IMG/M |
3300022407|Ga0181351_1001831 | All Organisms → cellular organisms → Bacteria | 7118 | Open in IMG/M |
3300022407|Ga0181351_1064537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1497 | Open in IMG/M |
3300022748|Ga0228702_1010058 | All Organisms → cellular organisms → Bacteria | 3749 | Open in IMG/M |
3300022752|Ga0214917_10000401 | All Organisms → cellular organisms → Bacteria | 56730 | Open in IMG/M |
3300022752|Ga0214917_10004840 | All Organisms → cellular organisms → Bacteria | 14734 | Open in IMG/M |
3300022752|Ga0214917_10008028 | All Organisms → cellular organisms → Bacteria | 10491 | Open in IMG/M |
3300024262|Ga0210003_1066319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1759 | Open in IMG/M |
3300024343|Ga0244777_10025339 | All Organisms → cellular organisms → Bacteria | 3756 | Open in IMG/M |
3300025057|Ga0208018_125393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 660 | Open in IMG/M |
3300025057|Ga0208018_131058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 561 | Open in IMG/M |
3300025630|Ga0208004_1037248 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300025646|Ga0208161_1029188 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
3300025646|Ga0208161_1070888 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300025671|Ga0208898_1000681 | All Organisms → cellular organisms → Bacteria | 25308 | Open in IMG/M |
3300025674|Ga0208162_1000274 | All Organisms → cellular organisms → Bacteria | 30151 | Open in IMG/M |
3300025818|Ga0208542_1043578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1417 | Open in IMG/M |
3300025853|Ga0208645_1016476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 4237 | Open in IMG/M |
3300025889|Ga0208644_1027640 | All Organisms → Viruses | 3449 | Open in IMG/M |
3300027223|Ga0208169_1060164 | Not Available | 683 | Open in IMG/M |
3300027608|Ga0208974_1017237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2273 | Open in IMG/M |
3300027712|Ga0209499_1232637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 642 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1004689 | All Organisms → cellular organisms → Bacteria | 16650 | Open in IMG/M |
3300027733|Ga0209297_1001183 | All Organisms → cellular organisms → Bacteria | 15170 | Open in IMG/M |
3300027741|Ga0209085_1015174 | All Organisms → cellular organisms → Bacteria | 3781 | Open in IMG/M |
3300027762|Ga0209288_10009800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2688 | Open in IMG/M |
3300027762|Ga0209288_10237677 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1003652 | All Organisms → cellular organisms → Bacteria | 24656 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1005270 | All Organisms → cellular organisms → Bacteria | 18173 | Open in IMG/M |
3300031707|Ga0315291_10003435 | All Organisms → cellular organisms → Bacteria | 20493 | Open in IMG/M |
3300031758|Ga0315907_10004717 | All Organisms → cellular organisms → Bacteria | 15171 | Open in IMG/M |
3300031772|Ga0315288_10739433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 920 | Open in IMG/M |
