| Basic Information | |
|---|---|
| Family ID | F033723 |
| Family Type | Metagenome |
| Number of Sequences | 176 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MTNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDTSMADL |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.75 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (80.682 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (17.614 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.841 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.682 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF04586 | Peptidase_S78 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 80.68 % |
| All Organisms | root | All Organisms | 19.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 15.34% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.07% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.50% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 5.11% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.41% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.27% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.70% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.70% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.14% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.14% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.14% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.57% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.57% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.57% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.57% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.57% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake | 0.57% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.57% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.57% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.57% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.57% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001523 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002465 | Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007522 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020517 | Freshwater microbial communities from Lake Mendota, WI - 30NOV2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027487 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_101239802 | 3300001282 | Freshwater | LTNPTSNYGFVLPTSTDLVTDLPADFEVALQGVDTRLKA |
| JGI1221J15618_11373182 | 3300001523 | Hypersaline | MANPTTNYGFVLPTPTDLVTDLPADFDVALQGVDTQMLT |
| B570J29032_1096014061 | 3300002408 | Freshwater | MSNPTTPFGWQMPTATDLVTDLPADFEVFGQAVATSMGDLLGGTS |
| LO132_101050921 | 3300002465 | Freshwater Lake | MANPTTNYGWVMPTSTDLVTDLPADFAVFGQGVDTTMAELK |
| JGI25923J51411_10656451 | 3300003493 | Freshwater Lake | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATDLADLLGGPSGYI |
| Ga0031658_10590862 | 3300003860 | Freshwater Lake Sediment | MANPTTNFGWVMPTSTDLVTDLPADFNTFGQGVDTTLAELKG |
| Ga0063232_102590092 | 3300004054 | Freshwater Lake | MTNPTTYFGWQMPTSTDLVTDLPADFEVFGQAVDTDFQGL |
| Ga0049081_102681572 | 3300005581 | Freshwater Lentic | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATSMADLLGGTSGQ |
| Ga0049085_102496522 | 3300005583 | Freshwater Lentic | MANPTTYFGWVMPNSADLVTDLPADFAVFGQGVDTSMQSLLGGT |
| Ga0079957_13682361 | 3300005805 | Lake | MANPTSNFNWQMPTNTDLVKDLPADFEVFGQAVDTSLADLKGG |
| Ga0070749_103924201 | 3300006802 | Aqueous | MANPTTNFGWQMPQNTDLVKDLPADFEVFGQAVDTDLADLKG |
| Ga0075467_102392991 | 3300006803 | Aqueous | MANPTTNFGWVMPTSTSLVTNLPADFNTFGQAVDTSMQYLLGGTTG |
| Ga0075464_104034822 | 3300006805 | Aqueous | MANPTTNFGWVMPTSTSLVTNLPADLNTFGQAVDTSMAQL |
| Ga0075464_109406152 | 3300006805 | Aqueous | MTNPTSNFGWQMPTSTDLVTDLPADFAVFGQAVDTTFAELKGGTTGQV |
| Ga0075459_10014505 | 3300006863 | Aqueous | MSNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDTSLADLK |
| Ga0075472_101050862 | 3300006917 | Aqueous | MANPTTNFGWVMPNSADLVTDLPADFNVFGQGVDTSMQ |
| Ga0102976_10767032 | 3300007169 | Freshwater Lake | MANPTTNFGWQMPTSTDLVTDLPADFEVFGQAVDTTLVDLKGGTTGQ |
| Ga0075458_101896391 | 3300007363 | Aqueous | MANPTTNFGWVMPTSTSLVTNLPADFNTFGQGVDTSMAQ |
| Ga0105050_104505172 | 3300007516 | Freshwater | MANPTTNYGWQMPTPTDLVTDLPADFDVFGQAVDN |
| Ga0105053_108156591 | 3300007522 | Freshwater | MANPTTNYGWQMPTPTDLVTDLPADFEVFGQAVDT |
| Ga0102859_10359972 | 3300007708 | Estuarine | MANPTTNFGWVMPTSTSLVTNLPADFNTFGQAVDTSMA |
| Ga0102859_11118711 | 3300007708 | Estuarine | MSNPTSNFGWQMPTPTDLVTSLPADFEVFGQAVDSSMADLKGGTSGQI |
| Ga0102859_11416942 | 3300007708 | Estuarine | MANPTTYFGWVMPTATDLVTDLPADFNTFGQGVDTSMQ |
| Ga0105746_13529852 | 3300007973 | Estuary Water | MANPTTYFGWVMPTSTDLVTDLPADFNVFGQGVDTSMQDLLGGTTGQ |
| Ga0114351_11894442 | 3300008117 | Freshwater, Plankton | MTNPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDTSM |
| Ga0114363_101641211 | 3300008266 | Freshwater, Plankton | MANPTTNFNWQMPTSTDLVTDLPADFETFGQAVDTS |
| Ga0105152_102144961 | 3300009039 | Lake Sediment | MANPTTNYSWPMPTSADLVTDLPADFALFGQPVDT |
| Ga0105152_104115861 | 3300009039 | Lake Sediment | MANPTTYFAWVMPNSADLVTDLPADFAVFGQGVDTSMSQLLGGTTGQVL |
| Ga0105152_104338381 | 3300009039 | Lake Sediment | MANPTTNFSWVMPTSADLVTDLPADFAVFGQGVDTSMQYLLGG |
| Ga0114968_101748911 | 3300009155 | Freshwater Lake | MSNPTTPFSWQMPTNTDLVTDLPADFEVFGQAVATSMADLLGGTSGQI |
| Ga0114978_102147912 | 3300009159 | Freshwater Lake | MSNPTTPFSWQMPTATDLVTDLPADFAVFGQAVATSMADLLG |
| Ga0114978_102413462 | 3300009159 | Freshwater Lake | MSNPTSNFGWQMPTATDLVTDLPADFEVFGQAVDTDFADLLGG |
| Ga0114981_103705761 | 3300009160 | Freshwater Lake | MSNPTANFGWVMPTATDLVTDLPADFAVFGQAVDTSMAGLKGGTTG |
| Ga0114975_101314921 | 3300009164 | Freshwater Lake | MANPTTNYGFVMPTSTDLVTDLPADFAVFGQPVDTQIFANAIM |
