NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033416

Metagenome / Metatranscriptome Family F033416

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033416
Family Type Metagenome / Metatranscriptome
Number of Sequences 177
Average Sequence Length 41 residues
Representative Sequence MAGYTIQNLKDVEDQAPNFGLSPQLEARMARVPLELENFGV
Number of Associated Samples 160
Number of Associated Scaffolds 177

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.14 %
% of genes near scaffold ends (potentially truncated) 98.31 %
% of genes from short scaffolds (< 2000 bps) 96.05 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.791 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.859 % of family members)
Environment Ontology (ENVO) Unclassified
(24.859 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.107 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.19%    β-sheet: 0.00%    Coil/Unstructured: 76.81%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 177 Family Scaffolds
PF00133tRNA-synt_1 63.84
PF09334tRNA-synt_1g 12.99
PF13603tRNA-synt_1_2 12.43
PF01189Methyltr_RsmB-F 0.56
PF00106adh_short 0.56
PF00501AMP-binding 0.56
PF02784Orn_Arg_deC_N 0.56
PF03473MOSC 0.56
PF04439Adenyl_transf 0.56
PF00085Thioredoxin 0.56
PF06463Mob_synth_C 0.56
PF13567DUF4131 0.56
PF06267DUF1028 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 177 Family Scaffolds
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 76.84
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 76.84
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 76.84
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 76.84
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 12.99
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 12.99
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 0.56
COG014416S rRNA C967 or C1407 C5-methylase, RsmB/RsmF familyTranslation, ribosomal structure and biogenesis [J] 0.56
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 0.56
COG2896GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA)Coenzyme transport and metabolism [H] 0.56
COG3342Uncharacterized conserved protein, Ntn-hydrolase superfamilyGeneral function prediction only [R] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.92 %
UnclassifiedrootN/A18.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918004|FACENC_F56XM5W01EM0WYAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia532Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10152949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300000878|AL9A1W_1132458Not Available572Open in IMG/M
3300000886|AL3A1W_1138208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus2356Open in IMG/M
3300004479|Ga0062595_100962464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales728Open in IMG/M
3300005093|Ga0062594_102512360All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005166|Ga0066674_10496982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300005171|Ga0066677_10712273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300005187|Ga0066675_10821795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales702Open in IMG/M
3300005356|Ga0070674_100154485All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin0701735Open in IMG/M
3300005435|Ga0070714_101282978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter715Open in IMG/M
3300005439|Ga0070711_100191301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1573Open in IMG/M
3300005440|Ga0070705_101047078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales665Open in IMG/M
3300005454|Ga0066687_10747606All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005467|Ga0070706_100724328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales922Open in IMG/M
3300005526|Ga0073909_10722952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales501Open in IMG/M
3300005540|Ga0066697_10761767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales527Open in IMG/M
3300005540|Ga0066697_10785930All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005546|Ga0070696_101598871All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005549|Ga0070704_102037067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales533Open in IMG/M