3300031784|Ga0315899_10000216 | All Organisms → cellular organisms → Bacteria | 71253 | Open in IMG/M |
3300031857|Ga0315909_10053555 | All Organisms → cellular organisms → Bacteria | 3716 | Open in IMG/M |
3300031857|Ga0315909_10756671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 621 | Open in IMG/M |
3300031873|Ga0315297_10099348 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
3300031885|Ga0315285_10184870 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300031952|Ga0315294_10078473 | All Organisms → cellular organisms → Bacteria | 3459 | Open in IMG/M |
3300031952|Ga0315294_10110388 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
3300031963|Ga0315901_10451043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1016 | Open in IMG/M |
3300031997|Ga0315278_10160587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2300 | Open in IMG/M |
3300031999|Ga0315274_10066154 | All Organisms → cellular organisms → Bacteria | 4802 | Open in IMG/M |
3300032093|Ga0315902_10589880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 937 | Open in IMG/M |
3300033816|Ga0334980_0065083 | Not Available | 1534 | Open in IMG/M |
3300033993|Ga0334994_0032737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 3357 | Open in IMG/M |
3300033994|Ga0334996_0457448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 583 | Open in IMG/M |
3300034061|Ga0334987_0080785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 2565 | Open in IMG/M |
3300034073|Ga0310130_0007614 | All Organisms → cellular organisms → Bacteria | 4015 | Open in IMG/M |
3300034106|Ga0335036_0005545 | All Organisms → cellular organisms → Bacteria | 10634 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.73% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.50% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.95% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.82% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.55% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.55% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.98% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.98% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.98% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.41% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.41% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.84% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.27% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.70% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.70% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.14% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.14% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.14% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.57% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.57% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.57% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.57% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.57% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.57% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.57% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.57% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.57% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.57% |
Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.57% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.57% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.57% |
Marine Benthic Sponge Stylissa Massa Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005074 | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA | Host-Associated | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007202 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projects | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021323 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027223 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSpr2010_100220044 | 3300000116 | Marine | MTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRT* |
GOS2236_10483534 | 3300001968 | Marine | MRDTDFPIRMAGQRLGLEPYKLTGITPSEVTRRLRYQEAFPRS* |
B570J40625_1001255124 | 3300002835 | Freshwater | MYHTNDFPIRMAGQRLNLDAVRLAGTTPSEITRRLRYQEAFPKS* |
B570J40625_1002518363 | 3300002835 | Freshwater | MRDTDFPIRLAGQRLGLEAVRLPGLTPSEVTARLRYQQTFPRT* |
JGI25908J49247_100383792 | 3300003277 | Freshwater Lake | MDNDFPVRMAGARLGLDPTKMAGITPTELTKRLRYQEAFPRT* |
JGI25908J49247_100931511 | 3300003277 | Freshwater Lake | MIDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY* |
Ga0065166_102376463 | 3300004112 | Freshwater Lake | MVVDNDFPVRMAGQRFGLDAQRLARTTPSEVTARLRYQQTFPRT* |
Ga0065861_10586054 | 3300004448 | Marine | MGENDFPVRMAGARLGIDAARMAGTTPSEVTRRLRYQEAFPRT* |
Ga0069718_134943392 | 3300004481 | Sediment | MQGNEFPIRLAGQRLNLEATRMTGLTPSDITRRLRYQEAFPSS* |
Ga0070431_11352333 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | MMTDNDFPVRMAGQRLGLFAPHLAGLTPQEVTRRLRYQETFPQT* |
Ga0068876_100568142 | 3300005527 | Freshwater Lake | MMVDNDFPVRMAGQRLNLNSQRLSAVTPSEVTARLRYQQTFPRT* |
Ga0068876_102159012 | 3300005527 | Freshwater Lake | MKDNDFPIRMAGQRFGLDATRMSAVTPSEVTSRLRYQQTFPKT* |
Ga0068872_106468072 | 3300005528 | Freshwater Lake | MKDNDFPIRMAGQRFGLDAARMSAVTPSEVTSRLRYQQTFPKT* |
Ga0049081_100004406 | 3300005581 | Freshwater Lentic | MTDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY* |
Ga0049081_100018484 | 3300005581 | Freshwater Lentic | MRDTDFSIRLAGQRLGLEPFKLMGITPSEITRRLRYQEAFPRT* |
Ga0049081_100105423 | 3300005581 | Freshwater Lentic | MDNDFPVRMAGSRLGLAPMRVAGITPSELTKRLRYQEAFPRT* |
Ga0049081_100744792 | 3300005581 | Freshwater Lentic | MMVDNDFPVRMAGQRFGLDAQRLARTTPSEVTARLRYQQTFPRT* |
Ga0049081_100999824 | 3300005581 | Freshwater Lentic | MRDSDFPIRLAGQRLGLEAYKLTGITPTEITRRLRYQEAFPQS* |
Ga0049082_100098124 | 3300005584 | Freshwater Lentic | MMDNDFPVRMAGARLGLDPTKMAGITPTELTKRLRYQEAFPRT* |
Ga0074649_100123941 | 3300005613 | Saline Water And Sediment | MDNDFPVRMAGSRLGLDPMRVAGITPSELTKRLRYQEAFPRT* |
Ga0079957_10198446 | 3300005805 | Lake | MRYTNFPLRMAGQRLGLDAPRLAGLTPSDVTARLRYQQTFPRT* |
Ga0079957_10231337 | 3300005805 | Lake | MMADNDFPVRMAGQALGLLPPHLRGLTPQEVTRRLRYQEAFPQT* |
