NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033783

Metagenome / Metatranscriptome Family F033783

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033783
Family Type Metagenome / Metatranscriptome
Number of Sequences 176
Average Sequence Length 43 residues
Representative Sequence MTDNDFPIRLAGQRLGLEATKLAGITPSEVTRRLRYQEAFPRT
Number of Associated Samples 125
Number of Associated Scaffolds 176

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.75 %
% of genes near scaffold ends (potentially truncated) 17.61 %
% of genes from short scaffolds (< 2000 bps) 47.16 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.886 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(22.727 % of family members)
Environment Ontology (ENVO) Unclassified
(36.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(42.614 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.39%    β-sheet: 0.00%    Coil/Unstructured: 67.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 176 Family Scaffolds
PF02511Thy1 46.02
PF13392HNH_3 10.80
PF13529Peptidase_C39_2 5.11
PF08706D5_N 5.11
PF12385Peptidase_C70 4.55
PF00589Phage_integrase 1.70
PF03016Exostosin 1.14
PF01612DNA_pol_A_exo1 1.14
PF03288Pox_D5 1.14
PF07728AAA_5 0.57
PF13578Methyltransf_24 0.57
PF00383dCMP_cyt_deam_1 0.57
PF07460NUMOD3 0.57
PF05050Methyltransf_21 0.57
PF03692CxxCxxCC 0.57
PF14279HNH_5 0.57
PF00436SSB 0.57
PF13936HTH_38 0.57
PF12708Pectate_lyase_3 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 176 Family Scaffolds
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 46.02
COG3378DNA primase, phage- or plasmid-associatedMobilome: prophages, transposons [X] 1.14
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 0.57
COG2965Primosomal replication protein NReplication, recombination and repair [L] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.45 %
UnclassifiedrootN/A4.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10022004All Organisms → cellular organisms → Bacteria3095Open in IMG/M
3300001968|GOS2236_1048353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1543Open in IMG/M
3300002835|B570J40625_100125512All Organisms → cellular organisms → Bacteria3033Open in IMG/M
3300002835|B570J40625_100251836All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1840Open in IMG/M
3300003277|JGI25908J49247_10038379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1309Open in IMG/M
3300003277|JGI25908J49247_10093151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium731Open in IMG/M
3300004112|Ga0065166_10237646All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium728Open in IMG/M
3300004448|Ga0065861_1058605All Organisms → cellular organisms → Bacteria4913Open in IMG/M
3300004481|Ga0069718_13494339Not Available644Open in IMG/M
3300005074|Ga0070431_1135233Not Available961Open in IMG/M
3300005527|Ga0068876_10056814All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2378Open in IMG/M
3300005527|Ga0068876_10215901All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1109Open in IMG/M
3300005528|Ga0068872_10646807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium558Open in IMG/M
3300005581|Ga0049081_10000440All Organisms → cellular organisms → Bacteria15854Open in IMG/M
3300005581|Ga0049081_10001848All Organisms → cellular organisms → Bacteria7959Open in IMG/M
3300005581|Ga0049081_10010542All Organisms → cellular organisms → Bacteria3500Open in IMG/M
3300005581|Ga0049081_10074479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1276Open in IMG/M
3300005581|Ga0049081_10099982All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1082Open in IMG/M
3300005584|Ga0049082_10009812All Organisms → cellular organisms → Bacteria3220Open in IMG/M
3300005613|Ga0074649_1001239All Organisms → cellular organisms → Bacteria31311Open in IMG/M
3300005805|Ga0079957_1019844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium4730Open in IMG/M
3300005805|Ga0079957_1023133All Organisms → cellular organisms → Bacteria4274Open in IMG/M
3300005828|Ga0074475_10892238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium505Open in IMG/M
3300006025|Ga0075474_10024922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2140Open in IMG/M
3300006637|Ga0075461_10035278All Organisms → cellular organisms → Bacteria1642Open in IMG/M
3300006639|Ga0079301_1065469All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1153Open in IMG/M
3300006734|Ga0098073_1002112All Organisms → cellular organisms → Bacteria5115Open in IMG/M
3300006734|Ga0098073_1012488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1395Open in IMG/M
3300006734|Ga0098073_1013606All Organisms → cellular organisms → Bacteria1313Open in IMG/M