3300005559|Ga0066700_10844637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300005562|Ga0058697_10498741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300005577|Ga0068857_102512952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300005578|Ga0068854_100332318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1238Open in IMG/M
3300005713|Ga0066905_100620504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059918Open in IMG/M
3300005841|Ga0068863_101628252All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300006032|Ga0066696_10031148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2855Open in IMG/M
3300006046|Ga0066652_101074062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales763Open in IMG/M
3300006049|Ga0075417_10606838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales557Open in IMG/M
3300006574|Ga0074056_11797857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1242Open in IMG/M
3300006581|Ga0074048_13414686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300006806|Ga0079220_10634282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059768Open in IMG/M
3300006846|Ga0075430_101787660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia504Open in IMG/M
3300006853|Ga0075420_101863554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300006914|Ga0075436_100833387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia688Open in IMG/M
3300009089|Ga0099828_10519138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1074Open in IMG/M
3300009147|Ga0114129_11182943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria953Open in IMG/M
3300009147|Ga0114129_11836776All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300009148|Ga0105243_11211123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300009156|Ga0111538_12014873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium726Open in IMG/M
3300009789|Ga0126307_10382816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1134Open in IMG/M
3300009789|Ga0126307_11188669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300009802|Ga0105073_1049396Not Available553Open in IMG/M
3300009840|Ga0126313_10221160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1460Open in IMG/M
3300009840|Ga0126313_11029776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria675Open in IMG/M
3300010036|Ga0126305_11244549All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010038|Ga0126315_10989581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300010039|Ga0126309_11097980All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300010044|Ga0126310_10998373Not Available659Open in IMG/M
3300010047|Ga0126382_11767239Not Available580Open in IMG/M
3300010325|Ga0134064_10167383Not Available770Open in IMG/M
3300010326|Ga0134065_10220191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300010329|Ga0134111_10171488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia867Open in IMG/M
3300010329|Ga0134111_10184949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria837Open in IMG/M
3300010335|Ga0134063_10668941Not Available534Open in IMG/M
3300010336|Ga0134071_10605493Not Available573Open in IMG/M
3300011003|Ga0138514_100021683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1157Open in IMG/M
3300011422|Ga0137425_1112944All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300011996|Ga0120156_1039678Not Available862Open in IMG/M
3300012199|Ga0137383_10911952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria642Open in IMG/M
3300012200|Ga0137382_10089540All Organisms → cellular organisms → Bacteria2011Open in IMG/M
3300012206|Ga0137380_11085279Not Available682Open in IMG/M
3300012209|Ga0137379_10917447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300012211|Ga0137377_10904394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium814Open in IMG/M
3300012285|Ga0137370_10070139Not Available1921Open in IMG/M
3300012349|Ga0137387_10766744Not Available698Open in IMG/M
3300012356|Ga0137371_10985100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300012359|Ga0137385_10903193All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300012491|Ga0157329_1007074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria807Open in IMG/M
3300012498|Ga0157345_1050961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300012502|Ga0157347_1075013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300012530|Ga0136635_10391677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300012685|Ga0137397_10771080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300012911|Ga0157301_10195229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300012915|Ga0157302_10168383Not Available760Open in IMG/M