Ga0074475_108922382 | 3300005828 | Sediment (Intertidal) | MKDNDFPIRMAGQRFGLDAARMSAVTPSEVTSRLRYQQTF |
Ga0075474_100249223 | 3300006025 | Aqueous | MMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRT* |
Ga0075461_100352783 | 3300006637 | Aqueous | MMRDSDFPIRMAGARLNLDSTRLAGITPSEVTRRLRYQAANPAT* |
Ga0079301_10654693 | 3300006639 | Deep Subsurface | MMVDNDFPVRLAGQRFGLTARDIRGVTPTEVTSRLRYQQTFPRT* |
Ga0098073_10021127 | 3300006734 | Marine | MMVDNDFPIRLAGQRFGLSARDLRGVTPMEVTSRLRYQQTFPRT* |
Ga0098073_10124883 | 3300006734 | Marine | MSDNDFPIRMAGQRFGLDAARMSRLTPSEVTSRLRYQQTFPRS* |
Ga0098073_10136063 | 3300006734 | Marine | MMADNDFPIRLAGGALGLAPRELRGLTPQEVTRRLRYQETFPQT* |
Ga0098073_10144702 | 3300006734 | Marine | MTDNDFPIRLAGQRFGLDAAKMAAIKPSEVTARLRYQQTFPRS* |
Ga0098073_10160542 | 3300006734 | Marine | MMVDNDFPIRLAGQRFGLSARDLQGVTPMEVTSRLRYQQTFPKT* |
Ga0098074_10780731 | 3300006790 | Marine | ADNDFPIRLAGGALGLAPRELRGLTPQEVTRRLRYQETFPQT* |
Ga0070749_1000181112 | 3300006802 | Aqueous | MRDSDFPIRMAGQRLSLDSTRLAGITPSEVTRRLRYQAANPST* |
Ga0070749_100893685 | 3300006802 | Aqueous | MRDSDFPIRMAGARLNLDSTRLAGITPSEVTRRLRYQAANPAT* |
Ga0070749_101485342 | 3300006802 | Aqueous | MTDRDFPVRMAGQRFGLDAVRMAGITPGEVTARLRYQQTFPRT* |
Ga0070749_106314111 | 3300006802 | Aqueous | DFPIRMAGQRLNLDAVRLAGITPSEITRRLRYQEAFPKS* |
Ga0070749_107143901 | 3300006802 | Aqueous | VMADNDFPVRMAGQRLGLFAPHLAGLTPQEVTRRLRYQETFPQT* |
Ga0070754_100060825 | 3300006810 | Aqueous | MSDNDFPIRLAGQRFGLDAAKMARITPSEVTSRLRYQQTFPRS* |
Ga0070750_104475063 | 3300006916 | Aqueous | VTDNDFPIRLAGQRFGLDAARMSAITPSEVTSRLRYQQTFPRT* |
Ga0075472_107106881 | 3300006917 | Aqueous | TDFPIRMAGQRLGLEAYKLTGITPSEITRRLRYQEAFPRT* |
Ga0103274_12205442 | 3300007202 | Freshwater Lake | MMSDNAFPIRMAGQRLNLEPMRLRGTTPSEITSRLRYQETFPAT* |
Ga0070752_10293402 | 3300007345 | Aqueous | MTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRN* |
Ga0075458_100834261 | 3300007363 | Aqueous | QMRDTDFPIRMAGQRLGLEAYKLTGITPSEITRRLRYQEAFPRT* |
Ga0075458_101553991 | 3300007363 | Aqueous | LAGQRLGLEAVRLPGLTPSEVTARLRYQQTFPRT* |
Ga0075458_102028911 | 3300007363 | Aqueous | MGENDFPVRMAGTRFGIDAARMAGTTPSEVTRRLRYQEAFPRT* |
Ga0099851_10344824 | 3300007538 | Aqueous | MTDNDFPIRLAGQRFGLDAARMAAITPSEVTSRLRYQQTFPRT* |
Ga0099851_10941942 | 3300007538 | Aqueous | MMVDNDFPVRMAGQRFGLDAQRLARTTPSELTARLRYQQTFPRT* |
Ga0099849_100102411 | 3300007539 | Aqueous | VNDNDFPIRLAGQRFGLDAARMARITPSEVTSRLRYQQTFPRT* |
Ga0099847_10438743 | 3300007540 | Aqueous | MMAENDFPIRLAGGALGLAPRELRGLTPQEVTRRLRYQETFPQT* |
Ga0099847_11613072 | 3300007540 | Aqueous | MMVDNDFPIRLAGQRFGLSARDLRGVTPMEVTSRLRYQQ |
Ga0099848_100014833 | 3300007541 | Aqueous | MYHSNDFPIRMAGQRLNLDAVRLAGTTPSEITRRLRYQEAFPKS* |
Ga0099848_10055879 | 3300007541 | Aqueous | VTDNDFPIRLAGQRFGLDAVRMVGIKPSEVTARLRYQQTFPRT* |
Ga0099848_10333901 | 3300007541 | Aqueous | MMVDNDFPIRLAGQRFGLSARDLQGVTPMEVTSRLRYQQT |
Ga0099848_10797473 | 3300007541 | Aqueous | MRDSDFPIRLAGQRFGLDAYKMTGITPSEVTRRLRYQ |
Ga0102914_10203652 | 3300007561 | Estuarine | MYHTNDFPIRMAGQRLNLDAVRLAGITPSEITRRLRYQEAFPKS* |