3300006734|Ga0098073_1014470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1259Open in IMG/M
3300006734|Ga0098073_1016054All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300006790|Ga0098074_1078073All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300006802|Ga0070749_10001811All Organisms → cellular organisms → Bacteria14424Open in IMG/M
3300006802|Ga0070749_10089368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1831Open in IMG/M
3300006802|Ga0070749_10148534All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1363Open in IMG/M
3300006802|Ga0070749_10631411Not Available576Open in IMG/M
3300006802|Ga0070749_10714390All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300006810|Ga0070754_10006082All Organisms → cellular organisms → Bacteria8059Open in IMG/M
3300006916|Ga0070750_10447506All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium534Open in IMG/M
3300006917|Ga0075472_10710688All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300007202|Ga0103274_1220544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1360Open in IMG/M
3300007345|Ga0070752_1029340All Organisms → cellular organisms → Bacteria2686Open in IMG/M
3300007363|Ga0075458_10083426All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300007363|Ga0075458_10155399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium707Open in IMG/M
3300007363|Ga0075458_10202891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium608Open in IMG/M
3300007538|Ga0099851_1034482All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2020Open in IMG/M
3300007538|Ga0099851_1094194All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1144Open in IMG/M
3300007539|Ga0099849_1001024All Organisms → cellular organisms → Bacteria13075Open in IMG/M
3300007540|Ga0099847_1043874All Organisms → cellular organisms → Bacteria1417Open in IMG/M
3300007540|Ga0099847_1161307All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium664Open in IMG/M
3300007541|Ga0099848_1000148All Organisms → cellular organisms → Bacteria29368Open in IMG/M
3300007541|Ga0099848_1005587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium5739Open in IMG/M
3300007541|Ga0099848_1033390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2134Open in IMG/M
3300007541|Ga0099848_1079747Not Available1277Open in IMG/M
3300007561|Ga0102914_1020365Not Available2038Open in IMG/M
3300007640|Ga0070751_1000442All Organisms → cellular organisms → Bacteria26528Open in IMG/M
3300007734|Ga0104986_1936All Organisms → cellular organisms → Bacteria51064Open in IMG/M
3300007735|Ga0104988_11010All Organisms → cellular organisms → Bacteria85685Open in IMG/M
3300007960|Ga0099850_1006758All Organisms → cellular organisms → Bacteria5315Open in IMG/M
3300008116|Ga0114350_1112146All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium838Open in IMG/M
3300008267|Ga0114364_1095856All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium935Open in IMG/M
3300008267|Ga0114364_1095895All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium935Open in IMG/M
3300009009|Ga0105105_10002128All Organisms → cellular organisms → Bacteria8115Open in IMG/M
3300009009|Ga0105105_10743504All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium587Open in IMG/M
3300009149|Ga0114918_10161053All Organisms → cellular organisms → Bacteria1331Open in IMG/M
3300009152|Ga0114980_10002445All Organisms → cellular organisms → Bacteria13079Open in IMG/M
3300009155|Ga0114968_10206418All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300009165|Ga0105102_10034781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2139Open in IMG/M
3300009684|Ga0114958_10102096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1478Open in IMG/M
3300010354|Ga0129333_10000817All Organisms → cellular organisms → Bacteria27384Open in IMG/M
3300010354|Ga0129333_10000833All Organisms → cellular organisms → Bacteria27074Open in IMG/M
3300010354|Ga0129333_10000914All Organisms → cellular organisms → Bacteria26053Open in IMG/M
3300010354|Ga0129333_10001262All Organisms → cellular organisms → Bacteria22699Open in IMG/M
3300010354|Ga0129333_10003844All Organisms → cellular organisms → Bacteria14071Open in IMG/M
3300010354|Ga0129333_10023257All Organisms → cellular organisms → Bacteria5881Open in IMG/M
3300010368|Ga0129324_10013897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium4148Open in IMG/M
3300010370|Ga0129336_10003516All Organisms → cellular organisms → Bacteria9690Open in IMG/M
3300010370|Ga0129336_10004633All Organisms → cellular organisms → Bacteria8481Open in IMG/M
3300010370|Ga0129336_10057770All Organisms → cellular organisms → Bacteria2311Open in IMG/M