3300012955|Ga0164298_10925276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300012957|Ga0164303_11147599Not Available564Open in IMG/M
3300012961|Ga0164302_10508343Not Available852Open in IMG/M
3300012972|Ga0134077_10498271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300012975|Ga0134110_10310569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia683Open in IMG/M
3300012976|Ga0134076_10593956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300012977|Ga0134087_10140909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1042Open in IMG/M
3300013296|Ga0157374_12164549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300014056|Ga0120125_1043876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium975Open in IMG/M
3300014166|Ga0134079_10238493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300014965|Ga0120193_10037194All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300015357|Ga0134072_10295590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300015357|Ga0134072_10371034Not Available555Open in IMG/M
3300015358|Ga0134089_10380645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300015359|Ga0134085_10260500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales756Open in IMG/M
3300015371|Ga0132258_10059826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia8768Open in IMG/M
3300015371|Ga0132258_10636458All Organisms → cellular organisms → Bacteria2681Open in IMG/M
3300015374|Ga0132255_102686424Not Available761Open in IMG/M
3300017657|Ga0134074_1251400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300017789|Ga0136617_10484033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria986Open in IMG/M
3300018051|Ga0184620_10235692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300018054|Ga0184621_10134897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria886Open in IMG/M
3300018054|Ga0184621_10252043Not Available629Open in IMG/M
3300018071|Ga0184618_10379708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300018433|Ga0066667_10754122All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b822Open in IMG/M
3300018433|Ga0066667_11873555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300018465|Ga0190269_10535925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium771Open in IMG/M
3300018466|Ga0190268_11874789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium544Open in IMG/M
3300018468|Ga0066662_10649508All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300018920|Ga0190273_12184161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia519Open in IMG/M
3300019361|Ga0173482_10217069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300019885|Ga0193747_1120874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300020002|Ga0193730_1040532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1349Open in IMG/M
3300020020|Ga0193738_1093753Not Available864Open in IMG/M
3300021080|Ga0210382_10467933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300021081|Ga0210379_10115731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1123Open in IMG/M
3300021413|Ga0193750_1042686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium982Open in IMG/M
3300025852|Ga0209124_10335601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300025899|Ga0207642_10712881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300025899|Ga0207642_11004802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300025908|Ga0207643_10556723Not Available736Open in IMG/M
3300025910|Ga0207684_10302996All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b1378Open in IMG/M
3300025919|Ga0207657_10348950All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin5101167Open in IMG/M
3300025924|Ga0207694_11778022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300025929|Ga0207664_11872931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300025935|Ga0207709_10754312Not Available783Open in IMG/M
3300025936|Ga0207670_11121121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300025938|Ga0207704_11835358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300025942|Ga0207689_10230473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium1531Open in IMG/M