Ga0070751_100044237 | 3300007640 | Aqueous | VTDNDFPIRLAGQRFGLDAARMARITPSEVTSRLRYQQTFPRT* |
Ga0104986_193626 | 3300007734 | Freshwater | MGENDFPVRMAGARLGIDAARMASTTPSEVTRRLRYQEAFPRT* |
Ga0104988_1101017 | 3300007735 | Freshwater | MGENDFPVRMAGARLGIDAARMANTTPSEVTRRLRYQEAFPRT* |
Ga0099850_10067588 | 3300007960 | Aqueous | MMADNDFPIRIAGGALGLAPRELRGLTPQEVTRRLRYQETFPQT* |
Ga0114350_11121462 | 3300008116 | Freshwater, Plankton | MMVDNDFPIRMAGQRFGLTARDIQGLTPTEVTSRLRYQQTFPKT* |
Ga0114364_10958561 | 3300008267 | Freshwater, Plankton | MMTDNDFPIRLAGQRFGLDSQRLARITPSEVTARLRYQQTFPRT* |
Ga0114364_10958951 | 3300008267 | Freshwater, Plankton | MTDNDFPIRLAGQRLGLSSQRLASITPSEVTARLRYQQTFPRT* |
Ga0105105_100021287 | 3300009009 | Freshwater Sediment | MVTDNDFPIRLAGQRLGLDSQRLARITPSEVTARLRYQQTFPRS* |
Ga0105105_107435041 | 3300009009 | Freshwater Sediment | MMSDNGFPIRMAGQRLNLDPMRMRGITPSELTRRLRYQET |
Ga0114918_101610532 | 3300009149 | Deep Subsurface | MMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRS* |
Ga0114980_1000244511 | 3300009152 | Freshwater Lake | MDNDFPVRMAGAGLGIDSSRLAGITPSEVTRRLRYQEAFPRS* |
Ga0114968_102064182 | 3300009155 | Freshwater Lake | MGENDFPVRMAGARLGIDAARMAGTTPSEVTRRLRYQEAFPRA* |
Ga0105102_100347813 | 3300009165 | Freshwater Sediment | MQGNDFPIRLAGQRLNLEATRLTGLTPSDITRRLRYQEAFPST* |
Ga0114958_101020962 | 3300009684 | Freshwater Lake | MRDSDFPIRMAGQRLGLDAYRMTGITPAEVTRRLRYQETFPRT* |
Ga0129333_100008175 | 3300010354 | Freshwater To Marine Saline Gradient | MRDSDFPIRLAGQRLGLEAYKLSGITPSEITRRLRYQETFPRT* |
Ga0129333_100008337 | 3300010354 | Freshwater To Marine Saline Gradient | MRDSDFPVRLAGQRLGLEAYKLTGITPTEITRRLRYQETFPRT* |
Ga0129333_1000091414 | 3300010354 | Freshwater To Marine Saline Gradient | MRDTNFPIRMAGQRLGLDAPRLAGLTPSDVTARLRYQQTFPRT* |
Ga0129333_1000126225 | 3300010354 | Freshwater To Marine Saline Gradient | MRDTDFPIRMAGQRLGLEPYKLTGITPTELTRRLRYQETFPRT* |
Ga0129333_1000384411 | 3300010354 | Freshwater To Marine Saline Gradient | MRDSDFPIRMAGQRLNLDSTRLAGITPSEVTRRLRYQAANPST* |
Ga0129333_100232572 | 3300010354 | Freshwater To Marine Saline Gradient | MRDTDFPIRMAGQRLGLEAYKLTGITPSEITRRLRYQEAFPRT* |
Ga0129324_100138972 | 3300010368 | Freshwater To Marine Saline Gradient | MVDNDFPVRLAGQRFGLSARDLRGVTPMEVTSRLRYQQTFPRT* |
Ga0129336_1000351611 | 3300010370 | Freshwater To Marine Saline Gradient | MMSDNGFPIRMAGQRLNLDPMRMRGITPSELTRRLRYQETFPST* |
Ga0129336_1000463314 | 3300010370 | Freshwater To Marine Saline Gradient | MRDSDFPVRMAGQRLGLQAYKLTGITPTEITRRLRYQEANPST* |
Ga0129336_100577702 | 3300010370 | Freshwater To Marine Saline Gradient | MTDRDFPVRMAGQRFGLDAVRMAGITPGEVTERLRYQQTFPRT* |
Ga0129336_106962061 | 3300010370 | Freshwater To Marine Saline Gradient | QMTDNDFPIRMAGQRLGLDVVRLRGLTPSEVTARLRYQETFPRT* |
Ga0129336_107525251 | 3300010370 | Freshwater To Marine Saline Gradient | KERWLIVRDSDFPIRLAGQRLGLDAYKMTGITPSEVTRRLRYQAANPST* |
Ga0136549_100374053 | 3300010389 | Marine Methane Seep Sediment | MRDSDFPIRMAGQRLGLEPYKLVGITPTELTRRLRYQETFPRT* |