3300010370|Ga0129336_10696206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium538Open in IMG/M
3300010370|Ga0129336_10752525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium514Open in IMG/M
3300010389|Ga0136549_10037405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2635Open in IMG/M
3300011268|Ga0151620_1006841All Organisms → cellular organisms → Bacteria4166Open in IMG/M
3300012000|Ga0119951_1047815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1243Open in IMG/M
3300012017|Ga0153801_1000460All Organisms → cellular organisms → Bacteria9816Open in IMG/M
3300013006|Ga0164294_10003809All Organisms → cellular organisms → Bacteria13357Open in IMG/M
(restricted) 3300013126|Ga0172367_10011097All Organisms → cellular organisms → Bacteria9583Open in IMG/M
3300013372|Ga0177922_10819675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium557Open in IMG/M
3300014819|Ga0119954_1000202All Organisms → cellular organisms → Bacteria21313Open in IMG/M
3300014819|Ga0119954_1001995All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium6376Open in IMG/M
3300015050|Ga0181338_1000336All Organisms → cellular organisms → Bacteria9515Open in IMG/M
3300017701|Ga0181364_1041703All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300017723|Ga0181362_1063723All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium754Open in IMG/M
3300017736|Ga0181365_1010970All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2255Open in IMG/M
3300017774|Ga0181358_1133523All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300017777|Ga0181357_1227353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium656Open in IMG/M
3300017778|Ga0181349_1143205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium864Open in IMG/M
3300017784|Ga0181348_1006494All Organisms → cellular organisms → Bacteria5151Open in IMG/M
3300017784|Ga0181348_1208567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium696Open in IMG/M
3300017784|Ga0181348_1266259All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300017785|Ga0181355_1007990All Organisms → cellular organisms → Bacteria4674Open in IMG/M
3300017788|Ga0169931_10013827All Organisms → cellular organisms → Bacteria10982Open in IMG/M
3300017952|Ga0181583_10648776All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium631Open in IMG/M
3300019756|Ga0194023_1117320All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300019781|Ga0181360_100842All Organisms → cellular organisms → Bacteria2302Open in IMG/M
3300019781|Ga0181360_103155All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300019784|Ga0181359_1083478All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300020055|Ga0181575_10138950All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300020074|Ga0194113_10107684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2421Open in IMG/M
3300020109|Ga0194112_10042702All Organisms → cellular organisms → Bacteria4645Open in IMG/M
3300020179|Ga0194134_10181999All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium920Open in IMG/M
3300020183|Ga0194115_10071485All Organisms → cellular organisms → Bacteria2058Open in IMG/M
3300020221|Ga0194127_10199766All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300020494|Ga0208326_100022All Organisms → cellular organisms → Bacteria7957Open in IMG/M
3300021323|Ga0210295_1143038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium665Open in IMG/M
3300021368|Ga0213860_10205432All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300021376|Ga0194130_10047629All Organisms → cellular organisms → Bacteria3104Open in IMG/M
3300021961|Ga0222714_10008073All Organisms → cellular organisms → Bacteria9483Open in IMG/M
3300021963|Ga0222712_10001171All Organisms → cellular organisms → Bacteria33454Open in IMG/M
3300021963|Ga0222712_10002401All Organisms → cellular organisms → Bacteria21463Open in IMG/M
3300021964|Ga0222719_10139464All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1723Open in IMG/M
3300022063|Ga0212029_1025773Not Available809Open in IMG/M
3300022183|Ga0196891_1014423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1533Open in IMG/M
3300022187|Ga0196899_1005126All Organisms → cellular organisms → Bacteria5609Open in IMG/M
3300022198|Ga0196905_1014075All Organisms → cellular organisms → Bacteria → Proteobacteria2592Open in IMG/M
3300022198|Ga0196905_1014240All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2573Open in IMG/M
3300022198|Ga0196905_1035254All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1483Open in IMG/M
3300022198|Ga0196905_1048180All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1221Open in IMG/M