| Ga0114975_104980931 | 3300009164 | Freshwater Lake | MTNPTTNYGWVMPTSASLVTNLPADFNTFGQAVDTSLAQLKGG |
| Ga0114974_100323721 | 3300009183 | Freshwater Lake | MANPTTNYGWPMPTSTDLVTDLPADFAAFGQPVDTTLK |
| Ga0114974_107841802 | 3300009183 | Freshwater Lake | MTNPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDTSMADLKGG |
| Ga0114976_103005971 | 3300009184 | Freshwater Lake | MANPTTYFGWVMPTSTDLVTDLPADFNIFGQGVDTSLQG |
| Ga0114976_104442822 | 3300009184 | Freshwater Lake | MANPTTNFGWVMPTSVSLVTNLPADFNTFGQAVDTSMAQLKG |
| Ga0114967_102273581 | 3300010160 | Freshwater Lake | MTNPTSNFGWQMPTNTDLVTDLPADFAVFGQAVDTSM |
| Ga0136655_12448891 | 3300010316 | Freshwater To Marine Saline Gradient | MTNPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDTDLVGLLGGANGYIL |
| Ga0129324_104060871 | 3300010368 | Freshwater To Marine Saline Gradient | MTNPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDT |
| Ga0133913_109705571 | 3300010885 | Freshwater Lake | MSNPTSNFGWVMPTNTDLVTDLPADFAVFGQAVDTSMADLL |
| Ga0133913_118983731 | 3300010885 | Freshwater Lake | MSNPTSNFGWQMPTATDLVTDLPADFEVFGQAVDTDLADLKG |
| Ga0139557_10025091 | 3300011010 | Freshwater | MSNPTTPFGWQMPTATDLVTDLPADFEVFGQAVAT |
| Ga0153805_10237922 | 3300012013 | Surface Ice | VSNPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDT |
| Ga0164293_107484692 | 3300013004 | Freshwater | MTNPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDTDFVDLL |
| Ga0164293_110426171 | 3300013004 | Freshwater | MANPTTNFGWQMPTSTDLVTDLPADFEVFGQAVDT |
| Ga0164292_106205602 | 3300013005 | Freshwater | MANPTTNFGWVMPTATDLVTDLPADFAVFGQAVDTSMADLKGGTT |
| Ga0119960_10716851 | 3300014811 | Aquatic | MSNPTTPFNWQMPTNTDLVTDLPADFEVFGQAVAT |
| Ga0181364_10323421 | 3300017701 | Freshwater Lake | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATSMADLF |
| Ga0181347_11435262 | 3300017722 | Freshwater Lake | MSNPTTPFLWQMPTSTDLVTDLPADFEVFGQAVATSMADLLG |
| Ga0181347_11816511 | 3300017722 | Freshwater Lake | VANPTTNYGFVLPTPTDLVTDLPADFDVALQGVDTR |
| Ga0181365_11012122 | 3300017736 | Freshwater Lake | MANPTTYFGWVMPNSADLVTDLPADFNVFGQGVDTSMQYLLGG |
| Ga0181365_11340432 | 3300017736 | Freshwater Lake | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVDTS |
| Ga0181356_10224383 | 3300017761 | Freshwater Lake | MANPTTNFGWQMPTSSDLVTDLPADFEVFGQAVDTALVDL |
| Ga0181358_10714122 | 3300017774 | Freshwater Lake | MSNPTTPFSWQMPTSTDLVTDLPADFEVFGQAVATSMADLLGG |
| Ga0181358_11304001 | 3300017774 | Freshwater Lake | MANPTTYFGWVMPNSADLVTDLPADFNVFGQGVDTSMQYLLGGTTGQVL |
| Ga0181357_11354521 | 3300017777 | Freshwater Lake | MTNPTTPFGWQMPTSTDLVTDLPADFEVFGQAVATSMADLLGGASGYIL |
| Ga0181357_11735592 | 3300017777 | Freshwater Lake | MANPTTNFGWVMPTATDLVTDLPADFAVFGQGVDTSMQYL |
| Ga0181348_11113522 | 3300017784 | Freshwater Lake | MANPTTYFGWVMPTATDLVTDLPADFNVFGQGVDTSMQKLLGGTTGQVL |
| Ga0181348_11887591 | 3300017784 | Freshwater Lake | MTNPTSNFGWQMPTSADLVTDLPADFEVFGQAVDTDFVDLL |