3300026023|Ga0207677_12202554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300026041|Ga0207639_11772442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300026095|Ga0207676_11027455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium813Open in IMG/M
3300026116|Ga0207674_12146566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300026142|Ga0207698_11435036All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus705Open in IMG/M
3300026310|Ga0209239_1119715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300026527|Ga0209059_1332236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300026540|Ga0209376_1364225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300026547|Ga0209156_10173007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1039Open in IMG/M
3300027050|Ga0209325_1021611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300027324|Ga0209845_1022752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1021Open in IMG/M
3300027907|Ga0207428_10261334Not Available1289Open in IMG/M
3300028709|Ga0307279_10053543All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300028710|Ga0307322_10105409All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11727Open in IMG/M
3300028711|Ga0307293_10165544Not Available704Open in IMG/M
3300028711|Ga0307293_10202302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300028716|Ga0307311_10213085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300028718|Ga0307307_10088123Not Available937Open in IMG/M
3300028720|Ga0307317_10053203Not Available1300Open in IMG/M
3300028720|Ga0307317_10130913Not Available839Open in IMG/M
3300028721|Ga0307315_10302645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300028722|Ga0307319_10228579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300028722|Ga0307319_10325734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300028744|Ga0307318_10048328Not Available1407Open in IMG/M
3300028744|Ga0307318_10267558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300028768|Ga0307280_10214530Not Available684Open in IMG/M
3300028768|Ga0307280_10414749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300028803|Ga0307281_10039848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1442Open in IMG/M
3300028811|Ga0307292_10340373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300028812|Ga0247825_10443067All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300028824|Ga0307310_10370139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300028828|Ga0307312_10077885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium2022Open in IMG/M
3300028828|Ga0307312_11126301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales519Open in IMG/M
3300028872|Ga0307314_10110751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300028875|Ga0307289_10311256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300028876|Ga0307286_10003234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4792Open in IMG/M
3300028881|Ga0307277_10183021Not Available915Open in IMG/M
3300028885|Ga0307304_10315444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300028885|Ga0307304_10373968Not Available640Open in IMG/M
3300030006|Ga0299907_10704515Not Available772Open in IMG/M
3300030620|Ga0302046_10246706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1469Open in IMG/M
3300031680|Ga0318574_10899028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300031716|Ga0310813_11643477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300031731|Ga0307405_11083095All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300031740|Ga0307468_100734218All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300031820|Ga0307473_11182565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300031847|Ga0310907_10479909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300031908|Ga0310900_11746397All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031995|Ga0307409_101063584All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin510829Open in IMG/M
3300032954|Ga0335083_10194543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1863Open in IMG/M
3300033412|Ga0310810_10404968Not Available1406Open in IMG/M
3300033475|Ga0310811_10431530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1422Open in IMG/M