3300022407|Ga0181351_1001831All Organisms → cellular organisms → Bacteria7118Open in IMG/M
3300022407|Ga0181351_1064537All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1497Open in IMG/M
3300022748|Ga0228702_1010058All Organisms → cellular organisms → Bacteria3749Open in IMG/M
3300022752|Ga0214917_10000401All Organisms → cellular organisms → Bacteria56730Open in IMG/M
3300022752|Ga0214917_10004840All Organisms → cellular organisms → Bacteria14734Open in IMG/M
3300022752|Ga0214917_10008028All Organisms → cellular organisms → Bacteria10491Open in IMG/M
3300024262|Ga0210003_1066319All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1759Open in IMG/M
3300024343|Ga0244777_10025339All Organisms → cellular organisms → Bacteria3756Open in IMG/M
3300025057|Ga0208018_125393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium660Open in IMG/M
3300025057|Ga0208018_131058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium561Open in IMG/M
3300025630|Ga0208004_1037248All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300025646|Ga0208161_1029188All Organisms → cellular organisms → Bacteria1961Open in IMG/M
3300025646|Ga0208161_1070888All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300025671|Ga0208898_1000681All Organisms → cellular organisms → Bacteria25308Open in IMG/M
3300025674|Ga0208162_1000274All Organisms → cellular organisms → Bacteria30151Open in IMG/M
3300025818|Ga0208542_1043578All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1417Open in IMG/M
3300025853|Ga0208645_1016476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium4237Open in IMG/M
3300025889|Ga0208644_1027640All Organisms → Viruses3449Open in IMG/M
3300027223|Ga0208169_1060164Not Available683Open in IMG/M
3300027608|Ga0208974_1017237All Organisms → cellular organisms → Bacteria → Proteobacteria2273Open in IMG/M
3300027712|Ga0209499_1232637All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium642Open in IMG/M
(restricted) 3300027730|Ga0247833_1004689All Organisms → cellular organisms → Bacteria16650Open in IMG/M
3300027733|Ga0209297_1001183All Organisms → cellular organisms → Bacteria15170Open in IMG/M
3300027741|Ga0209085_1015174All Organisms → cellular organisms → Bacteria3781Open in IMG/M
3300027762|Ga0209288_10009800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2688Open in IMG/M
3300027762|Ga0209288_10237677All Organisms → cellular organisms → Bacteria600Open in IMG/M
(restricted) 3300028569|Ga0247843_1003652All Organisms → cellular organisms → Bacteria24656Open in IMG/M
(restricted) 3300028569|Ga0247843_1005270All Organisms → cellular organisms → Bacteria18173Open in IMG/M
3300031707|Ga0315291_10003435All Organisms → cellular organisms → Bacteria20493Open in IMG/M
3300031758|Ga0315907_10004717All Organisms → cellular organisms → Bacteria15171Open in IMG/M
3300031772|Ga0315288_10739433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium920Open in IMG/M
3300031784|Ga0315899_10000216All Organisms → cellular organisms → Bacteria71253Open in IMG/M
3300031857|Ga0315909_10053555All Organisms → cellular organisms → Bacteria3716Open in IMG/M
3300031857|Ga0315909_10756671All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium621Open in IMG/M
3300031873|Ga0315297_10099348All Organisms → cellular organisms → Bacteria2304Open in IMG/M
3300031885|Ga0315285_10184870All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300031952|Ga0315294_10078473All Organisms → cellular organisms → Bacteria3459Open in IMG/M
3300031952|Ga0315294_10110388All Organisms → cellular organisms → Bacteria2833Open in IMG/M
3300031963|Ga0315901_10451043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1016Open in IMG/M
3300031997|Ga0315278_10160587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2300Open in IMG/M
3300031999|Ga0315274_10066154All Organisms → cellular organisms → Bacteria4802Open in IMG/M
3300032093|Ga0315902_10589880All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium937Open in IMG/M
3300033816|Ga0334980_0065083Not Available1534Open in IMG/M
3300033993|Ga0334994_0032737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium3357Open in IMG/M
3300033994|Ga0334996_0457448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium583Open in IMG/M
3300034061|Ga0334987_0080785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium2565Open in IMG/M
3300034073|Ga0310130_0007614All Organisms → cellular organisms → Bacteria4015Open in IMG/M