Ga0151620_10068415 | 3300011268 | Freshwater | MENDFPIRMAGGALGLRKEQLLGLTPSEVTRRLRYQEAFPQT* |
Ga0119951_10478152 | 3300012000 | Freshwater | MGENDFPVRMAGARLGIDAARMAGTTPSEVTRRLRYQEGFPRT* |
Ga0153801_100046015 | 3300012017 | Freshwater | MRDTDFPIRLAGQRLGLEALRLPGLTPSEVTARLRYQQTFPRT* |
Ga0164294_1000380913 | 3300013006 | Freshwater | MRDSDFPIRMAGQRLGLDAYKMTGITPTEVTRRLRYQEAFPRT* |
(restricted) Ga0172367_1001109710 | 3300013126 | Freshwater | MRDTDFPIRLAGQRLGLEATRLPSLTPSEVTARLRYQQTFPRT* |
Ga0177922_108196752 | 3300013372 | Freshwater | VSPGQDEKGGSQVRDNDFPLRLAGQRFGLDAVRMSSITPSEVTARLRYQQTFPRT* |
Ga0119954_100020217 | 3300014819 | Freshwater | MDNDFPVRMAGSRLGLDPLRVASITPSELTKRLRYQEAFPRT* |
Ga0119954_10019959 | 3300014819 | Freshwater | MGENDFPVRMAGARLGIDAARMAHATPSEVTRRLRYQEAFPRT* |
Ga0181338_10003364 | 3300015050 | Freshwater Lake | MSDNNFPIRLAGQRLGLEATKLSGITPSEVTRRLRYQEAFPRT* |
Ga0181364_10417031 | 3300017701 | Freshwater Lake | NNFPIRLAGQRLGLEATKLSGITPSEVTRRLRYQEAFPRT |
Ga0181362_10637233 | 3300017723 | Freshwater Lake | FPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY |
Ga0181365_10109702 | 3300017736 | Freshwater Lake | MMDNDFPVRIAGARLGLDPTKMAGITPTELTKRLRYQEAFPRT |
Ga0181358_11335233 | 3300017774 | Freshwater Lake | EFGSRKEGSKMIDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY |
Ga0181357_12273531 | 3300017777 | Freshwater Lake | EGSKMTDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY |
Ga0181349_11432051 | 3300017778 | Freshwater Lake | MQGNEFPIRLAGQRLNLEATRMTGLTPSDITRRLRYQEAFPSS |
Ga0181348_100649413 | 3300017784 | Freshwater Lake | MRDTDFPIRLAGQRLGLEAVRLPGLTPSEVTARLRYQQTF |
Ga0181348_12085672 | 3300017784 | Freshwater Lake | MDNDFPVRMAGSRLGLDPMRVAGITPSELTKRLRYQEAFPR |
Ga0181348_12662593 | 3300017784 | Freshwater Lake | HEFGSRKEGSKMIDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY |
Ga0181355_10079901 | 3300017785 | Freshwater Lake | MRDTDFPIRLAGQRLGLEAVRLPGLTPSEVTARLRY |
Ga0169931_1001382716 | 3300017788 | Freshwater | MRDTDFPIRLAGQRLGLEATRLPSLTPSEVTARLRYQQTFPRT |
Ga0181583_106487763 | 3300017952 | Salt Marsh | DNDFPVRMAGQRLGLFAPHLAGLTPQEVTRRLRYQETFPQT |
Ga0194023_11173201 | 3300019756 | Freshwater | MMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRT |
Ga0181360_1008424 | 3300019781 | Freshwater Lake | MMDNDFPVRMAGARLGLDPTKMAGITPTELTKRLRYQEAFPRT |
Ga0181360_1031551 | 3300019781 | Freshwater Lake | MIDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY |
Ga0181359_10834782 | 3300019784 | Freshwater Lake | MDNDFPVRMAGARLGLDPTKMAGITPTELTKRLRYQEAFPRT |
Ga0181575_101389504 | 3300020055 | Salt Marsh | MADNDFPVRMAGQRLGLFAPHLAGLTPQEVTRRLRYQETFPQT |
Ga0194113_101076845 | 3300020074 | Freshwater Lake | MRDTDFPIRMAGQRLGLEPYKLAGITPSEVTRRLRYQEAFPRT |
Ga0194112_1004270211 | 3300020109 | Freshwater Lake | VRDTNFPIRLAGQRLGLEPFKLMGITPSEITRRLRYQEAFPQT |
Ga0194134_101819992 | 3300020179 | Freshwater Lake | MKDNDFPVRMAGQRLGLEAYKLSGITPSELTRRLRYQETFPRT |
Ga0194115_100714856 | 3300020183 | Freshwater Lake | MTENDFPIRMAGGAMGLHKEQLRGITPSEITRLLRYQAAFPSY |
Ga0194127_101997661 | 3300020221 | Freshwater Lake | FCFKQKVRDTNFPIRLAGQRLGLEPFKLMGITPSEITRRLRYQEAFPQT |