| Ga0181355_12442781 | 3300017785 | Freshwater Lake | MANPTSNFGWQMPTNTDLVKDLPADFEVFGQAVDTSLM |
| Ga0181359_11348202 | 3300019784 | Freshwater Lake | MSNPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDTAMADLLGGTSGQ |
| Ga0181359_11466261 | 3300019784 | Freshwater Lake | MSNPTSNFGWQMPTATDLVTDLPADFEVFGQAVDTDFV |
| Ga0181359_11804582 | 3300019784 | Freshwater Lake | MANPTTYFGWVMPTTTDLVTDLPADFNVFGQGVDTSMQDL |
| Ga0211732_15070121 | 3300020141 | Freshwater | MTNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDT |
| Ga0211736_102261352 | 3300020151 | Freshwater | MSNPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDT |
| Ga0211729_112722661 | 3300020172 | Freshwater | MSNPTTPFGWQMPTNTDLVTDLPADFEVFGQAVATSMQDLL |
| Ga0163150_104145572 | 3300020195 | Freshwater Microbial Mat | MANPTTNYGWQMPTPTDLVTDLPADFEVFGQAVDTALIDLKGGTT |
| Ga0211731_100304662 | 3300020205 | Freshwater | VSNPTSSFGWQMPTATDLVTDLPADFEVFGQAVDSSMADLLGG |
| Ga0208854_10474572 | 3300020517 | Freshwater | MTNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDTDFV |
| Ga0208601_10426472 | 3300020532 | Freshwater | VSNPTSSFGWQMPTATDLVTDLPADFEVFGQAVDTAMA |
| Ga0208364_10566662 | 3300020533 | Freshwater | MSNPTSNFNWQMPTATDLVTDLPADFEVFGQAVDTSLADLKGGTTGQ |
| Ga0208486_10583081 | 3300020556 | Freshwater | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATSMADLLGGTSGQI |
| Ga0194048_101488691 | 3300021519 | Anoxic Zone Freshwater | MANPTTNFGWVMPTSTSLVTNLPADFNTFGQGVDTSMAQLK |
| Ga0222713_104392112 | 3300021962 | Estuarine Water | MANPTTAFGWVMPTTTDLVTDLPADFAVFGQGVDTSMQYLLGGTRG |
| Ga0181354_12347901 | 3300022190 | Freshwater Lake | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATSMADLLGGT |
| Ga0196905_10462581 | 3300022198 | Aqueous | MANPTTNFGWQMPTNTDLVKDLPADFEVFGQAVDT |
| Ga0181351_11593472 | 3300022407 | Freshwater Lake | MSNPTTPFSWQMPENTDLVTDLPADFEVFGQAVATSMQDL |
| Ga0255752_103724651 | 3300022929 | Salt Marsh | MANPTTNFGWVMPTSTSLVTNLPADFNTFGQGVDTSM |
| Ga0210003_13537381 | 3300024262 | Deep Subsurface | MANPTTNFGWQMPTATDLVTDLPADFEVFGQAVDTAFVDLLGGTT |
| Ga0255144_10228312 | 3300024513 | Freshwater | MANPTTNFGWQMPTSTDLVTDLPADFEVFGQAVDTTLVDLKGGTT |
| Ga0208147_11342551 | 3300025635 | Aqueous | MANPTSAFGWQMPTNTDLVKDLPSDFEVFGQAVDTDL |
| Ga0208147_11640312 | 3300025635 | Aqueous | MANPTTNFGWVMPTSSDLVTDLPADFAVFGQGVDTTLADLKGGTTGQ |
| Ga0208161_10753151 | 3300025646 | Aqueous | MANPTSAFGWQMPTNTDLVKDLPSDFEIFGQAVDDSLADLK |
| Ga0208916_105073782 | 3300025896 | Aqueous | MSNPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDSTMA |
| Ga0255070_10727202 | 3300027133 | Freshwater | MANPTTNYGWVMPTSTDLVTDLPADFAVFGQAVDTSLADLKGGT |
| Ga0255073_10202442 | 3300027135 | Freshwater | MANPTTNFGWVMPTSTSLVTNLPADFNTFGQGVDT |
| Ga0255091_10434112 | 3300027487 | Freshwater | MANPTTNFGWVMPTSTSLVTNLPADFNTFGQGVDTSMAQLKGGSTGQV |