3300034106|Ga0335036_0005545All Organisms → cellular organisms → Bacteria10634Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous22.73%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake12.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater7.95%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient6.82%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.55%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.55%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.98%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.98%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.41%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.41%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.84%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.27%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.27%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.70%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.70%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.14%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.14%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.14%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.57%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.57%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.57%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.57%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.57%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.57%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.57%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.57%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.57%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.57%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.57%
Marine Benthic Sponge Stylissa Massa AssociatedHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated0.57%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001968Marine microbial communities from Lake Gatun, Panama - GS020EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005074Marine benthic sponge Stylissa massa associated microbial communities from Guam, USAHost-AssociatedOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005613Saline sediment microbial communities from Etoliko Lagoon, Greece - sedimentEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005828Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBIEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007202Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300007735Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014OctEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012000Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007AEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014819Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011AEnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300019781Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.DEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020494Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022748Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MGEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027223Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027712Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027762Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1002200443300000116MarineMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRT*
GOS2236_104835343300001968MarineMRDTDFPIRMAGQRLGLEPYKLTGITPSEVTRRLRYQEAFPRS*
B570J40625_10012551243300002835FreshwaterMYHTNDFPIRMAGQRLNLDAVRLAGTTPSEITRRLRYQEAFPKS*
B570J40625_10025183633300002835FreshwaterMRDTDFPIRLAGQRLGLEAVRLPGLTPSEVTARLRYQQTFPRT*
JGI25908J49247_1003837923300003277Freshwater LakeMDNDFPVRMAGARLGLDPTKMAGITPTELTKRLRYQEAFPRT*
JGI25908J49247_1009315113300003277Freshwater LakeMIDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY*
Ga0065166_1023764633300004112Freshwater LakeMVVDNDFPVRMAGQRFGLDAQRLARTTPSEVTARLRYQQTFPRT*
Ga0065861_105860543300004448MarineMGENDFPVRMAGARLGIDAARMAGTTPSEVTRRLRYQEAFPRT*
Ga0069718_1349433923300004481SedimentMQGNEFPIRLAGQRLNLEATRMTGLTPSDITRRLRYQEAFPSS*
Ga0070431_113523333300005074Marine Benthic Sponge Stylissa Massa AssociatedMMTDNDFPVRMAGQRLGLFAPHLAGLTPQEVTRRLRYQETFPQT*
Ga0068876_1005681423300005527Freshwater LakeMMVDNDFPVRMAGQRLNLNSQRLSAVTPSEVTARLRYQQTFPRT*
Ga0068876_1021590123300005527Freshwater LakeMKDNDFPIRMAGQRFGLDATRMSAVTPSEVTSRLRYQQTFPKT*
Ga0068872_1064680723300005528Freshwater LakeMKDNDFPIRMAGQRFGLDAARMSAVTPSEVTSRLRYQQTFPKT*
Ga0049081_1000044063300005581Freshwater LenticMTDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY*
Ga0049081_1000184843300005581Freshwater LenticMRDTDFSIRLAGQRLGLEPFKLMGITPSEITRRLRYQEAFPRT*
Ga0049081_1001054233300005581Freshwater LenticMDNDFPVRMAGSRLGLAPMRVAGITPSELTKRLRYQEAFPRT*
Ga0049081_1007447923300005581Freshwater LenticMMVDNDFPVRMAGQRFGLDAQRLARTTPSEVTARLRYQQTFPRT*