3300033551|Ga0247830_11654014Not Available513Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil9.04%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.21%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.52%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.39%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.26%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.69%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.13%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.13%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.13%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.13%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.13%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.13%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.13%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.13%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.13%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.56%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.56%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.56%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.56%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.56%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.56%
Arabidopsis RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.56%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918004Soil microbial communities from sample at FACE Site 2 North Carolina CO2-EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000878Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009802Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011996Permafrost microbial communities from Nunavut, Canada - A39_65cm_12MEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012502Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610Host-AssociatedOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027324Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCA_11196402035918004SoilMSDYTHINLKDDVEDQAPNFGLSPDLETRMARVPLGMEEAGL
AF_2010_repII_A1DRAFT_1015294913300000597Forest SoilMATFTHLNLQNDVEDQAPKFGLSPDLEFRMARVPLEMENAGCSYL
AL9A1W_113245823300000878PermafrostMAGFTKVNLKDDVDDQAPNFGLSPNLEMRMARVPLGMENSG
AL3A1W_113820823300000886PermafrostMAGFTKVNLKDDVDDQAPNFGLSPNLEMRMARVPLGMENSGMSYQRIAPN
Ga0062595_10096246413300004479SoilMAAYTKVNLKEDVDDQAPNFGLAPDLEARMARVPLELEHSGIS
Ga0062594_10251236023300005093SoilMAAYTKVNLKQDVDDQAPNFGLAPDLEARMARVPLELEHS
Ga0066674_1049698213300005166SoilMYQRGRIVAMSDYTHINLKEDVDDQAPNFGLSPQLESRMARVPLEM
Ga0066677_1071227323300005171SoilMAGYTKLNLREDVEDQGPNFGYEGKMEARMARVPLELEHSGVS
Ga0066675_1082179523300005187SoilMSDFTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEQSGLSYCRV
Ga0070674_10015448523300005356Miscanthus RhizosphereMAGYTKLNLKNDVEDQAPNFGLEGKIEARMARVPLELEQQGVS
Ga0070714_10128297823300005435Agricultural SoilMDAMTGYTHINLKEDVEDQAPNFGMSPNLEMRMARVPLELENSGL
Ga0070711_10019130123300005439Corn, Switchgrass And Miscanthus RhizosphereMDAMTGYTHINLKEDVEDQAPNFGMSPNLEMRMARVPLEL
Ga0070705_10104707813300005440Corn, Switchgrass And Miscanthus RhizosphereMSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEQSGLSYCRV
Ga0066687_1074760613300005454SoilMAGHTVQNLKEVEDQAPNFGLSPHLEARMARVPLELENFG
Ga0070706_10072432813300005467Corn, Switchgrass And Miscanthus RhizosphereMTDYTHINLKEDVDDQAPNFGLSPDLETRMARVPLGMENSGLSYI
Ga0073909_1072295213300005526Surface SoilMSDYTQLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEQSGLSYCRV
Ga0066697_1076176723300005540SoilLAGYTKVNLKDDVDDQAPNFGLEGKIEARMARVALELEHSGVSYQRLAPN
Ga0066697_1078593023300005540SoilMAAYTVQNLKEVEDQAPNFGLGPELEARMARVPLELEEF
Ga0070696_10159887113300005546Corn, Switchgrass And Miscanthus RhizosphereMAGYTKLNLRENVDDQGPNFGFEGKIEARMARVALELEQSGVS
Ga0070704_10203706723300005549Corn, Switchgrass And Miscanthus RhizosphereMTDYTHINLKEDVDDQAPNFGLSPDLETRMARVPLGMENSGLSYIRI
Ga0066700_1084463723300005559SoilMGEYTIKNLKTDVDDQATNFGLAPNLEARMARVPLELENF
Ga0058697_1049874113300005562AgaveMAAYTIKNLKTDVDDQAPNFGLSPDLEVRMARVPLELESF
Ga0068857_10251295213300005577Corn RhizosphereMAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLELEQQGVSY
Ga0068854_10033231823300005578Corn RhizosphereMAGYTKLNLKDDVEDQAPNFGLEGKIEARMARVPLELEQQ
Ga0066905_10062050413300005713Tropical Forest SoilMSDYTHINLREDVEDQAPNFGLAPNLETRMARVPLEMENAGLT
Ga0068863_10162825213300005841Switchgrass RhizosphereVAAYTIQNLKDVEDQAPKFGFSPQLEARMARVPLE
Ga0066696_1003114813300006032SoilMAGYTIQNLKDVEDQAPNFGLSPQLEARMARVPLELENFGV
Ga0066652_10107406213300006046SoilVAEYTVQNMKEVEDQAPKFGHSPHLEARMARVPLE
Ga0075417_1060683823300006049Populus RhizosphereMSDYTHINLKEDVDDQAPNFGLAPDLEFRMARVPLEMENAGVS
Ga0074056_1179785713300006574SoilMSDYTHLNLKDADDQAPNFGLSPDMEFRMARVPLGLEHSGISYCRVSPGFR
Ga0074048_1341468623300006581SoilMSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEHS
Ga0079220_1063428223300006806Agricultural SoilMDAMSDYTHLNLKQDVDDQAPNFGLAPDMEFRMARVPLEMENAGV
Ga0075430_10178766013300006846Populus RhizosphereMAAMSGYTIANLKEVEDQAPKFGLSPDLEARFARVALDAEM
Ga0075420_10186355413300006853Populus RhizosphereVADYTKVNIKEEVEDQAPNFGLSPDLESRMARVPL
Ga0075436_10083338723300006914Populus RhizosphereMDAMTGYTHINLKEDVEDQAPNFGMSPNLEMRMARVPLELE
Ga0099828_1051913823300009089Vadose Zone SoilMSDYTHLNLKDADDQAPNFGLSPDLEFRMARVPLGLEHSGLS
Ga0114129_1118294323300009147Populus RhizosphereMAAYTKVNLRDDVDDQAPNFGLAPDLEARMARVPLELEHSGISYQRLAPN
Ga0114129_1183677613300009147Populus RhizosphereMSEYTHLNLKEVEDQAPKFGLSPDLEFRMARVPLEMENAGV
Ga0105243_1121112323300009148Miscanthus RhizosphereLAGYTTLNLKDVEDQAPNFGLSPDLEARMARVPLELEQFGL
Ga0111538_1201487323300009156Populus RhizosphereVGGYTHLNLKEDVDDQAPNFGLSPNLEARMARVPLELEGFGVSYQ
Ga0126307_1038281633300009789Serpentine SoilMSTYTKVNLREDVDDMAPRFGYAEHVEARFARRTLELEQSGI
Ga0126307_1118866923300009789Serpentine SoilMAGYTKLNLKDEVEDQAPKFGLGGKLEARMARVPLELEHSGVSYQRLS
Ga0105073_104939613300009802Groundwater SandMAGYTKLNLKADVEDQAPKFGFSPNLEFRMARDSL
Ga0126313_1022116023300009840Serpentine SoilMSGYTIVNLKEVEDQAPKFGYSPNLEARFARVPLEL
Ga0126313_1102977623300009840Serpentine SoilMSGYTIVNLKEVEDQAPNFGLTPDLEARFARVALD
Ga0126305_1124454913300010036Serpentine SoilMSEYTVVNMRNVEDQAEKFGLSPQLEARFARVPLEAEL
Ga0126315_1098958113300010038Serpentine SoilMSRYTHINLKDDVEDQAPKFGMSPNLEMRMARVPLELENS
Ga0126309_1109798023300010039Serpentine SoilMSDYTHLNLKEVEDQAPKFGLSPDLEFRMGRVPLDMEQAGLSYIR
Ga0126310_1099837323300010044Serpentine SoilMTDYTLINLKQDVEDQAPNFGLSPNLEARMARVPLAMENAGLSYIRIAPGF
Ga0126382_1176723913300010047Tropical Forest SoilMAAMSDYTHINLKEDVDDQAPNFGLAPHLETRMARVPLEMEHAGLSYIRIA
Ga0134064_1016738313300010325Grasslands SoilMADDTHINHKEDVEDQAPNFGLSPNLEARMARVPLEMEQAGVTYL
Ga0134065_1022019113300010326Grasslands SoilMTTYTIKNLKADVDDQAPNFGLSPQLETRMARVPLELEHAGVS
Ga0134111_1017148823300010329Grasslands SoilMADYTHINLKDDVDDQAPNFGLSPQLETRMARVPLEMENAGVSY
Ga0134111_1018494913300010329Grasslands SoilMAGYTKLNLKKDVEDQGPNFGYEGKMEARMARVPLELEHAGV
Ga0134063_1066894113300010335Grasslands SoilMSDYTHINLKEDVDDQAPNFGLSPNLEARMARVPL
Ga0134071_1060549313300010336Grasslands SoilVAAYTKVNLKEDVEDQAPNFGLSPNLEARMARVPLEMEQLLE*
Ga0138514_10002168323300011003SoilMSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLEMENSGI
Ga0137425_111294423300011422SoilMSEYTHVNLREVEDQAPKFGLSPDLEFRMGRVPLDMENAGVSYIRMA
Ga0120156_103967823300011996PermafrostMAGFTKVNLKDDVDDQAPNFGLSPNLEMRMARVPLGMENSGMS
Ga0137383_1091195223300012199Vadose Zone SoilMAGYTKLNLREDVEDQAPNFGLEGKIEARMARVPLELEHSGV
Ga0137382_1008954013300012200Vadose Zone SoilMSAMSDYTHINLKEDVEDQAPNFGLSPNLEARMARVPLEMEQAG
Ga0137380_1108527923300012206Vadose Zone SoilMSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEH
Ga0137379_1091744713300012209Vadose Zone SoilLTLATIIGDMSDYTHLNLKDADDQAPNFGLSPELEFRMARVPLGLEHS
Ga0137377_1090439423300012211Vadose Zone SoilVAGYTKVNLKDDVEDQAPNFGLAPHIEARMARVPLELEH
Ga0137370_1007013923300012285Vadose Zone SoilMSAMSDYTHINLKEDVDDQAPNFGLSPNMEFRMARVPLDMENAGLSYLRIAPGFRV
Ga0137387_1076674413300012349Vadose Zone SoilMSDYTHLNLKDVEDQAPNFGLEDNLEFRMARVALGLENSGLSYCRVAPGF
Ga0137371_1098510013300012356Vadose Zone SoilMAAYTLVNLKDVEDQGPNFGLAGDLEARMARVPLELEHSGVTYQR
Ga0137385_1090319313300012359Vadose Zone SoilLGDYTKVNLKEDVDDQAERFGLAPNIEFRMGRVPL
Ga0157329_100707423300012491Arabidopsis RhizosphereMAAYTKVNLREDVDDQAPNFGLAPDLEARMARVPLELE
Ga0157345_105096113300012498Arabidopsis RhizosphereMGYTKLNLREDVEDQAPKFGLEGNLEARMARVPLEL
Ga0157347_107501323300012502Arabidopsis RhizosphereMAAYTKVNLREEVDDQAPNFGLAPDLEARMARVPLEVEHSGISYQRLA
Ga0136635_1039167713300012530Polar Desert SandMAGYTIVNRRDVEDQAPKFGLSPNLHARFTGDSLG
Ga0137397_1077108023300012685Vadose Zone SoilMSDYTHLNLKDAEDQAPNFGLGDNLEFRMARVALGLE
Ga0157301_1019522913300012911SoilMPEYNKLNLKDDVEDQAPNFGLAPDLEARMARVPLELEGFGV
Ga0157302_1016838323300012915SoilMGGYTKVNLKDDVEDQGPNFGLEGKIEARMARVPLE
Ga0164298_1092527623300012955SoilMSEYTTVNLKEVEDQAPKWNLSPDLEARFARVALDAE
Ga0164303_1114759923300012957SoilMVMADYTHINLKQDVDDQAPNFGLSPNLEARMARVPLGMENAGVSYLRIGPG
Ga0164302_1050834323300012961SoilMSDYTHLNLKDADDQAPNFGLSPDLEFRMARVPLGLEHSG
Ga0134077_1049827113300012972Grasslands SoilMSGYTIVNMKEVEDQAPKFGLSPDLEARFARVALDAELIG
Ga0134110_1031056923300012975Grasslands SoilMADYTHINLKDDVDDQAPNFGLSPQLETRMARVPLEM
Ga0134076_1059395613300012976Grasslands SoilMSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLELEQS
Ga0134087_1014090923300012977Grasslands SoilMSGYTKLNLREEVEDQAPNFGLEGKIEMRMARVPLEC
Ga0157374_1216454923300013296Miscanthus RhizosphereVSGYTIVNLKEVEDRATGEGPTLEARCARGALDSDHL
Ga0120125_104387623300014056PermafrostMEMADFTKLNLKEDVEDQAPNFGLAPHLEARMARVALGMENGGLS
Ga0134079_1023849323300014166Grasslands SoilMAGYTHLNLKEVEDQAPKFDMSPDLEFRSARVPLEMEN
Ga0120193_1003719423300014965TerrestrialMSGYTIVNLKQVEDQAPNFGLSPDLEARFARVALDA
Ga0134072_1029559023300015357Grasslands SoilMAGYTVRNLKDDVDDQALNFGLSPQLESRMARVPLEL
Ga0134072_1037103413300015357Grasslands SoilMSDYTHLNLKEDVDDQAPNFGLSPNLEFRMARVPLEMENA
Ga0134089_1038064513300015358Grasslands SoilMSGYTIVNLKEVEDQAPNFGLAPDFEARFARVALDAELV
Ga0134085_1026050013300015359Grasslands SoilMAGYTIQNLKDVEDQAPNFGVPPGLEARFARQALELEKSGASY
Ga0132258_1005982643300015371Arabidopsis RhizosphereMRYTKLNLKDDVEDQAPKFGLGENLESRMARVPLELQQSGVSYQRLGPN*
Ga0132258_1063645813300015371Arabidopsis RhizosphereMTDYTHLNLKDDVDDQAPNFGLAPDLEFRMARVPL
Ga0132255_10268642413300015374Arabidopsis RhizosphereMGYTKLNLREDVEDQAPKFGLEGNLEARMARVPLELQQSGLSYQRLG
Ga0134074_125140023300017657Grasslands SoilVGGYTIKNLKTDVEDQAPNFGYSPHIEARMARVPLGLEHS
Ga0136617_1048403333300017789Polar Desert SandMADYTLKNLKEVKDQAPDHGMGGDMEARFARTDLELEK
Ga0184620_1023569223300018051Groundwater SedimentVAEYTDQNMKEVEDQAPKFGHSPHLEARMARVPLE
Ga0184621_1013489723300018054Groundwater SedimentMSDYTIVNLKEVDDQAPNFGLEGKIEARMARVPLELEHSGISYQRLA
Ga0184621_1025204313300018054Groundwater SedimentMAGFTKVNLKDDVDDQAPNFGLSPHIEARMARVPLEMENAGISY
Ga0184618_1037970813300018071Groundwater SedimentMAGYTKLNLREDVEDQAPNFGLEDKLEARMARVPLELEHSGLSY
Ga0066667_1075412213300018433Grasslands SoilMSDYTHLNLKEDVDDQGPNFGFAGDIEARMARVPLGMESSGV
Ga0066667_1187355523300018433Grasslands SoilMTAYTIKNLKDDVDDQAPNFGLSPDLEARMARVPLELEQFGISY
Ga0190269_1053592523300018465SoilMSGYTHLNLKDVEDQAPNFGLADNLEFRMARVALGL
Ga0190268_1187478923300018466SoilMAGYTHVNLKQDVEDQAPNFGYAPNIEARFAGGSLELENSGVS
Ga0066662_1064950813300018468Grasslands SoilMAEYTHINLKEDVDDQAPNFGLSPHIEARMARVPLGMEHAGLSYQ
Ga0190273_1218416123300018920SoilMSEYTHLNLKDVEDQAPKFGLSPDMEFRMARVPLEMENAGVSYLRVA
Ga0173482_1021706923300019361SoilMSDYTIVNLKEVEDQAPNFGLSPDLEARFARVALDAERVG
Ga0193747_112087413300019885SoilMAGYTKVNLREDVDDQGPNFGFEGKIEARMARVPLELEQSGVSLLGLAPNF
Ga0193730_104053213300020002SoilMSDYTLLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEHSGISYFRVSPG
Ga0193738_109375323300020020SoilMSGYTIVNLKEVEDQAENFGLAPDFEARFARVALEAE
Ga0210382_1046793313300021080Groundwater SedimentMSGYTIVNLKEVEDQALNFGLSPDLEARFGRVALDAELIG
Ga0210379_1011573123300021081Groundwater SedimentMSEYTHVNLKEVEDQAPKFGLSPDLEFRMGRVPLDMENAGV
Ga0193750_104268613300021413SoilMSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLE
Ga0209124_1033560113300025852Arctic Peat SoilMAGYTLKNLKEVEDQAPTFGLSPSLEARFARGPLELESSGLS
Ga0207642_1071288123300025899Miscanthus RhizosphereMAAYTKVNLKQDVDDQAPNFGLAPDLEARMARVPLELEHSGISYQ
Ga0207642_1100480223300025899Miscanthus RhizosphereMAGYTKLNLKDEVEDQAPNFGLEGKIEARMARVPLELEQQG
Ga0207643_1055672313300025908Miscanthus RhizosphereMSDFTHLNLKDVEDQAPNFGLEENLEFRMARVGLGLENSGLSYL
Ga0207684_1030299623300025910Corn, Switchgrass And Miscanthus RhizosphereMAGYTKLNLRENVDDQGPNFGFEGKIEARMARVPLELEQSGVSLL
Ga0207657_1034895013300025919Corn RhizosphereMAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPL
Ga0207694_1177802213300025924Corn RhizosphereMAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLELD
Ga0207664_1187293123300025929Agricultural SoilMSDYTHLNLKDADDQAPNFGLSPDLEFRMARVPLGLEHS
Ga0207709_1075431213300025935Miscanthus RhizosphereMAGYTKLNLKDDVEDQAPNFGLEGKIEARMACVPLE
Ga0207670_1112112123300025936Switchgrass RhizosphereMAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLEL
Ga0207704_1183535823300025938Miscanthus RhizosphereMAAYTKVNLKEDVDDQAPNFGLAPDLEARMARVPLELEHSGISYQ
Ga0207689_1023047313300025942Miscanthus RhizosphereMAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLELEHQGVTYQ
Ga0207677_1220255413300026023Miscanthus RhizosphereVAAYTIQNLKDVEDQAPKFGFSPQLEARMARVPLELENFGIS
Ga0207639_1177244213300026041Corn RhizosphereMAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLELEHQG
Ga0207676_1102745513300026095Switchgrass RhizosphereMSDYTHLNLKDADDQAPNFGLSPDLEFRMARVPLGLEHSGI
Ga0207674_1214656613300026116Corn RhizosphereMAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLELEQQGVSYQRLAPN
Ga0207698_1143503613300026142Corn RhizosphereMAGYTKLNLKDDVEDQAPNFGLEGKIEARMARVPL
Ga0209239_111971513300026310Grasslands SoilVAGYTKANLKEDVEDQAPNFGLEGKIEARMARVAL
Ga0209059_133223613300026527SoilMAGYTKLNLREDVEDQAPNFGLEENLEARMARVPLELEHSGVS
Ga0209376_136422513300026540SoilMAGYTKLNLREDVEDQGPNFGYEGKMEARMARVPLELEHSGVSLLGL
Ga0209156_1017300713300026547SoilMAGYTHLNLKEVEDQAPKFDMSPDLEFRSARVPLEMENAGISYLRV
Ga0209325_102161113300027050Forest SoilMAGYTKLNLKDEVEDQAPNFGLEGKIEARMARVPLEP
Ga0209845_102275223300027324Groundwater SandVAEYTLTNLKDVEDQAPKFGLGDNLEFRMARVALGLENSG
Ga0207428_1026133413300027907Populus RhizosphereMSEYTIKNLKDDVGDQAPNFGLSPDLGARFARDSLDME
Ga0307279_1005354313300028709SoilVADYTVTNLKSDVEDQAPNFGMSPNLEARFARAALELQSSGVSYQ
Ga0307322_1010540923300028710SoilMAAYTKVNLKEDVDDQAPNFGLAPDLEARMARVPLE
Ga0307293_1016554423300028711SoilMSDYTHLNLKDADDQAPNFGLSPDLEFRMARVPLGLEQSGLSYCRVA
Ga0307293_1020230223300028711SoilMSDYTHLNLKAAEDQAPNFGLSPDLEFRMARVPLGLEQS
Ga0307311_1021308513300028716SoilMAGYTKVNLKDDVEDQGPNFGYEGKIEARMARVPLE
Ga0307307_1008812323300028718SoilMSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEHSGISYCRVS
Ga0307317_1005320313300028720SoilMSDYTHINLKEDVEDQAPNFGLSPNLETRMARVPLGMENSGV
Ga0307317_1013091313300028720SoilMAGFTKVNLKEDVDDQAPNFGLSPNLEARMARVPLEMENAGISYQRIAPN
Ga0307315_1030264523300028721SoilMAAYTKVNLKEDVDDQAPNFGLAPDLEARMARVPLELEHSGISY
Ga0307319_1022857923300028722SoilMAGYTKLNLREVDDQAPNFGLEGKIEARMARVQLEL
Ga0307319_1032573423300028722SoilMSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEHSGI
Ga0307318_1004832823300028744SoilMSDYTHINLKEDVEDQAPNFGLSPNLETRMARVPLGM
Ga0307318_1026755813300028744SoilMSGYTIVNLKEVEDQAPNFGLSPDLEARFARVALDAELIG
Ga0307280_1021453023300028768SoilMSDYTHINLKEDVEDQAPNFGLSPNLETRMARVPLGMENSGVSYIRIAPGFR
Ga0307280_1041474923300028768SoilVAGYTVQNLKEVEDQALNFGLSPHLEARMARVPLELEQSGV
Ga0307281_1003984813300028803SoilMSEYTHVNLKEVEDQAPKFGLSPDLEFRMGRVPLDMENAGVSYIRM
Ga0307292_1034037313300028811SoilMAGYTKLNLREVDDQAPNFGLEGKIEARMARVPLEL
Ga0247825_1044306723300028812SoilMSDYTIVNMKEVEDQAPKFGLAPDLEARFARVPLDAELIGFT
Ga0307310_1037013923300028824SoilMSEYKIVNLKEVEDQAPNFGLSPDLEARFARVALE
Ga0307312_1007788523300028828SoilMAGYTKLNLKDDVEDQAPKFGLGGTMEARMARVPLELE
Ga0307312_1112630113300028828SoilMSGYTIVNLKEVEDQAPNFGLSPDLEARFARVALDAELIGLTYQR
Ga0307314_1011075123300028872SoilMSGYTIVNLKEVEDQAPNFGLAPDFEARFARVALEAEL
Ga0307289_1031125623300028875SoilMSEYTIVNLKEVEDQAPKWNLSPDLEARFARVALD
Ga0307286_1000323443300028876SoilMPSNSSSVTVGAMSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEHS
Ga0307277_1018302113300028881SoilMAGYTKLNLKDDVDDQGPNFGYEGKIEARMARVPLELEHSGVSYLR
Ga0307304_1031544413300028885SoilMAEYTHLNLKQDVDDQAPNFGLSPNLEARMARVPLQL
Ga0307304_1037396823300028885SoilMSDYTHINLKEDVEDQAPNFGLSPNLETRMARVPLGMENSGVSYIR
Ga0299907_1070451523300030006SoilMSDYTHLNLKEVEDQAPKFGLSPDLEFRMARVPLELEQAGV
Ga0302046_1024670613300030620SoilMADYTKVNLKRDVDDSAEQHGLAPELEARFATLPLELTESAISYQRFAAN
Ga0318574_1089902823300031680SoilVAGYAIVNLKDVEDQAPAFGLSPALEARFARRPLD
Ga0310813_1164347713300031716SoilMAEYNKVNLKDDVEDQAPNFGLAPDLEARMARVPLELEGFGVSYQRVA
Ga0307405_1108309513300031731RhizosphereMGYTKLNLKDDVEDQAPNFGLEENLEARMARVPLELQNSGLSY
Ga0307468_10073421823300031740Hardwood Forest SoilMAAMSGYTIANLKEVEDQAPNFGMSPDLEARFARVAL
Ga0307473_1118256513300031820Hardwood Forest SoilVAAYTIQNLKDVEDQAPKFGFSPQLEARMARVPLEL
Ga0310907_1047990923300031847SoilMAGYTKVNLKDDVEDQAPNFGLEGKIEARMARVPLEMEQAGVSYQRIAPSFRV
Ga0310900_1174639723300031908SoilMSEYTHLNLKEVEDQAPKFGLSPDLEFRMGRVPLDMENAGVS
Ga0307409_10106358423300031995RhizosphereMGYTKLNLKDDVEDQAPNFGLEENLEARMARVPLELQ
Ga0335083_1019454313300032954SoilMVENRRCELAGYTKVNLKDDVDDQGPNFGLEGKIEARMARVPLELEHTGVSY
Ga0310810_1040496813300033412SoilMSEYTIVNLKEVEDQAPKWNLSPDLEARFARVALDAELV
Ga0310811_1043153013300033475SoilMSEYTIVNLKEVEDQAPKWNLSPDLEARFARVALDA
Ga0247830_1165401423300033551SoilMSEYTIVNLKEVEDQAPNFGLAPDFEARFARVALEAE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.