| Ga0255072_10099243 | 3300027508 | Freshwater | MTNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDTDFVDLLGGASGYI |
| Ga0255077_11183971 | 3300027529 | Freshwater | MTNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDTDFVDLLGGASGYILS |
| Ga0209552_10828642 | 3300027563 | Freshwater Lake | MSNPTSNFGWQMPEPTDLVTNLPADFEVFGQAVDT |
| Ga0208966_12002761 | 3300027586 | Freshwater Lentic | MANPTTNFGWVMPTATDLVTDLPADFAVFGQGVDTSMAYLLGGTT |
| Ga0208974_11460441 | 3300027608 | Freshwater Lentic | MSNPTSNFGWQMPTATDLVTDLPADFEVFGQAVDT |
| Ga0209357_11089422 | 3300027656 | Freshwater Lake | MTNPTTPFSWQMPTSTDLVTDLPADFETFGQAVATSM |
| Ga0208975_10944082 | 3300027659 | Freshwater Lentic | MANPTTNYGFVLPTSTDLVTDLPADFDVALQGVDTRL |
| Ga0209297_13694902 | 3300027733 | Freshwater Lake | MTNPTSNFGWQMPTNTDLVTDLPADFAVFGQAVDTS |
| Ga0209087_13421631 | 3300027734 | Freshwater Lake | MSNPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDSD |
| Ga0209190_12865461 | 3300027736 | Freshwater Lake | MTNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDTDFVDLLG |
| Ga0209296_11416981 | 3300027759 | Freshwater Lake | MANPTTNYGWPMPTSTDLVTDLPADFAAFGQPVDTTLKAL |
| Ga0209134_102873981 | 3300027764 | Freshwater Lake | MTNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDTDFVDL |
| Ga0209086_102333162 | 3300027770 | Freshwater Lake | MSNPTTPFSWQMPTSTDLVTDLPADFEVFGQAVATSMADLLG |
| Ga0209086_103337502 | 3300027770 | Freshwater Lake | MANPTTYFGWVMPNSADLVTDLPADFNVFGQGVDTSMQYLLGGTTGQI |
| Ga0209500_102221932 | 3300027782 | Freshwater Lake | MSNPTTPFSWQMPTATDLVTDLPADFAVFGQAVATSMADLLGG |
| Ga0209246_100629881 | 3300027785 | Freshwater Lake | MTNPTSNYGWQMPTATDLVTDLPADFEVFGQAVDTAM |
| Ga0209107_100407603 | 3300027797 | Freshwater And Sediment | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATS |
| Ga0209353_100856531 | 3300027798 | Freshwater Lake | MSNPTTPFSWQMPTSTDLVTDLPADFEVFGQAVATSMADLLGGTTGQ |
| Ga0209353_102262212 | 3300027798 | Freshwater Lake | MSNPTTPFSWQMPTSTDLVTDLPADFEVFGQAVAT |
| Ga0209353_103371841 | 3300027798 | Freshwater Lake | MSNPTSNYGWQMPTATDLVTDLPADFEVFGQAVDTALMDLKGG |
| Ga0209353_103994501 | 3300027798 | Freshwater Lake | MANPTTYFGWVMPTSTDLVTDLPADFNVFGQGVDTSMQYLLGG |
| Ga0209358_104711842 | 3300027804 | Freshwater Lake | MANPTSNFGWQMPTPTDLVTDLPADFEVFGQAVDSSMADLLGGTTG |
| Ga0209354_101047342 | 3300027808 | Freshwater Lake | MSNPTSNFGWQMPEPTDLVTDLPADFEVFGQAVDTDLADLNGGT |
| Ga0209990_102854401 | 3300027816 | Freshwater Lake | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATSMADLLGGTSG |
| Ga0209668_107331481 | 3300027899 | Freshwater Lake Sediment | MANPTTNFGWVMPTSTDLVTDLPADFNVFGQGVDTSMQY |
| Ga0209668_111810192 | 3300027899 | Freshwater Lake Sediment | MSNPTTPFGWQMPTATDLVTDLPADFEVFGQAVATSMAEPCGTAMPC |
| Ga0209191_11477892 | 3300027969 | Freshwater Lake | MANPTTNFGWVMPTATDLVTDLPADFDVFGQAVDTSLAQLKGGT |
| Ga0209299_12567342 | 3300027974 | Freshwater Lake | MSNPTTPFSWQMPTATDLVTDLPADFAVFGQAVATSMADLL |