Ga0049081_1009998243300005581Freshwater LenticMRDSDFPIRLAGQRLGLEAYKLTGITPTEITRRLRYQEAFPQS*
Ga0049082_1000981243300005584Freshwater LenticMMDNDFPVRMAGARLGLDPTKMAGITPTELTKRLRYQEAFPRT*
Ga0074649_1001239413300005613Saline Water And SedimentMDNDFPVRMAGSRLGLDPMRVAGITPSELTKRLRYQEAFPRT*
Ga0079957_101984463300005805LakeMRYTNFPLRMAGQRLGLDAPRLAGLTPSDVTARLRYQQTFPRT*
Ga0079957_102313373300005805LakeMMADNDFPVRMAGQALGLLPPHLRGLTPQEVTRRLRYQEAFPQT*
Ga0074475_1089223823300005828Sediment (Intertidal)MKDNDFPIRMAGQRFGLDAARMSAVTPSEVTSRLRYQQTF
Ga0075474_1002492233300006025AqueousMMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRT*
Ga0075461_1003527833300006637AqueousMMRDSDFPIRMAGARLNLDSTRLAGITPSEVTRRLRYQAANPAT*
Ga0079301_106546933300006639Deep SubsurfaceMMVDNDFPVRLAGQRFGLTARDIRGVTPTEVTSRLRYQQTFPRT*
Ga0098073_100211273300006734MarineMMVDNDFPIRLAGQRFGLSARDLRGVTPMEVTSRLRYQQTFPRT*
Ga0098073_101248833300006734MarineMSDNDFPIRMAGQRFGLDAARMSRLTPSEVTSRLRYQQTFPRS*
Ga0098073_101360633300006734MarineMMADNDFPIRLAGGALGLAPRELRGLTPQEVTRRLRYQETFPQT*
Ga0098073_101447023300006734MarineMTDNDFPIRLAGQRFGLDAAKMAAIKPSEVTARLRYQQTFPRS*
Ga0098073_101605423300006734MarineMMVDNDFPIRLAGQRFGLSARDLQGVTPMEVTSRLRYQQTFPKT*
Ga0098074_107807313300006790MarineADNDFPIRLAGGALGLAPRELRGLTPQEVTRRLRYQETFPQT*
Ga0070749_10001811123300006802AqueousMRDSDFPIRMAGQRLSLDSTRLAGITPSEVTRRLRYQAANPST*
Ga0070749_1008936853300006802AqueousMRDSDFPIRMAGARLNLDSTRLAGITPSEVTRRLRYQAANPAT*
Ga0070749_1014853423300006802AqueousMTDRDFPVRMAGQRFGLDAVRMAGITPGEVTARLRYQQTFPRT*
Ga0070749_1063141113300006802AqueousDFPIRMAGQRLNLDAVRLAGITPSEITRRLRYQEAFPKS*
Ga0070749_1071439013300006802AqueousVMADNDFPVRMAGQRLGLFAPHLAGLTPQEVTRRLRYQETFPQT*
Ga0070754_1000608253300006810AqueousMSDNDFPIRLAGQRFGLDAAKMARITPSEVTSRLRYQQTFPRS*
Ga0070750_1044750633300006916AqueousVTDNDFPIRLAGQRFGLDAARMSAITPSEVTSRLRYQQTFPRT*
Ga0075472_1071068813300006917AqueousTDFPIRMAGQRLGLEAYKLTGITPSEITRRLRYQEAFPRT*
Ga0103274_122054423300007202Freshwater LakeMMSDNAFPIRMAGQRLNLEPMRLRGTTPSEITSRLRYQETFPAT*
Ga0070752_102934023300007345AqueousMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRN*
Ga0075458_1008342613300007363AqueousQMRDTDFPIRMAGQRLGLEAYKLTGITPSEITRRLRYQEAFPRT*
Ga0075458_1015539913300007363AqueousLAGQRLGLEAVRLPGLTPSEVTARLRYQQTFPRT*
Ga0075458_1020289113300007363AqueousMGENDFPVRMAGTRFGIDAARMAGTTPSEVTRRLRYQEAFPRT*
Ga0099851_103448243300007538AqueousMTDNDFPIRLAGQRFGLDAARMAAITPSEVTSRLRYQQTFPRT*
Ga0099851_109419423300007538AqueousMMVDNDFPVRMAGQRFGLDAQRLARTTPSELTARLRYQQTFPRT*
Ga0099849_1001024113300007539AqueousVNDNDFPIRLAGQRFGLDAARMARITPSEVTSRLRYQQTFPRT*
Ga0099847_104387433300007540AqueousMMAENDFPIRLAGGALGLAPRELRGLTPQEVTRRLRYQETFPQT*
Ga0099847_116130723300007540AqueousMMVDNDFPIRLAGQRFGLSARDLRGVTPMEVTSRLRYQQ
Ga0099848_1000148333300007541AqueousMYHSNDFPIRMAGQRLNLDAVRLAGTTPSEITRRLRYQEAFPKS*
Ga0099848_100558793300007541AqueousVTDNDFPIRLAGQRFGLDAVRMVGIKPSEVTARLRYQQTFPRT*
Ga0099848_103339013300007541AqueousMMVDNDFPIRLAGQRFGLSARDLQGVTPMEVTSRLRYQQT
Ga0099848_107974733300007541AqueousMRDSDFPIRLAGQRFGLDAYKMTGITPSEVTRRLRYQ
Ga0102914_102036523300007561EstuarineMYHTNDFPIRMAGQRLNLDAVRLAGITPSEITRRLRYQEAFPKS*
Ga0070751_1000442373300007640AqueousVTDNDFPIRLAGQRFGLDAARMARITPSEVTSRLRYQQTFPRT*
Ga0104986_1936263300007734FreshwaterMGENDFPVRMAGARLGIDAARMASTTPSEVTRRLRYQEAFPRT*
Ga0104988_11010173300007735FreshwaterMGENDFPVRMAGARLGIDAARMANTTPSEVTRRLRYQEAFPRT*
Ga0099850_100675883300007960AqueousMMADNDFPIRIAGGALGLAPRELRGLTPQEVTRRLRYQETFPQT*
Ga0114350_111214623300008116Freshwater, PlanktonMMVDNDFPIRMAGQRFGLTARDIQGLTPTEVTSRLRYQQTFPKT*
Ga0114364_109585613300008267Freshwater, PlanktonMMTDNDFPIRLAGQRFGLDSQRLARITPSEVTARLRYQQTFPRT*
Ga0114364_109589513300008267Freshwater, PlanktonMTDNDFPIRLAGQRLGLSSQRLASITPSEVTARLRYQQTFPRT*
Ga0105105_1000212873300009009Freshwater SedimentMVTDNDFPIRLAGQRLGLDSQRLARITPSEVTARLRYQQTFPRS*
Ga0105105_1074350413300009009Freshwater SedimentMMSDNGFPIRMAGQRLNLDPMRMRGITPSELTRRLRYQET
Ga0114918_1016105323300009149Deep SubsurfaceMMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRS*
Ga0114980_10002445113300009152Freshwater LakeMDNDFPVRMAGAGLGIDSSRLAGITPSEVTRRLRYQEAFPRS*
Ga0114968_1020641823300009155Freshwater LakeMGENDFPVRMAGARLGIDAARMAGTTPSEVTRRLRYQEAFPRA*
Ga0105102_1003478133300009165Freshwater SedimentMQGNDFPIRLAGQRLNLEATRLTGLTPSDITRRLRYQEAFPST*
Ga0114958_1010209623300009684Freshwater LakeMRDSDFPIRMAGQRLGLDAYRMTGITPAEVTRRLRYQETFPRT*
Ga0129333_1000081753300010354Freshwater To Marine Saline GradientMRDSDFPIRLAGQRLGLEAYKLSGITPSEITRRLRYQETFPRT*
Ga0129333_1000083373300010354Freshwater To Marine Saline GradientMRDSDFPVRLAGQRLGLEAYKLTGITPTEITRRLRYQETFPRT*
Ga0129333_10000914143300010354Freshwater To Marine Saline GradientMRDTNFPIRMAGQRLGLDAPRLAGLTPSDVTARLRYQQTFPRT*