Ga0208326_1000226 | 3300020494 | Freshwater | MYHTNDFPIRMAGQRLNLDAVRLAGTTPSEITRRLRYQEAFPKS |
Ga0210295_11430382 | 3300021323 | Estuarine | MKDNDFPIRMAGQRFGLDAARMSAVTPSEVTSRLRYQQTFPKT |
Ga0213860_102054322 | 3300021368 | Seawater | MMVDNDFPIRLAGQRFGLSARDLRGVTPMEVTSRLRYQQTFPRT |
Ga0194130_100476294 | 3300021376 | Freshwater Lake | MRDNDFPIRMAGQRLGLEPYKLTGITPTEVTRRLRYQEAFPRT |
Ga0222714_100080736 | 3300021961 | Estuarine Water | MDNDFPVRMAGSRLGLAPMRVADITPSELTKRLRYQEAFPRT |
Ga0222712_1000117150 | 3300021963 | Estuarine Water | MRDTDFPIRMAGQRMGLEPYKLTGITPTEITRRLRYQEAFPRT |
Ga0222712_1000240116 | 3300021963 | Estuarine Water | MRDTDFPIRMAGQRLGLEAYKLTGITPSEITRRLRYQEAFPRT |
Ga0222719_101394644 | 3300021964 | Estuarine Water | MMVDNDFPIRLAGQRFGLTARDIQGVTPMEVTSRLRYQQTFPKT |
Ga0212029_10257732 | 3300022063 | Aqueous | MMADNDFPIRLAGGALGLAPRELRGLTPQEVTRRLRYQETFPQT |
Ga0196891_10144232 | 3300022183 | Aqueous | MTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRT |
Ga0196899_10051265 | 3300022187 | Aqueous | MMVDNDFPVRMAGQRFGLDAQRLARTTPSEVTARLRYQQTFPRT |
Ga0196905_10140755 | 3300022198 | Aqueous | MMVDNDFPVRMAGQRFGLDAQRLARTTPSELTARLRYQQTFPRT |
Ga0196905_10142404 | 3300022198 | Aqueous | MVDNDFPVRLAGQRFGLSARDLRGVTPMEVTSRLRYQQTFPRT |
Ga0196905_10352543 | 3300022198 | Aqueous | MMVDNDFPIRLAGQRFGLSARDLQGVTPMEVTSRLRYQQTFPKT |
Ga0196905_10481803 | 3300022198 | Aqueous | MTDNDFPIRLAGQRFGLDAARMAAITPSEVTSRLRYQQTFPRT |
Ga0181351_10018316 | 3300022407 | Freshwater Lake | MQGNDFPIRLAGQRLNLEATRLTGLTPSDITRRLRYQEAFPSS |
Ga0181351_10645372 | 3300022407 | Freshwater Lake | MRDTDFPIRMAGQRFGLDAARMSAVTPSEVTSRLRYQQTFPRT |
Ga0228702_10100584 | 3300022748 | Freshwater | MRDTDFPIRLAGQRLGLDAVRLPGLTPSEVTARLRYQQTFPRT |
Ga0214917_1000040153 | 3300022752 | Freshwater | MTDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY |
Ga0214917_1000484012 | 3300022752 | Freshwater | MDNDFPVRMAGSRLGLDPLRVASITPSELTKRLRYQEAFPRT |
Ga0214917_1000802813 | 3300022752 | Freshwater | MENDFPVRMAGGILGLHKEQLRGLTPSEVTRRLRYQEAFPQT |
Ga0210003_10663193 | 3300024262 | Deep Subsurface | MMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRS |
Ga0244777_100253394 | 3300024343 | Estuarine | MYHTNDFPIRMAGQRLNLDAVRLAGITPSEITRRLRYQEAFPKS |
Ga0208018_1253932 | 3300025057 | Marine | MSDNDFPIRMAGQRFGLDAARMSRLTPSEVTSRLRYQQTFPRS |
Ga0208018_1310582 | 3300025057 | Marine | MTDNDFPIRLAGQRFGLDAAKMAAIKPSEVTARLRYQQTFPRS |
Ga0208004_10372483 | 3300025630 | Aqueous | MMRDSDFPIRMAGARLNLDSTRLAGITPSEVTRRLRYQAANPAT |
Ga0208161_10291886 | 3300025646 | Aqueous | MYHSNDFPIRMAGQRLNLDAVRLAGTTPSEITRRLRYQEAFPKS |
Ga0208161_10708882 | 3300025646 | Aqueous | MRDSDFPIRMAGARLNLDSTRLAGITPSEVTRRLRYQAANPAT |
Ga0208898_100068140 | 3300025671 | Aqueous | VTDNDFPIRLAGQRFGLDAARMARITPSEVTSRLRYQQTFPRT |
Ga0208162_100027410 | 3300025674 | Aqueous | VNDNDFPIRLAGQRFGLDAARMARITPSEVTSRLRYQQTFPRT |
Ga0208542_10435782 | 3300025818 | Aqueous | MRDSDFPIRMAGQRLSLDSTRLAGITPSEVTRRLRYQAANPST |
Ga0208645_10164767 | 3300025853 | Aqueous | MSDNDFPIRLAGQRFGLDAAKMARITPSEVTSRLRYQQTFPRS |
Ga0208644_10276407 | 3300025889 | Aqueous | MMADNDFPVRMAGQALGLLPPHLRGLTPQEVTRRLRYQEAFPQT |
Ga0208169_10601642 | 3300027223 | Estuarine | DFPIRMAGQRLNLDAVRLAGITPSEITRRLRYQEAFPKS |
Ga0208974_10172373 | 3300027608 | Freshwater Lentic | MRDTDFSIRLAGQRLGLEPFKLMGITPSEITRRLRYQEAFPRT |
Ga0209499_12326371 | 3300027712 | Freshwater Lake | MRDSDFPIRMAGQRLGLDAYRMTGITPAEVTRRLRYQETF |
(restricted) Ga0247833_100468919 | 3300027730 | Freshwater | MDNDFPVRMAGSRLGLDPMRVAGITPSELTKRLRYQEAFPRT |
Ga0209297_100118310 | 3300027733 | Freshwater Lake | MDNDFPVRMAGAGLGIDSSRLAGITPSEVTRRLRYQEAFPRS |
Ga0209085_10151747 | 3300027741 | Freshwater Lake | MGENDFPVRMAGARLGIDAARMAGTTPSEVTRRLRYQEAFPRA |
Ga0209288_100098005 | 3300027762 | Freshwater Sediment | MVVDNDFPVRMAGQRFGLDAQRLARTTPSEVTARLRYQQTFPRT |
Ga0209288_102376773 | 3300027762 | Freshwater Sediment | MVTDNDFPIRLAGQRLGLDSQRLARITPSEVTARLRYQQTFPRS |
(restricted) Ga0247843_10036529 | 3300028569 | Freshwater | MTDNDFPIRLAGQRLGLEATKLAGITPSEVTRRLRYQEAFPRT |
(restricted) Ga0247843_100527011 | 3300028569 | Freshwater | MDNDFPVRMAGARLGLDPTKVGGITPTELTKRLRYQEAFPST |
Ga0315291_100034359 | 3300031707 | Sediment | MRDSDFPIRMAGQRLGLDAYKMTGITPTEVTRRLRYQEAFPRT |
Ga0315907_1000471712 | 3300031758 | Freshwater | MMVDNDFPIRMAGQRFGLTARDIQGLTPTEVTSRLRYQQTFPKT |
Ga0315288_107394331 | 3300031772 | Sediment | MSDNNFPIRLAGQRLGLEATKLSGITPSEVTRRLRYQEAF |
Ga0315899_100002165 | 3300031784 | Freshwater | MKDNDFPIRMAGQRFGLDATRMSAVTPSEVTSRLRYQQTFPKT |
Ga0315909_100535555 | 3300031857 | Freshwater | MVDNDFPVRMAGQRLNLNSQRLSAVTPSEVTARLRYQQTFPRT |
Ga0315909_107566711 | 3300031857 | Freshwater | MMTDNDFPIRLAGQRFGLDSQRLARITPSEVTARLRYQQTFPRT |
Ga0315297_100993485 | 3300031873 | Sediment | MDNDFPVRMAGARLGLDPTKMAGVTPTELTKRLRYQEAFPRT |
Ga0315285_101848703 | 3300031885 | Sediment | MSDNNFPIRLAGQRLGLEATKLSGITPSEVTRRLRYQEAFPRT |
Ga0315294_100784735 | 3300031952 | Sediment | SRKEGSKMTDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY |
Ga0315294_101103882 | 3300031952 | Sediment | MDNDFPVRMAGARLGLDPTKMAGLTPTELTKRLRYQEAFPRT |
Ga0315901_104510432 | 3300031963 | Freshwater | MMTDNDFPIRLAGQRLGLSSQRLASITPSEVTARLRYQQTFPRT |
Ga0315278_101605871 | 3300031997 | Sediment | MMDNDFPVRMAGARLGLDPTKMAGITPTELTKRLRYQEAFPR |
Ga0315274_100661543 | 3300031999 | Sediment | MIGNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY |
Ga0315902_105898803 | 3300032093 | Freshwater | MTDNDFPIRLAGQRLGLSSQRLASITPSEVTARLRYQQTFPRT |
Ga0334980_0065083_23_157 | 3300033816 | Freshwater | MYHTNDFPIRMAGQRLNLDAVRLAGTTPSEITRRLKYQQAFPKS |
Ga0334994_0032737_2513_2644 | 3300033993 | Freshwater | MQGNDFPIRLAGQRLNLEATRLTGLTPSDITRRLRYQEAFPST |
Ga0334996_0457448_143_274 | 3300033994 | Freshwater | MTDNDFPIRMAGQRLGLDVVRLRGLTPSEVTARLRYQETFPRT |
Ga0334987_0080785_1877_2011 | 3300034061 | Freshwater | MMVDNDFPVRMAGQRLNLNSQRLSAVTPSEVTARLRYQQAFPRT |
Ga0310130_0007614_463_594 | 3300034073 | Fracking Water | MRDTDFPIRLAGQRLGLEASRLPSLTPSEVTARLRYQQTFPRT |
Ga0335036_0005545_3454_3588 | 3300034106 | Freshwater | MMSDNGFPIRMAGQRLNLDPMRMRGITPSELTRRLRYQETFPST |
⦗Top⦘ |