| Ga0209702_100851783 | 3300027976 | Freshwater | MANPTTNYGWQMPTSTDLVTDLPADFEVFGQAVDTALIDLK |
| Ga0209702_101196202 | 3300027976 | Freshwater | MANPTTNYGWQMPTSTDLVTDLPADFEVFGQAVDTSLLGLK |
| Ga0209284_103566071 | 3300027983 | Freshwater | MANPTTNYGWQMPTSTDLVTDLPADFEVFGQAVDTALIDLKGGT |
| Ga0315291_110390882 | 3300031707 | Sediment | MSNPTTPFGWQMPTATDLVTDLPADFEVFGQAVATSMADLLG |
| Ga0315293_100788863 | 3300031746 | Sediment | MSNPTTPFSWQMPTATDLVTDLPADFAVFGQAVATSM |
| Ga0315293_105325242 | 3300031746 | Sediment | MTNPTSNFGWQMPESTDLVTNLPADFEVFGQAVDTDFVD |
| Ga0315293_106780081 | 3300031746 | Sediment | MSNPTTPFSWQMPQSTDLVTDLPADFEVFGQAVATSMADLL |
| Ga0315293_108420122 | 3300031746 | Sediment | MSNPTSNFGWQMPTATDLVTDLPADFEVFGQAVDTD |
| Ga0315293_109580951 | 3300031746 | Sediment | MANPTTYFGWVMPNSADLVTDLPADFNVFGQGVDT |
| Ga0315288_107990201 | 3300031772 | Sediment | MTNPTSNFGWQMPEPTDLVTNLPADFEVFGQAVDTDFVDLLG |
| Ga0315290_109087782 | 3300031834 | Sediment | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATSMAD |
| Ga0315909_107584741 | 3300031857 | Freshwater | MTNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDTSMADL |
| Ga0315294_111922191 | 3300031952 | Sediment | MSNPTTPFGWQMPTNTDLVTDLPADFEVFGQAVATSMQDLLGGTT |
| Ga0315294_115093332 | 3300031952 | Sediment | MANPTTYFGWVMPTATDLVTDLPADFNVFGQGVDTS |
| Ga0315901_101771501 | 3300031963 | Freshwater | MTNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDTSLADLK |
| Ga0315274_107930052 | 3300031999 | Sediment | MANPTTYFGWVMPNSADLVTDLPADFNVFGQGVDTSMQYLL |
| Ga0315274_111890711 | 3300031999 | Sediment | MANPTTYFGWVMPNSADLVTDLPADFNVFGQGVDTSMQYLLGGT |
| Ga0315274_112205282 | 3300031999 | Sediment | MSNPTTPFGWQMPTATDLVTDLPADFEVFGQAVATS |
| Ga0315289_105398972 | 3300032046 | Sediment | MSNPTTPFGWQMPTATDLVTDLPADFEVFGQAVATSMADLL |
| Ga0315289_112225762 | 3300032046 | Sediment | MSNPTSNYGWQMPTATDLVTDLPADFEVFGQAVDTALMDLKG |
| Ga0315289_114784012 | 3300032046 | Sediment | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATSMADLLGGASG |
| Ga0315284_108765611 | 3300032053 | Sediment | MSNPTTPFSWQMPTAVDLVTDLPADFEVFGQAVATSMADL |
| Ga0315284_110863001 | 3300032053 | Sediment | MTNPTSNFGWQMPTNTDLVTDLPADFAVFGQAVDTSMADLLGG |
| Ga0315903_109984061 | 3300032116 | Freshwater | MANPTSNFGWQMPTNTDLVKDLPADFEVFGQAVDTSLMD |
| Ga0315295_106739061 | 3300032156 | Sediment | MSNPTTPFSWQMPTATDLVTDLPADFAVFGQAVATS |
| Ga0315295_120700772 | 3300032156 | Sediment | MANPTTYFGWVMPNSADLVTDLPADFNVFGQGVDTSMQDLLGG |
| Ga0315268_117501921 | 3300032173 | Sediment | MSNPTSNFGWQMPTATDLVTDLPADFEVFGQAVDTAM |
| Ga0315276_119722352 | 3300032177 | Sediment | MTNPTSNFGWQMPTNTDLVTDLPADFAVFGQAVDTSMA |
| Ga0315287_108441451 | 3300032397 | Sediment | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVAT |
| Ga0335396_104412182 | 3300032462 | Freshwater | MANPTTNYGWQMPTPTDLVTDLPADFEVFGQAVDTALIDLK |