Ga0129333_10001262253300010354Freshwater To Marine Saline GradientMRDTDFPIRMAGQRLGLEPYKLTGITPTELTRRLRYQETFPRT*
Ga0129333_10003844113300010354Freshwater To Marine Saline GradientMRDSDFPIRMAGQRLNLDSTRLAGITPSEVTRRLRYQAANPST*
Ga0129333_1002325723300010354Freshwater To Marine Saline GradientMRDTDFPIRMAGQRLGLEAYKLTGITPSEITRRLRYQEAFPRT*
Ga0129324_1001389723300010368Freshwater To Marine Saline GradientMVDNDFPVRLAGQRFGLSARDLRGVTPMEVTSRLRYQQTFPRT*
Ga0129336_10003516113300010370Freshwater To Marine Saline GradientMMSDNGFPIRMAGQRLNLDPMRMRGITPSELTRRLRYQETFPST*
Ga0129336_10004633143300010370Freshwater To Marine Saline GradientMRDSDFPVRMAGQRLGLQAYKLTGITPTEITRRLRYQEANPST*
Ga0129336_1005777023300010370Freshwater To Marine Saline GradientMTDRDFPVRMAGQRFGLDAVRMAGITPGEVTERLRYQQTFPRT*
Ga0129336_1069620613300010370Freshwater To Marine Saline GradientQMTDNDFPIRMAGQRLGLDVVRLRGLTPSEVTARLRYQETFPRT*
Ga0129336_1075252513300010370Freshwater To Marine Saline GradientKERWLIVRDSDFPIRLAGQRLGLDAYKMTGITPSEVTRRLRYQAANPST*
Ga0136549_1003740533300010389Marine Methane Seep SedimentMRDSDFPIRMAGQRLGLEPYKLVGITPTELTRRLRYQETFPRT*
Ga0151620_100684153300011268FreshwaterMENDFPIRMAGGALGLRKEQLLGLTPSEVTRRLRYQEAFPQT*
Ga0119951_104781523300012000FreshwaterMGENDFPVRMAGARLGIDAARMAGTTPSEVTRRLRYQEGFPRT*
Ga0153801_1000460153300012017FreshwaterMRDTDFPIRLAGQRLGLEALRLPGLTPSEVTARLRYQQTFPRT*
Ga0164294_10003809133300013006FreshwaterMRDSDFPIRMAGQRLGLDAYKMTGITPTEVTRRLRYQEAFPRT*
(restricted) Ga0172367_10011097103300013126FreshwaterMRDTDFPIRLAGQRLGLEATRLPSLTPSEVTARLRYQQTFPRT*
Ga0177922_1081967523300013372FreshwaterVSPGQDEKGGSQVRDNDFPLRLAGQRFGLDAVRMSSITPSEVTARLRYQQTFPRT*
Ga0119954_1000202173300014819FreshwaterMDNDFPVRMAGSRLGLDPLRVASITPSELTKRLRYQEAFPRT*
Ga0119954_100199593300014819FreshwaterMGENDFPVRMAGARLGIDAARMAHATPSEVTRRLRYQEAFPRT*
Ga0181338_100033643300015050Freshwater LakeMSDNNFPIRLAGQRLGLEATKLSGITPSEVTRRLRYQEAFPRT*
Ga0181364_104170313300017701Freshwater LakeNNFPIRLAGQRLGLEATKLSGITPSEVTRRLRYQEAFPRT
Ga0181362_106372333300017723Freshwater LakeFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY
Ga0181365_101097023300017736Freshwater LakeMMDNDFPVRIAGARLGLDPTKMAGITPTELTKRLRYQEAFPRT
Ga0181358_113352333300017774Freshwater LakeEFGSRKEGSKMIDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY
Ga0181357_122735313300017777Freshwater LakeEGSKMTDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY
Ga0181349_114320513300017778Freshwater LakeMQGNEFPIRLAGQRLNLEATRMTGLTPSDITRRLRYQEAFPSS
Ga0181348_1006494133300017784Freshwater LakeMRDTDFPIRLAGQRLGLEAVRLPGLTPSEVTARLRYQQTF
Ga0181348_120856723300017784Freshwater LakeMDNDFPVRMAGSRLGLDPMRVAGITPSELTKRLRYQEAFPR
Ga0181348_126625933300017784Freshwater LakeHEFGSRKEGSKMIDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY
Ga0181355_100799013300017785Freshwater LakeMRDTDFPIRLAGQRLGLEAVRLPGLTPSEVTARLRY
Ga0169931_10013827163300017788FreshwaterMRDTDFPIRLAGQRLGLEATRLPSLTPSEVTARLRYQQTFPRT
Ga0181583_1064877633300017952Salt MarshDNDFPVRMAGQRLGLFAPHLAGLTPQEVTRRLRYQETFPQT
Ga0194023_111732013300019756FreshwaterMMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRT
Ga0181360_10084243300019781Freshwater LakeMMDNDFPVRMAGARLGLDPTKMAGITPTELTKRLRYQEAFPRT
Ga0181360_10315513300019781Freshwater LakeMIDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY
Ga0181359_108347823300019784Freshwater LakeMDNDFPVRMAGARLGLDPTKMAGITPTELTKRLRYQEAFPRT
Ga0181575_1013895043300020055Salt MarshMADNDFPVRMAGQRLGLFAPHLAGLTPQEVTRRLRYQETFPQT
Ga0194113_1010768453300020074Freshwater LakeMRDTDFPIRMAGQRLGLEPYKLAGITPSEVTRRLRYQEAFPRT
Ga0194112_10042702113300020109Freshwater LakeVRDTNFPIRLAGQRLGLEPFKLMGITPSEITRRLRYQEAFPQT
Ga0194134_1018199923300020179Freshwater LakeMKDNDFPVRMAGQRLGLEAYKLSGITPSELTRRLRYQETFPRT
Ga0194115_1007148563300020183Freshwater LakeMTENDFPIRMAGGAMGLHKEQLRGITPSEITRLLRYQAAFPSY
Ga0194127_1019976613300020221Freshwater LakeFCFKQKVRDTNFPIRLAGQRLGLEPFKLMGITPSEITRRLRYQEAFPQT
Ga0208326_10002263300020494FreshwaterMYHTNDFPIRMAGQRLNLDAVRLAGTTPSEITRRLRYQEAFPKS
Ga0210295_114303823300021323EstuarineMKDNDFPIRMAGQRFGLDAARMSAVTPSEVTSRLRYQQTFPKT
Ga0213860_1020543223300021368SeawaterMMVDNDFPIRLAGQRFGLSARDLRGVTPMEVTSRLRYQQTFPRT
Ga0194130_1004762943300021376Freshwater LakeMRDNDFPIRMAGQRLGLEPYKLTGITPTEVTRRLRYQEAFPRT
Ga0222714_1000807363300021961Estuarine WaterMDNDFPVRMAGSRLGLAPMRVADITPSELTKRLRYQEAFPRT
Ga0222712_10001171503300021963Estuarine WaterMRDTDFPIRMAGQRMGLEPYKLTGITPTEITRRLRYQEAFPRT
Ga0222712_10002401163300021963Estuarine WaterMRDTDFPIRMAGQRLGLEAYKLTGITPSEITRRLRYQEAFPRT
Ga0222719_1013946443300021964Estuarine WaterMMVDNDFPIRLAGQRFGLTARDIQGVTPMEVTSRLRYQQTFPKT
Ga0212029_102577323300022063AqueousMMADNDFPIRLAGGALGLAPRELRGLTPQEVTRRLRYQETFPQT
Ga0196891_101442323300022183AqueousMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRT
Ga0196899_100512653300022187AqueousMMVDNDFPVRMAGQRFGLDAQRLARTTPSEVTARLRYQQTFPRT
Ga0196905_101407553300022198AqueousMMVDNDFPVRMAGQRFGLDAQRLARTTPSELTARLRYQQTFPRT
Ga0196905_101424043300022198AqueousMVDNDFPVRLAGQRFGLSARDLRGVTPMEVTSRLRYQQTFPRT
Ga0196905_103525433300022198AqueousMMVDNDFPIRLAGQRFGLSARDLQGVTPMEVTSRLRYQQTFPKT
Ga0196905_104818033300022198AqueousMTDNDFPIRLAGQRFGLDAARMAAITPSEVTSRLRYQQTFPRT
Ga0181351_100183163300022407Freshwater LakeMQGNDFPIRLAGQRLNLEATRLTGLTPSDITRRLRYQEAFPSS
Ga0181351_106453723300022407Freshwater LakeMRDTDFPIRMAGQRFGLDAARMSAVTPSEVTSRLRYQQTFPRT
Ga0228702_101005843300022748FreshwaterMRDTDFPIRLAGQRLGLDAVRLPGLTPSEVTARLRYQQTFPRT
Ga0214917_10000401533300022752FreshwaterMTDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY
Ga0214917_10004840123300022752FreshwaterMDNDFPVRMAGSRLGLDPLRVASITPSELTKRLRYQEAFPRT
Ga0214917_10008028133300022752FreshwaterMENDFPVRMAGGILGLHKEQLRGLTPSEVTRRLRYQEAFPQT
Ga0210003_106631933300024262Deep SubsurfaceMMTDNDFPIRLAGQRFGLDSQRLARITPSEVTSRLRYQQTFPRS
Ga0244777_1002533943300024343EstuarineMYHTNDFPIRMAGQRLNLDAVRLAGITPSEITRRLRYQEAFPKS
Ga0208018_12539323300025057MarineMSDNDFPIRMAGQRFGLDAARMSRLTPSEVTSRLRYQQTFPRS
Ga0208018_13105823300025057MarineMTDNDFPIRLAGQRFGLDAAKMAAIKPSEVTARLRYQQTFPRS
Ga0208004_103724833300025630AqueousMMRDSDFPIRMAGARLNLDSTRLAGITPSEVTRRLRYQAANPAT
Ga0208161_102918863300025646AqueousMYHSNDFPIRMAGQRLNLDAVRLAGTTPSEITRRLRYQEAFPKS
Ga0208161_107088823300025646AqueousMRDSDFPIRMAGARLNLDSTRLAGITPSEVTRRLRYQAANPAT
Ga0208898_1000681403300025671AqueousVTDNDFPIRLAGQRFGLDAARMARITPSEVTSRLRYQQTFPRT
Ga0208162_1000274103300025674AqueousVNDNDFPIRLAGQRFGLDAARMARITPSEVTSRLRYQQTFPRT
Ga0208542_104357823300025818AqueousMRDSDFPIRMAGQRLSLDSTRLAGITPSEVTRRLRYQAANPST
Ga0208645_101647673300025853AqueousMSDNDFPIRLAGQRFGLDAAKMARITPSEVTSRLRYQQTFPRS
Ga0208644_102764073300025889AqueousMMADNDFPVRMAGQALGLLPPHLRGLTPQEVTRRLRYQEAFPQT
Ga0208169_106016423300027223EstuarineDFPIRMAGQRLNLDAVRLAGITPSEITRRLRYQEAFPKS
Ga0208974_101723733300027608Freshwater LenticMRDTDFSIRLAGQRLGLEPFKLMGITPSEITRRLRYQEAFPRT
Ga0209499_123263713300027712Freshwater LakeMRDSDFPIRMAGQRLGLDAYRMTGITPAEVTRRLRYQETF
(restricted) Ga0247833_1004689193300027730FreshwaterMDNDFPVRMAGSRLGLDPMRVAGITPSELTKRLRYQEAFPRT
Ga0209297_1001183103300027733Freshwater LakeMDNDFPVRMAGAGLGIDSSRLAGITPSEVTRRLRYQEAFPRS
Ga0209085_101517473300027741Freshwater LakeMGENDFPVRMAGARLGIDAARMAGTTPSEVTRRLRYQEAFPRA
Ga0209288_1000980053300027762Freshwater SedimentMVVDNDFPVRMAGQRFGLDAQRLARTTPSEVTARLRYQQTFPRT
Ga0209288_1023767733300027762Freshwater SedimentMVTDNDFPIRLAGQRLGLDSQRLARITPSEVTARLRYQQTFPRS
(restricted) Ga0247843_100365293300028569FreshwaterMTDNDFPIRLAGQRLGLEATKLAGITPSEVTRRLRYQEAFPRT
(restricted) Ga0247843_1005270113300028569FreshwaterMDNDFPVRMAGARLGLDPTKVGGITPTELTKRLRYQEAFPST
Ga0315291_1000343593300031707SedimentMRDSDFPIRMAGQRLGLDAYKMTGITPTEVTRRLRYQEAFPRT
Ga0315907_10004717123300031758FreshwaterMMVDNDFPIRMAGQRFGLTARDIQGLTPTEVTSRLRYQQTFPKT
Ga0315288_1073943313300031772SedimentMSDNNFPIRLAGQRLGLEATKLSGITPSEVTRRLRYQEAF
Ga0315899_1000021653300031784FreshwaterMKDNDFPIRMAGQRFGLDATRMSAVTPSEVTSRLRYQQTFPKT
Ga0315909_1005355553300031857FreshwaterMVDNDFPVRMAGQRLNLNSQRLSAVTPSEVTARLRYQQTFPRT
Ga0315909_1075667113300031857FreshwaterMMTDNDFPIRLAGQRFGLDSQRLARITPSEVTARLRYQQTFPRT
Ga0315297_1009934853300031873SedimentMDNDFPVRMAGARLGLDPTKMAGVTPTELTKRLRYQEAFPRT
Ga0315285_1018487033300031885SedimentMSDNNFPIRLAGQRLGLEATKLSGITPSEVTRRLRYQEAFPRT
Ga0315294_1007847353300031952SedimentSRKEGSKMTDNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY
Ga0315294_1011038823300031952SedimentMDNDFPVRMAGARLGLDPTKMAGLTPTELTKRLRYQEAFPRT
Ga0315901_1045104323300031963FreshwaterMMTDNDFPIRLAGQRLGLSSQRLASITPSEVTARLRYQQTFPRT
Ga0315278_1016058713300031997SedimentMMDNDFPVRMAGARLGLDPTKMAGITPTELTKRLRYQEAFPR
Ga0315274_1006615433300031999SedimentMIGNDFPVRMAGQRLSLQPYKLAGLTPSDVTKRLRYQAANPSY
Ga0315902_1058988033300032093FreshwaterMTDNDFPIRLAGQRLGLSSQRLASITPSEVTARLRYQQTFPRT
Ga0334980_0065083_23_1573300033816FreshwaterMYHTNDFPIRMAGQRLNLDAVRLAGTTPSEITRRLKYQQAFPKS
Ga0334994_0032737_2513_26443300033993FreshwaterMQGNDFPIRLAGQRLNLEATRLTGLTPSDITRRLRYQEAFPST
Ga0334996_0457448_143_2743300033994FreshwaterMTDNDFPIRMAGQRLGLDVVRLRGLTPSEVTARLRYQETFPRT
Ga0334987_0080785_1877_20113300034061FreshwaterMMVDNDFPVRMAGQRLNLNSQRLSAVTPSEVTARLRYQQAFPRT
Ga0310130_0007614_463_5943300034073Fracking WaterMRDTDFPIRLAGQRLGLEASRLPSLTPSEVTARLRYQQTFPRT
Ga0335036_0005545_3454_35883300034106FreshwaterMMSDNGFPIRMAGQRLNLDPMRMRGITPSELTRRLRYQETFPST


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.