| Ga0335396_107958152 | 3300032462 | Freshwater | MANPTSNYGWQMPTSTDLVTDLPADFEVFGQAVDTALIDLK |
| Ga0335396_108253082 | 3300032462 | Freshwater | MANPTTNYGWQMPTPTDLVTDLPADFEVFGQAVDNSL |
| Ga0335396_109395672 | 3300032462 | Freshwater | MANPTTNYGWQMPTSTDLVTDLPADFEVFGQAVDTSLLGLKGGTTGQ |
| Ga0315273_118643322 | 3300032516 | Sediment | MANPTTNYGWVMPTSTSLVTNLPADFNVFGQAVDT |
| Ga0315273_130313972 | 3300032516 | Sediment | MANPTTYFGWVMPTATDLVTDLPADFNVFGQGVDTSMQYLLGGTT |
| Ga0334722_100244818 | 3300033233 | Sediment | MTNPTSNYGWQMPTATDLVTDLPADFEVFGQAVDTAMAD |
| Ga0334722_105842881 | 3300033233 | Sediment | MTNPTTNYSWQMPTATDLVTDLPADFAVFGQANDTT |
| Ga0316617_1022316661 | 3300033557 | Soil | MSNPTSNFGWQMPTNSDLVTDLPADFEVFGQAVDT |
| Ga0334994_0391526_548_673 | 3300033993 | Freshwater | MANPTTYFGWVMPTATDLVTDLPADFNVFGQGVDTSMQDLLG |
| Ga0334979_0664853_2_136 | 3300033996 | Freshwater | MANPTTNFGWVMPTSTDLVTDLPADFAVFGQGVDTSFADLNGGTT |
| Ga0334986_0100883_2_109 | 3300034012 | Freshwater | MTNPTSNYNFQMPTATDLVTDLPADFEVFGQAVDTR |
| Ga0334986_0150938_1_147 | 3300034012 | Freshwater | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATSMADLLGGTSGQVL |
| Ga0335005_0150589_1329_1478 | 3300034022 | Freshwater | MANPTTHFGWVMPTATDLVTDLPADFNVFGQGVDTSMQDLLGGTTGQVLS |
| Ga0335023_0709404_1_129 | 3300034050 | Freshwater | MSNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATSMADLLGG |
| Ga0334995_0413990_717_839 | 3300034062 | Freshwater | MTNPTTPFSWQMPQSTDLVTDLPADFEVFGQAVATSMADLL |
| Ga0334995_0833125_355_501 | 3300034062 | Freshwater | MANPTTNYGWVMPTATDLVTDLPADFNVFGQGVDTSMQDLLGGTTGQVL |
| Ga0335000_0784764_381_512 | 3300034063 | Freshwater | MSNPTNPFSWQMPTPTDLVTDLPADFEVFGQAVATSLADLLGGT |
| Ga0335019_0232378_3_134 | 3300034066 | Freshwater | MTNPTTPFSWQMPTATDLVTDLPADFEVFGQAVATSLADLLGGT |
| Ga0335022_0444275_3_143 | 3300034095 | Freshwater | MANPTTYFGWVMPTSSSLVTNLPADFNTFGQGVDTSLQDLLGGTTGQ |
| Ga0335027_0772489_447_560 | 3300034101 | Freshwater | MTNPTSNFGWQMPTSTDLVTDLPADFEVFGQAVDTSLA |
| Ga0335030_0593005_3_110 | 3300034103 | Freshwater | MTNPTTPFGWQMPTSTDLVTDLPADFEVFGQAVATS |
| Ga0335031_0240217_1071_1205 | 3300034104 | Freshwater | MANPTTNYGWVMPTATDLVTDLPADFNVFGQAVDTSLAQLKGGTT |
| Ga0335036_0697877_475_600 | 3300034106 | Freshwater | MANPTNPFSWQMPTASDLVTDLPADFETFGQAVATSMADLLG |
| Ga0335066_0343275_1_132 | 3300034112 | Freshwater | MSNPTSNFNWQMPTATDLVTDLPADFEVFGQAVDTALMDLKGGT |
| Ga0335056_0426291_573_710 | 3300034120 | Freshwater | MTNPTTPFSWQMPTSSDLVTDLPADFETFGQAVATSMADLLGGTTG |
| Ga0335060_0070527_2051_2158 | 3300034122 | Freshwater | MANPTTNYGFVLPTSTDLVTDLPADFDVALQGVDTR |
| Ga0335007_0344421_1_141 | 3300034283 | Freshwater | MANPTTYFGWVMPTATDLVTDLPADFNVFGQGVDTSMQDLLGGTTGQ |
| Ga0335064_0827416_425_562 | 3300034357 | Freshwater | MANPTTYFGWVMPTSSSLVTNLPADFNPFGQGVDTSLQDLLGGTTG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |