


| Basic Information | |
|---|---|
| Family ID | F033124 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MEQAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASAD |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 17.98 % |
| % of genes near scaffold ends (potentially truncated) | 98.31 % |
| % of genes from short scaffolds (< 2000 bps) | 90.45 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.719 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.393 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.079 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.944 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF04216 | FdhE | 4.49 |
| PF13545 | HTH_Crp_2 | 3.37 |
| PF01040 | UbiA | 2.81 |
| PF06537 | DHOR | 1.69 |
| PF02518 | HATPase_c | 1.69 |
| PF03551 | PadR | 1.12 |
| PF00892 | EamA | 1.12 |
| PF07681 | DoxX | 1.12 |
| PF13620 | CarboxypepD_reg | 1.12 |
| PF00561 | Abhydrolase_1 | 1.12 |
| PF00248 | Aldo_ket_red | 1.12 |
| PF13671 | AAA_33 | 1.12 |
| PF01638 | HxlR | 1.12 |
| PF04238 | DUF420 | 1.12 |
| PF00296 | Bac_luciferase | 1.12 |
| PF08592 | Anthrone_oxy | 1.12 |
| PF04239 | DUF421 | 1.12 |
| PF08240 | ADH_N | 1.12 |
| PF00723 | Glyco_hydro_15 | 1.12 |
| PF00072 | Response_reg | 0.56 |
| PF00106 | adh_short | 0.56 |
| PF00891 | Methyltransf_2 | 0.56 |
| PF00206 | Lyase_1 | 0.56 |
| PF03724 | META | 0.56 |
| PF00873 | ACR_tran | 0.56 |
| PF13561 | adh_short_C2 | 0.56 |
| PF11752 | DUF3309 | 0.56 |
| PF13426 | PAS_9 | 0.56 |
| PF00534 | Glycos_transf_1 | 0.56 |
| PF12680 | SnoaL_2 | 0.56 |
| PF01019 | G_glu_transpept | 0.56 |
| PF00440 | TetR_N | 0.56 |
| PF13602 | ADH_zinc_N_2 | 0.56 |
| PF00899 | ThiF | 0.56 |
| PF00027 | cNMP_binding | 0.56 |
| PF13302 | Acetyltransf_3 | 0.56 |
| PF11528 | DUF3224 | 0.56 |
| PF12728 | HTH_17 | 0.56 |
| PF05163 | DinB | 0.56 |
| PF04389 | Peptidase_M28 | 0.56 |
| PF02195 | ParBc | 0.56 |
| PF00589 | Phage_integrase | 0.56 |
| PF06925 | MGDG_synth | 0.56 |
| PF13590 | DUF4136 | 0.56 |
| PF00144 | Beta-lactamase | 0.56 |
| PF13313 | DUF4082 | 0.56 |
| PF00664 | ABC_membrane | 0.56 |
| PF00313 | CSD | 0.56 |
| PF04961 | FTCD_C | 0.56 |
| PF02517 | Rce1-like | 0.56 |
| PF01654 | Cyt_bd_oxida_I | 0.56 |
| PF05985 | EutC | 0.56 |
| PF12681 | Glyoxalase_2 | 0.56 |
| PF10282 | Lactonase | 0.56 |
| PF07883 | Cupin_2 | 0.56 |
| PF12697 | Abhydrolase_6 | 0.56 |
| PF07690 | MFS_1 | 0.56 |
| PF12844 | HTH_19 | 0.56 |
| PF13676 | TIR_2 | 0.56 |
| PF13442 | Cytochrome_CBB3 | 0.56 |
| PF08447 | PAS_3 | 0.56 |
| PF13378 | MR_MLE_C | 0.56 |
| PF06662 | C5-epim_C | 0.56 |
| PF01380 | SIS | 0.56 |
| PF00085 | Thioredoxin | 0.56 |
| PF13365 | Trypsin_2 | 0.56 |
| PF09445 | Methyltransf_15 | 0.56 |
| PF13495 | Phage_int_SAM_4 | 0.56 |
| PF02322 | Cyt_bd_oxida_II | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG3058 | Formate dehydrogenase maturation protein FdhE | Posttranslational modification, protein turnover, chaperones [O] | 4.49 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.25 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 1.69 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.12 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.12 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.12 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.12 |
| COG2322 | Cytochrome oxidase assembly protein CtaM/YozB, DUF420 family | Posttranslational modification, protein turnover, chaperones [O] | 1.12 |
| COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 1.12 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 1.12 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.12 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.56 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.56 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.56 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.56 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.56 |
| COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG3404 | Formiminotetrahydrofolate cyclodeaminase | Amino acid transport and metabolism [E] | 0.56 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 0.56 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.72 % |
| Unclassified | root | N/A | 25.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001471|JGI12712J15308_10122773 | Not Available | 664 | Open in IMG/M |
| 3300001545|JGI12630J15595_10017599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1522 | Open in IMG/M |
| 3300001593|JGI12635J15846_10051228 | All Organisms → cellular organisms → Bacteria | 3147 | Open in IMG/M |
| 3300001593|JGI12635J15846_10417938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300001593|JGI12635J15846_10541227 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300004092|Ga0062389_100423119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1458 | Open in IMG/M |
| 3300005445|Ga0070708_100049245 | All Organisms → cellular organisms → Bacteria | 3727 | Open in IMG/M |
| 3300005536|Ga0070697_101460617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 611 | Open in IMG/M |
| 3300005542|Ga0070732_10729665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 603 | Open in IMG/M |
| 3300005586|Ga0066691_10761489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 572 | Open in IMG/M |
| 3300005610|Ga0070763_10757772 | Not Available | 572 | Open in IMG/M |
| 3300005712|Ga0070764_10574224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 685 | Open in IMG/M |
| 3300006176|Ga0070765_100473183 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300006176|Ga0070765_100542683 | Not Available | 1094 | Open in IMG/M |
| 3300006176|Ga0070765_102160606 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006800|Ga0066660_10365609 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300006893|Ga0073928_10185301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300007258|Ga0099793_10135561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1160 | Open in IMG/M |
| 3300007258|Ga0099793_10224348 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300009038|Ga0099829_10134292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1961 | Open in IMG/M |
| 3300009088|Ga0099830_10172184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1679 | Open in IMG/M |
| 3300009137|Ga0066709_101287707 | Not Available | 1073 | Open in IMG/M |
| 3300010159|Ga0099796_10392906 | Not Available | 607 | Open in IMG/M |
| 3300010379|Ga0136449_101237174 | Not Available | 1171 | Open in IMG/M |
| 3300010876|Ga0126361_11187444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 511 | Open in IMG/M |
| 3300011269|Ga0137392_10201277 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300011269|Ga0137392_10438651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1084 | Open in IMG/M |
| 3300011271|Ga0137393_10339622 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300011271|Ga0137393_10354923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1253 | Open in IMG/M |
| 3300011271|Ga0137393_10933386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Hapalosiphonaceae → Fischerella → Fischerella thermalis | 740 | Open in IMG/M |
| 3300011271|Ga0137393_11800550 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012096|Ga0137389_11163784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012096|Ga0137389_11330429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300012169|Ga0153990_1145216 | Not Available | 529 | Open in IMG/M |
| 3300012189|Ga0137388_10041846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3657 | Open in IMG/M |
| 3300012189|Ga0137388_10586946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300012189|Ga0137388_10759860 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300012189|Ga0137388_10893468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300012203|Ga0137399_11245354 | Not Available | 626 | Open in IMG/M |
| 3300012203|Ga0137399_11654255 | Not Available | 528 | Open in IMG/M |
| 3300012205|Ga0137362_10565705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300012205|Ga0137362_10717047 | Not Available | 859 | Open in IMG/M |
| 3300012205|Ga0137362_10930460 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012205|Ga0137362_11599994 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012206|Ga0137380_11015027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300012209|Ga0137379_10294901 | Not Available | 1532 | Open in IMG/M |
| 3300012350|Ga0137372_10254407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1380 | Open in IMG/M |
| 3300012350|Ga0137372_10436725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 984 | Open in IMG/M |
| 3300012354|Ga0137366_10372837 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300012359|Ga0137385_10871330 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012361|Ga0137360_10054152 | All Organisms → cellular organisms → Bacteria | 2904 | Open in IMG/M |
| 3300012361|Ga0137360_10682737 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300012361|Ga0137360_10757216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. S8 | 835 | Open in IMG/M |
| 3300012362|Ga0137361_10984636 | Not Available | 762 | Open in IMG/M |
| 3300012362|Ga0137361_11104419 | Not Available | 714 | Open in IMG/M |
| 3300012363|Ga0137390_10618265 | Not Available | 1050 | Open in IMG/M |
| 3300012683|Ga0137398_10715547 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300012917|Ga0137395_10141791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1638 | Open in IMG/M |
| 3300012917|Ga0137395_10786578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300012917|Ga0137395_11009717 | Not Available | 595 | Open in IMG/M |
| 3300012923|Ga0137359_10685955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300012923|Ga0137359_11099048 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012925|Ga0137419_10336595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 1164 | Open in IMG/M |
| 3300012927|Ga0137416_11302753 | Not Available | 656 | Open in IMG/M |
| 3300012927|Ga0137416_12128727 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012929|Ga0137404_10901866 | Not Available | 806 | Open in IMG/M |
| 3300012930|Ga0137407_10182439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1873 | Open in IMG/M |
| 3300012930|Ga0137407_10556147 | Not Available | 1074 | Open in IMG/M |
| 3300012930|Ga0137407_11043845 | Not Available | 774 | Open in IMG/M |
| 3300012930|Ga0137407_11064113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300012930|Ga0137407_11322436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. S8 | 685 | Open in IMG/M |
| 3300012930|Ga0137407_11641259 | Not Available | 612 | Open in IMG/M |
| 3300014158|Ga0181521_10272642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300014160|Ga0181517_10283773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300014501|Ga0182024_11421936 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300015052|Ga0137411_1258640 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300015241|Ga0137418_10231469 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300015241|Ga0137418_10307198 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300015245|Ga0137409_10165993 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300015264|Ga0137403_10350355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1364 | Open in IMG/M |
| 3300018037|Ga0187883_10656172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300018083|Ga0184628_10519526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300018431|Ga0066655_10924344 | Not Available | 598 | Open in IMG/M |
| 3300018482|Ga0066669_11974882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300019189|Ga0184585_131800 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300020022|Ga0193733_1153777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300020199|Ga0179592_10073000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1571 | Open in IMG/M |
| 3300020579|Ga0210407_10760980 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300020579|Ga0210407_11078381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300020579|Ga0210407_11220440 | Not Available | 565 | Open in IMG/M |
| 3300020583|Ga0210401_10048794 | All Organisms → cellular organisms → Bacteria | 4000 | Open in IMG/M |
| 3300020583|Ga0210401_10504648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300021168|Ga0210406_11065183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300021168|Ga0210406_11171434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300021170|Ga0210400_10137264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1962 | Open in IMG/M |
| 3300021170|Ga0210400_11212677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300021171|Ga0210405_11007831 | Not Available | 627 | Open in IMG/M |
| 3300021171|Ga0210405_11030649 | Not Available | 619 | Open in IMG/M |
| 3300021180|Ga0210396_10499327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1065 | Open in IMG/M |
| 3300021180|Ga0210396_11064002 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300021180|Ga0210396_11503363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300021181|Ga0210388_11257597 | Not Available | 626 | Open in IMG/M |
| 3300021344|Ga0193719_10066758 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Emticicia → unclassified Emticicia → Emticicia sp. BO119 | 1561 | Open in IMG/M |
| 3300021401|Ga0210393_10355854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1192 | Open in IMG/M |
| 3300021401|Ga0210393_10784996 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300021401|Ga0210393_11167467 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300021401|Ga0210393_11351010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 570 | Open in IMG/M |
| 3300021402|Ga0210385_11365522 | Not Available | 542 | Open in IMG/M |
| 3300021404|Ga0210389_10272882 | Not Available | 1324 | Open in IMG/M |
| 3300021404|Ga0210389_10368707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1128 | Open in IMG/M |
| 3300021405|Ga0210387_10979484 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300021420|Ga0210394_11074247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300021432|Ga0210384_10438728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300021432|Ga0210384_11142601 | Not Available | 683 | Open in IMG/M |
| 3300021433|Ga0210391_10343272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1171 | Open in IMG/M |
| 3300021433|Ga0210391_10473353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300021478|Ga0210402_10330910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1412 | Open in IMG/M |
| 3300021478|Ga0210402_10456225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300021479|Ga0210410_10617255 | Not Available | 962 | Open in IMG/M |
| 3300021479|Ga0210410_11586389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300022557|Ga0212123_10302011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
| 3300022557|Ga0212123_10625134 | Not Available | 675 | Open in IMG/M |
| 3300022726|Ga0242654_10401133 | Not Available | 526 | Open in IMG/M |
| 3300024330|Ga0137417_1494846 | All Organisms → cellular organisms → Bacteria | 4904 | Open in IMG/M |
| 3300025916|Ga0207663_10511639 | Not Available | 934 | Open in IMG/M |
| 3300025922|Ga0207646_10605456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300026467|Ga0257154_1003531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1957 | Open in IMG/M |
| 3300026480|Ga0257177_1044223 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300026499|Ga0257181_1017763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300026507|Ga0257165_1003120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2225 | Open in IMG/M |
| 3300026532|Ga0209160_1157078 | Not Available | 1025 | Open in IMG/M |
| 3300026551|Ga0209648_10602509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300026555|Ga0179593_1218733 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
| 3300027334|Ga0209529_1001817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPHIGHO2_01_FULL_67_28 | 3078 | Open in IMG/M |
| 3300027521|Ga0209524_1018510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1434 | Open in IMG/M |
| 3300027567|Ga0209115_1053396 | Not Available | 921 | Open in IMG/M |
| 3300027591|Ga0209733_1146337 | Not Available | 576 | Open in IMG/M |
| 3300027651|Ga0209217_1075645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300027660|Ga0209736_1014345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2500 | Open in IMG/M |
| 3300027667|Ga0209009_1026090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1431 | Open in IMG/M |
| 3300027671|Ga0209588_1260617 | Not Available | 528 | Open in IMG/M |
| 3300027674|Ga0209118_1184664 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027846|Ga0209180_10002071 | All Organisms → cellular organisms → Bacteria | 10010 | Open in IMG/M |
| 3300027853|Ga0209274_10715476 | Not Available | 516 | Open in IMG/M |
| 3300027857|Ga0209166_10268700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
| 3300027869|Ga0209579_10381316 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300027889|Ga0209380_10725821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300028047|Ga0209526_10447394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300028536|Ga0137415_10002633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17829 | Open in IMG/M |
| 3300028536|Ga0137415_10124580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2422 | Open in IMG/M |
| 3300028906|Ga0308309_10340936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1276 | Open in IMG/M |
| 3300028906|Ga0308309_10758321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 843 | Open in IMG/M |
| 3300028906|Ga0308309_11200819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300029636|Ga0222749_10641504 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300029944|Ga0311352_11339536 | Not Available | 540 | Open in IMG/M |
| 3300029999|Ga0311339_10254398 | Not Available | 1929 | Open in IMG/M |
| 3300030007|Ga0311338_11136224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300031234|Ga0302325_11453227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300031446|Ga0170820_13774268 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300031474|Ga0170818_111323440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300031708|Ga0310686_104680918 | Not Available | 597 | Open in IMG/M |
| 3300031708|Ga0310686_106150516 | All Organisms → cellular organisms → Bacteria | 5664 | Open in IMG/M |
| 3300031715|Ga0307476_10998248 | Not Available | 616 | Open in IMG/M |
| 3300031715|Ga0307476_11360251 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031720|Ga0307469_11088950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300031754|Ga0307475_10254314 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300031820|Ga0307473_10771716 | Not Available | 683 | Open in IMG/M |
| 3300031823|Ga0307478_11040543 | Not Available | 684 | Open in IMG/M |
| 3300031962|Ga0307479_10783428 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300031962|Ga0307479_11080888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300032174|Ga0307470_10995319 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300032180|Ga0307471_102528916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300032783|Ga0335079_10909818 | Not Available | 903 | Open in IMG/M |
| 3300032896|Ga0335075_10014724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11729 | Open in IMG/M |
| 3300032897|Ga0335071_10001447 | All Organisms → cellular organisms → Bacteria | 25614 | Open in IMG/M |
| 3300032954|Ga0335083_10071787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3531 | Open in IMG/M |
| 3300033134|Ga0335073_11764489 | Not Available | 580 | Open in IMG/M |
| 3300034195|Ga0370501_0272686 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.25% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.56% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.56% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.56% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.56% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.56% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019189 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12712J15308_101227731 | 3300001471 | Forest Soil | MEQAQINPRPVVGAIIVVSGLAVSFLLWLLYVHHASADFAGRWM |
| JGI12630J15595_100175991 | 3300001545 | Forest Soil | MEFCDLIVSMEQAEISPRPVVGAIVAVSGLAVSFLLWLLYVHHASADFAG |
| JGI12635J15846_100512281 | 3300001593 | Forest Soil | MDFCDLIVGMEQTGISPRPVVGAIIVVSGLAVSFLLWLLYVHHASADF |
| JGI12635J15846_104179381 | 3300001593 | Forest Soil | VTPSVDFCDLIVCMEQAEISPRPVVGAIVVVSGLAVS |
| JGI12635J15846_105412272 | 3300001593 | Forest Soil | MDFCDLIVSMEQAEISSRPVVGAIVVVSGLAVSFL |
| Ga0062389_1004231192 | 3300004092 | Bog Forest Soil | MEQAEISPRPVVGAIIVVSGLAVSFLLWVLYVHRALAGFAGRWMFLPPVRTNNSV* |
| Ga0070708_1000492451 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFCDLIVGMEQAQINPRPIVGAIVVVSGVAVSFLLWLVYLHHASADFAGRWMFLP |
| Ga0070697_1014606171 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFCDLIVDVQQAQISPRPVVGAIIVVSGVAVSFLLWLLYVHHASADF |
| Ga0070732_107296651 | 3300005542 | Surface Soil | MQQAENQAAVSPRPVVAAIVAVSGLAVSFLLWLVYVHRASAD |
| Ga0066691_107614891 | 3300005586 | Soil | MSFCDLIVSMEQTEINPRPVVGAIIVVSGLAVSFLLWLLYVHHAS |
| Ga0070763_107577721 | 3300005610 | Soil | MNVCDLIASMEQAEISPRPVIGVIIVVSGIAVSFLL |
| Ga0070764_105742242 | 3300005712 | Soil | MEQTQVGTRPVVGGIVVVSGLAVSFLLWLVYVHHASADFAG |
| Ga0070765_1004731831 | 3300006176 | Soil | MDSCDLIVSMEQAEISPRPVVGAIVVVSGLAVSFLLWL |
| Ga0070765_1005426833 | 3300006176 | Soil | MDFCDLIVSMEQAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHA |
| Ga0070765_1021606062 | 3300006176 | Soil | MDVCALIVSMEQAEVRPRPVVGAIIVVSGLAVSFLLWLLYVHHPSADFAGRWMFL |
| Ga0066660_103656092 | 3300006800 | Soil | MQQTEISPRPVVGTIIVVSGLAVSFLLWLLYVHHASA |
| Ga0073928_101853011 | 3300006893 | Iron-Sulfur Acid Spring | MDSCDLIVSMEHAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHA |
| Ga0099793_101355611 | 3300007258 | Vadose Zone Soil | MDFYDLIVSMEQAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHAS |
| Ga0099793_102243481 | 3300007258 | Vadose Zone Soil | MTSRLDFCDLIVGMEQTGINPRPVVGAIIVVSGLAVSFLLWLLYVHHASADFA |
| Ga0099829_101342924 | 3300009038 | Vadose Zone Soil | MEQTGISPRPVVGAIIVASGLAVSFLLWLLYVHHASSDFAGR |
| Ga0099830_101721841 | 3300009088 | Vadose Zone Soil | MDFCDLIVSMEQTEISPRPVVGAIVVLSGLAVSFLLWL |
| Ga0066709_1012877071 | 3300009137 | Grasslands Soil | MDFCDLIVSVEQAQISPRPVVGAIIVVSGVAVSFLLWLLYVHHASADFTVRWM |
| Ga0099796_103929061 | 3300010159 | Vadose Zone Soil | MDFCALIVSMEQAEISPRPVVGAIVVVSGLAVSFLLWL |
| Ga0136449_1012371743 | 3300010379 | Peatlands Soil | VYFYDLIVAMEQPGIAQRPLVGTIIVVSGLAVSFLLWLLYVHHA |
| Ga0126361_111874442 | 3300010876 | Boreal Forest Soil | FCDLIVSMEPGEISPRPLVGAIIGVSGLAVSFLLWLL* |
| Ga0137392_102012773 | 3300011269 | Vadose Zone Soil | MQPAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASSDF |
| Ga0137392_104386511 | 3300011269 | Vadose Zone Soil | MEQAEIGSRPVVGAIIVASGLAVSFLLWLLYVHHASADF |
| Ga0137393_103396221 | 3300011271 | Vadose Zone Soil | MEQTGISPRPVVGAIIVASGLAVSFLLWLLYVHHASSDFAGRW |
| Ga0137393_103549233 | 3300011271 | Vadose Zone Soil | MGFCDLIVGMEQTGISPRPVVGAIILVSGLAVSFLLWLLYVH |
| Ga0137393_109333862 | 3300011271 | Vadose Zone Soil | MVSVEHAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHAS |
| Ga0137393_118005502 | 3300011271 | Vadose Zone Soil | MEFYDLIVGVEQAETSPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAQ |
| Ga0137389_111637841 | 3300012096 | Vadose Zone Soil | MEQAGISRRPVVGAIAVVSGLAVSFLLWLLYVHHASADFVGRWMF |
| Ga0137389_113304292 | 3300012096 | Vadose Zone Soil | MEQAEISPRPVVGAIVVVSGVAVSFLLWLLYVHHASADFAGRWM |
| Ga0153990_11452161 | 3300012169 | Attine Ant Fungus Gardens | MEQAGISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAGRWMF |
| Ga0137388_100418461 | 3300012189 | Vadose Zone Soil | MDFCDLIVSMEQTEISPRPVVGAIVVLSGLAVSFLLWLLYVHHASADF |
| Ga0137388_105869461 | 3300012189 | Vadose Zone Soil | MEQAEISPRPVVGAIVVVSGVAVSFLLWLLYVHHASADFAGRWMF |
| Ga0137388_107598601 | 3300012189 | Vadose Zone Soil | MEQTGISPRPVVGAIIVACGLAVSFLLWLLYVHHASSDFAGRWM |
| Ga0137388_108934682 | 3300012189 | Vadose Zone Soil | VDFCDLIVGMEQTGISPRPVVGAIIVVSGLAVSFLLWLLYVHHASSDFAGRWMFL |
| Ga0137399_112453541 | 3300012203 | Vadose Zone Soil | MDFCDLIVGMEQTGINPRPVVGAIIVVSGLAVSFLLWLLYVHHA |
| Ga0137399_116542552 | 3300012203 | Vadose Zone Soil | MEQAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASAD |
| Ga0137362_105657051 | 3300012205 | Vadose Zone Soil | MEFCDLMVGMEQTEINPRPVVGAIIVVSGLAVSFLLWL |
| Ga0137362_107170471 | 3300012205 | Vadose Zone Soil | MGFCDLMASMEQAEVSPGPVVGAIVVVSGLAVSFMLWLLYVHHASADFAGRWM |
| Ga0137362_109304602 | 3300012205 | Vadose Zone Soil | MEFYDLIVGMEQAETSPRPVVGAIVVVSGLAVSFLLWLLY |
| Ga0137362_115999941 | 3300012205 | Vadose Zone Soil | MEFYDLIVGVEQAETSPRPVVGAIVVVSGLAVSFLLWLLYVHHASADF |
| Ga0137380_110150272 | 3300012206 | Vadose Zone Soil | MGFCDLIVTMEQAHISPRPVVGAIVVVSGLAVSFLLWLLYVHHASSDFAGRWMFL |
| Ga0137379_102949012 | 3300012209 | Vadose Zone Soil | MMEQAEISPRPVVGAIVAVSGLAVSFLLWLLYVHHASADFAG |
| Ga0137372_102544071 | 3300012350 | Vadose Zone Soil | MNICDLIVDVEQAQISPRPVVGAIVVASGVAVSFLLWLLYVHHA |
| Ga0137372_104367251 | 3300012350 | Vadose Zone Soil | MMEQAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAGRWM |
| Ga0137366_103728371 | 3300012354 | Vadose Zone Soil | MEPAEISPRSVVGAIVVVSGLAVSFLLWLLYVHHASADFAGRWM |
| Ga0137385_108713301 | 3300012359 | Vadose Zone Soil | MNSCVLIVSMDPVDSSPRPAVGAIVVVSGLAVSFLLWLLYVHHASTDFAGRWM |
| Ga0137360_100541521 | 3300012361 | Vadose Zone Soil | MEFCDLMVSMEQTEINPRPVVGAIIVVSGLAVSFLLWLLYVHHA |
| Ga0137360_106827371 | 3300012361 | Vadose Zone Soil | MDFCALIVSMEQAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFA |
| Ga0137360_107572161 | 3300012361 | Vadose Zone Soil | MDLCDLIVPMEQVETRSGPVVGAIVVVSSLAVSFLLWLLYVHRASADFA |
| Ga0137361_109846361 | 3300012362 | Vadose Zone Soil | MQQTEINPRPVVGAIIVVSGLAVSFLLWLLYVHHASSD |
| Ga0137361_111044192 | 3300012362 | Vadose Zone Soil | MDFCDLIVSMEQAEISPRPVVGAIVVVSGLAVSFLLWLLYV |
| Ga0137390_106182651 | 3300012363 | Vadose Zone Soil | MDFCDLIVSMVQAEISPRPVVGAIVVLSGLAVSFL |
| Ga0137398_107155472 | 3300012683 | Vadose Zone Soil | MNSCVLIISMDQVETSPRPAVGAIVVVSGLAVSFLLWLLYVHHASTDFA |
| Ga0137395_101417911 | 3300012917 | Vadose Zone Soil | MDFCDLIVSMEQGEISPRPVVGAIVVASGLAVSFLLWLLYVHHASADFA |
| Ga0137395_107865782 | 3300012917 | Vadose Zone Soil | MGFCDLIVTMEQAHISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADF |
| Ga0137395_110097171 | 3300012917 | Vadose Zone Soil | MNIYDLIVSMEEAEFSPRPVVGAIVVVSGLAVSFLLWLLYGHHASADFAGRWMFL |
| Ga0137359_106859551 | 3300012923 | Vadose Zone Soil | MTSEWDSCDLMVGMEQAEFSPRPVIGAIVVVSGLAVSFLLWLLYVHHASTDFAGRW |
| Ga0137359_110990482 | 3300012923 | Vadose Zone Soil | MDFCDLIVSMEQAEISPRPVVGAIVMASGLAVSFLLWLLYVHHASADFVGRWMFLP |
| Ga0137419_103365952 | 3300012925 | Vadose Zone Soil | MEQAEISSRPVVGAIIVVSGLAISFLLWLLYVHHA |
| Ga0137416_113027531 | 3300012927 | Vadose Zone Soil | MDFCDLMVRMEQAEISPRPAVGAIIVVSGLAVSFLLWL |
| Ga0137416_121287271 | 3300012927 | Vadose Zone Soil | MGFCDLIVSMEQTEINPRPVVGAIIVVSGLAVSFLLWLLYVHHA |
| Ga0137404_109018663 | 3300012929 | Vadose Zone Soil | MDVCDLIVLMEQAEISPRSVVGAILVVSGFAVSFLLWLLYVHHASADFAGRWM |
| Ga0137407_101824394 | 3300012930 | Vadose Zone Soil | MNFCDLIVSVEQAQTSPRPVVGAIVVVSAVAVSFLLWLLYVHHASA |
| Ga0137407_105561471 | 3300012930 | Vadose Zone Soil | MNICDLIVDVEQAQISPRPVVGAIVVASGVAVSFLLWLLYVHHASA |
| Ga0137407_110438451 | 3300012930 | Vadose Zone Soil | MEQAEISPRPVVGAIVVVSGVAVSFLLWLLYVHHASADFTGRWM |
| Ga0137407_110641131 | 3300012930 | Vadose Zone Soil | MERAEIHPRPVIGAIIVTSSLAVSFLLWLLYVHHASA |
| Ga0137407_113224361 | 3300012930 | Vadose Zone Soil | MDLCDLIVLMEQAETSPGPVVGAIVVVSGLAVSFLLWL |
| Ga0137407_116412592 | 3300012930 | Vadose Zone Soil | MDFCDLIVSMERSEIHPRPVIGAIIVTSSLAVSFLLWLLYVHRASA |
| Ga0181521_102726421 | 3300014158 | Bog | MDLCDLIVSMEQAEISPRSVVGAIVVVSGLAVSFLLWLLYVHHASADFAG |
| Ga0181517_102837732 | 3300014160 | Bog | VVFCDLIAGMEQAEINPRPVIRAIVVVSGLAVSFLLWLLYIHRPSANFVGRWMF |
| Ga0182024_114219362 | 3300014501 | Permafrost | MFCDLIVSMEQAEISPRTVIRAIVVASGLAVSFLLWL |
| Ga0137411_12586402 | 3300015052 | Vadose Zone Soil | MEQAEISTRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAG |
| Ga0137418_102314692 | 3300015241 | Vadose Zone Soil | MDFCDLIVGMEQTGINPRPVVGAIIVVSGLAVSFLLWLLYVHH |
| Ga0137418_103071983 | 3300015241 | Vadose Zone Soil | MEQAEISPRPVIGAIVVVSGVAVSFLLWLLYVHHASADFAGRWMF |
| Ga0137409_101659931 | 3300015245 | Vadose Zone Soil | MDFCDLMVSMEQTEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAGRWMFL |
| Ga0137403_103503553 | 3300015264 | Vadose Zone Soil | MEQAEITPRPVIGAIIVASGLAVSFLLWLLYVHHASPDFVGR |
| Ga0187883_106561722 | 3300018037 | Peatland | MEQAEISPRPVLGVIIVVSGLAASFLLWLLYVHRPSPDFAGRWMFLP |
| Ga0184628_105195261 | 3300018083 | Groundwater Sediment | MEQAEVSSRPAIGAIVVVSGLAVAFLLWLVYVHPVPDDFVGRW |
| Ga0066655_109243441 | 3300018431 | Grasslands Soil | MEQAETSPRAVVAAIIEVSGLAISFLLWLLYVHHASADFAGRWMF |
| Ga0066669_119748821 | 3300018482 | Grasslands Soil | MEQTEISSRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAGRWMF |
| Ga0184585_1318001 | 3300019189 | Soil | MEQAAIRPRPAVGAIVVVSGLAVSFLLWLLYVHRAPAD |
| Ga0193733_11537771 | 3300020022 | Soil | MEQAEISSRPVVGAIVVVSGLAVSFLLWLLYVHHASAD |
| Ga0179592_100730001 | 3300020199 | Vadose Zone Soil | MLPLYGFRMDSCDLIVSMEQAEISPRPVVGAIVLVSGLAVSFLLWLL |
| Ga0210407_107609802 | 3300020579 | Soil | MEQAEISSRPVIGAIVVVSGLAVSFLLWLLYVHHASADFAGRWM |
| Ga0210407_110783812 | 3300020579 | Soil | MAMEQAQLSPRPVVGTIVVVSGLAVTFLLWLLYVHHASATFAGRWM |
| Ga0210407_112204401 | 3300020579 | Soil | MEQAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFA |
| Ga0210401_100487946 | 3300020583 | Soil | MEQAQINPRPVVGTIIVVSGLAVSFLLWLLYVHHA |
| Ga0210401_105046482 | 3300020583 | Soil | MDFYDLIVRMEQAEFSSRPVVGAIVVVSGLAVSFLLWLLYVHHAS |
| Ga0210406_110651831 | 3300021168 | Soil | MEQAQINPRSVVGTIIVVSGLAVSFLLWLLYVHHASADFAGRWM |
| Ga0210406_111714341 | 3300021168 | Soil | VGVEQAGINPRPVVGAIIVVSGLAISFLLWLLYVHHASP |
| Ga0210400_101372641 | 3300021170 | Soil | MEQAQISPRPVVGAIVVVSGLAVSFLLWLLYVHHASAD |
| Ga0210400_112126771 | 3300021170 | Soil | MSELRRDLDKDFFDLIVSMEQAQINPRPVVGTIVVVSGLAVSFLLWLLYVHHA |
| Ga0210405_110078312 | 3300021171 | Soil | MEQAGISPRPVVGAIILVSGLAVSFLLWLLYVHHASADFTG |
| Ga0210405_110306493 | 3300021171 | Soil | MEQAAITPRPAIGAIIVVSGLAVSFLLWLLYVHHAP |
| Ga0210396_104993273 | 3300021180 | Soil | MDLCGLIGSMQQAQTSPRPVVGAIVVVSGLAVAFLLWLLYVHH |
| Ga0210396_110640022 | 3300021180 | Soil | MEQAAISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAGR |
| Ga0210396_115033632 | 3300021180 | Soil | MEQAQINPRPVVGTIIVVSGLAVSFLLWLLYVHHASAAFAGRWLFL |
| Ga0210388_112575972 | 3300021181 | Soil | MERVEIGARPAVGAIVVVSGLAVSFLLWLLYVHHASAGFVGRFTFLP |
| Ga0193719_100667581 | 3300021344 | Soil | MDFCDLIVIMQQADISPRPVVGAIVVVSGLAVSFLLWL |
| Ga0210393_103558543 | 3300021401 | Soil | MDSCDLIVSMEQAEISPRPVVGAIVVVSGLAVSFLLWLLYLHHASAD |
| Ga0210393_107849962 | 3300021401 | Soil | MEQAAISPRPVVGAIVVVSGLAVSFLLWLLYVHHASA |
| Ga0210393_111674672 | 3300021401 | Soil | MDFCDLIVSMEQAEISPRPVVGAIVVVSGLAVSFLLWL |
| Ga0210393_113510101 | 3300021401 | Soil | MDFCDLIVSMEQAEISPRPVVGAIVVVSGLAVSFLL |
| Ga0210385_113655221 | 3300021402 | Soil | MEQTQVGTRPVVGGIVMVSGLAVTFLLWLVYVHHASADFAGRWMFF |
| Ga0210389_102728821 | 3300021404 | Soil | MHDSEISPRPAIGLLVVLSGLAVSFLLWLLYVHHASADFAGRWMF |
| Ga0210389_103687071 | 3300021404 | Soil | MDLCGLIGSMQQAQTSPRPVVGAIVVVSGLAVAFLLWLLYVHHASTDF |
| Ga0210387_109794842 | 3300021405 | Soil | MERVEIGARPAVGAIIAISGLAVSFLLWLLYLHHAS |
| Ga0210394_110742472 | 3300021420 | Soil | MEQAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAGR |
| Ga0210384_104387283 | 3300021432 | Soil | MEQAQINPRPVVGAIIAISGFAVSFLLWLLYIHHA |
| Ga0210384_111426011 | 3300021432 | Soil | MDFCDLIVWMQQAEFSPRPVVGAIIVVSGLAVSFLLW |
| Ga0210391_103432722 | 3300021433 | Soil | MDVCALIVSMEQAEVRPRPVVGAIIVVSGLAVSFLLWLLYVHHPS |
| Ga0210391_104733532 | 3300021433 | Soil | VVFCDLIAGMEQAEINPRPVIRAIVVVSGLAVSFLLWL |
| Ga0210402_103309101 | 3300021478 | Soil | MLSMEQAETSPRPVVGAIVVVSGLAVSFLLWLLYVHHASGNFA |
| Ga0210402_104562252 | 3300021478 | Soil | MDFYDLIVGMEQTGVSLRPVVGAIIVASGLAVSFLLWL |
| Ga0210410_106172552 | 3300021479 | Soil | MVSMEQAEIRTRPVVGAIVVVSCLAVSFLRWLLYVHHASADFAGRWM |
| Ga0210410_115863892 | 3300021479 | Soil | MDFCDLIVSMEQAEFSPRPVVGAIVVVSGLAVSFL |
| Ga0212123_103020111 | 3300022557 | Iron-Sulfur Acid Spring | MEQTGINPRPVVGAIIVVSGLAVSFLLWLLYVHHASSDFAGRWM |
| Ga0212123_106251341 | 3300022557 | Iron-Sulfur Acid Spring | MDICDLIGSMEQAGISPRPVVGAIVVVSGLAVAFLLWLLYVHHASADFAGRW |
| Ga0242654_104011331 | 3300022726 | Soil | MDFYDLIVGMEQTGISPRPVVGAIIVVSGLAVSFL |
| Ga0137417_14948463 | 3300024330 | Vadose Zone Soil | MDFCDLIISMERTEISRRPVVGAIVVVSGVAVSFLLWLLYVHHASADFAGRWMFFGRPSTRF |
| Ga0207663_105116392 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MEQTDNHPRTVIGAIIVVSGLAVSFLLWLLYVRHASADFAGRW |
| Ga0207646_106054563 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDFYDLIVGMEQTRISPRPVVGAIIVVSGLAVSFLLWLLYVHHASSDF |
| Ga0257154_10035314 | 3300026467 | Soil | MFCDLIVSMEQTEISARPVIGAIVVASGLAVSFLLWLLY |
| Ga0257177_10442231 | 3300026480 | Soil | MQPAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHA |
| Ga0257181_10177632 | 3300026499 | Soil | MEQAEIGSRPVVGAIVVASGLAVSFLLWLLYVHHASADFAGRW |
| Ga0257165_10031201 | 3300026507 | Soil | MEQAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASSDFTGRWMF |
| Ga0209160_11570781 | 3300026532 | Soil | MDFCDLIVSVEQAQISPRPVVGAIIVVSGVAVSFLLWLLYVHHASADFTGRWM |
| Ga0209648_106025091 | 3300026551 | Grasslands Soil | MDFCDLIVSMEQAEISSRPVVGAIVVVSGLAVSFLLWLLYVHHASADYAG |
| Ga0179593_12187332 | 3300026555 | Vadose Zone Soil | MEQAEISPRPVVGAIIVVSGLAVSFLLWLLYVHHASADFTGRWMFCRP |
| Ga0209529_10018175 | 3300027334 | Forest Soil | MEQVGISPRPVVGAIIVVSGLAVSFLLWLLYVHHASADFAGR |
| Ga0209524_10185101 | 3300027521 | Forest Soil | MDFRDLIVGMQQAEISPRPVIGTIVVVSGLAVSFLLW |
| Ga0209115_10533961 | 3300027567 | Forest Soil | MDFCDLIVSMGQAEIRPRPVVGAILVVSGLAVSFLLWLLYVHHASADFAGRWMF |
| Ga0209733_11463372 | 3300027591 | Forest Soil | MEHAGINPRPVVGAIIVVSGLAVSFLLWLLYVHHASADFAGR |
| Ga0209217_10756452 | 3300027651 | Forest Soil | MDFYDLIVRMEQADFSPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAGRWMFL |
| Ga0209736_10143451 | 3300027660 | Forest Soil | MDFCDLIVGMEQTGISPRPVVGAIIVVSGLAVSFLLWLLYVHHAS |
| Ga0209009_10260903 | 3300027667 | Forest Soil | MEQAEISPRPVVGAIVVASGLAVSFLLWLLYVHHASADFAGR |
| Ga0209588_12606171 | 3300027671 | Vadose Zone Soil | MDFCDLIISMEQAQISPRPVRPVIGAIVVVSGLAVTFLLWLLYIH |
| Ga0209118_11846641 | 3300027674 | Forest Soil | MDFCGLIVDMEQAELSPRPVVGAIVAVSGLAVSFLLWLLYVHRASADFAGR |
| Ga0209180_100020711 | 3300027846 | Vadose Zone Soil | MDFCDVIVAMEQTQISPRPIVGAIIVVSGLAVSSLLWLLYVHHAS |
| Ga0209274_107154761 | 3300027853 | Soil | MDSCDLIVNMEQAAISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAGRW |
| Ga0209166_102687001 | 3300027857 | Surface Soil | MEQVEISPRPVIGAIVVVSGLAVSFLLWLLYLHHASADFAGRWM |
| Ga0209579_103813161 | 3300027869 | Surface Soil | MEQAAINPRPVVGAIVVVSGLAVSFLLWLLYVHHAPAD |
| Ga0209380_107258211 | 3300027889 | Soil | MDFCVLIVSMEQAEIRPRPVVGAIIVVSGLAVSFLLWLLYVHHPSA |
| Ga0209526_104473942 | 3300028047 | Forest Soil | MNFCDLIVSMEQSEISPRPVVGAIVVVSGLAVSFLLWL |
| Ga0137415_100026331 | 3300028536 | Vadose Zone Soil | MMEQAEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFTGRWMF |
| Ga0137415_101245801 | 3300028536 | Vadose Zone Soil | MEQTEISPRPVVGAIVVVSGLAVSFLLWLLYVHHASADFNGRW |
| Ga0308309_103409364 | 3300028906 | Soil | MDVCALIVSMEQAEVRPRPVVGAIIVVSGLAVSFLLWLLYVHHPSADFAG |
| Ga0308309_107583211 | 3300028906 | Soil | MQQAGISPRPVVGAIIVVSGLAVSFLLWLLYVHHAS |
| Ga0308309_112008192 | 3300028906 | Soil | MDFCVLIVSMEQAEIRPRPVVGAIVVVSGLAVSFLLWLLYVHHPSADFAG |
| Ga0222749_106415041 | 3300029636 | Soil | MGFCDVIIRMEQAESSPRPIVGAIVVVSGLAVSFLLWLLYVHHASADFTGRWMFL |
| Ga0311352_113395361 | 3300029944 | Palsa | MGCEVAQATYFCDLIVGMQRTETSSRPVVGAIIVVSGLAVSFLLWLLYV |
| Ga0311339_102543981 | 3300029999 | Palsa | MERVEIGARPAVGAIVVVSGLAVSFLLWLLYVHHAS |
| Ga0311338_111362242 | 3300030007 | Palsa | MDFCDLIVGMEQAEIRPRPAVGAIVVVSGLAVSFLLWLLYVHHP |
| Ga0302325_114532272 | 3300031234 | Palsa | MATTEVSSRTVIGAIIVVSGLAVSFLLWLLYVHHASADFVGRWM |
| Ga0170820_137742681 | 3300031446 | Forest Soil | MEQAGTSPRPVIGAIVVVSGLAVSFLLWLLYVHHASADFARRWMFL |
| Ga0170818_1113234401 | 3300031474 | Forest Soil | MAFCDVIDGMEQAQINPRPIVGAIVVVSGVAVSFLLWLVYLHHASADFAGRWM |
| Ga0310686_1046809182 | 3300031708 | Soil | MDICDLIVNMGQAEIRPRPVVGAILVVSGLAVSFLLWLLYVHHAS |
| Ga0310686_1061505168 | 3300031708 | Soil | MEQAEFSSRPVVGAIVVVSGLAVSFLLWLLYVHHASA |
| Ga0307476_109982481 | 3300031715 | Hardwood Forest Soil | MDFCDLILGMEQAEISPRPVVGAIIVVSGLAVSFLLWLLYVHHASADFAGRWMFL |
| Ga0307476_113602512 | 3300031715 | Hardwood Forest Soil | MEQVQISPRPIVGAIIVVSGLAVSFLLWLVYVHHASADFAGR |
| Ga0307469_110889503 | 3300031720 | Hardwood Forest Soil | MEHAGISPRPVVGAIVVVSGLAVSFLFWLLYVHHASADF |
| Ga0307475_102543141 | 3300031754 | Hardwood Forest Soil | MDFCDLIIGMEQAEISPRPAVGAIVVVSGLAVSFLLWLLYVHHAS |
| Ga0307473_107717161 | 3300031820 | Hardwood Forest Soil | MDFYDLIVGMEQTGISPRPVVGAIIVVSGLAVSFLLWLLYVHHASSDFA |
| Ga0307478_110405432 | 3300031823 | Hardwood Forest Soil | LDFCDLIVSMERAQINARPIVGAIIVVSGVAVSFL |
| Ga0307479_107834281 | 3300031962 | Hardwood Forest Soil | MYFYDLIVSMEQTGISPRPVIGAIIVVSGLAVSFLLWLLFVH |
| Ga0307479_110808881 | 3300031962 | Hardwood Forest Soil | MEQAQIGPRPVISAIVVVSGLAVSFLLWLLYIHRASADF |
| Ga0307470_109953191 | 3300032174 | Hardwood Forest Soil | MEQAELRPRPVIGAIVVVSGLAVSFLLWLLYVHHAPADF |
| Ga0307471_1025289162 | 3300032180 | Hardwood Forest Soil | MAFCDVIVGVEQAQINPRPIVGAIVVVSGVAVSFLLWLVYLHHASADFAGR |
| Ga0335079_109098182 | 3300032783 | Soil | MLSMEQAEIRTRPVVGAIVVVSGLAVSFLLWLLYVHHASA |
| Ga0335075_100147241 | 3300032896 | Soil | MEQTQIGTRPTVGGIIVVSGLAVSFLLWLVYVHHASADF |
| Ga0335071_100014471 | 3300032897 | Soil | MEQAEIRTRPVVGAIVVVSGLAISFLLWLLYVHHAS |
| Ga0335083_100717875 | 3300032954 | Soil | MEQAEIRTRPVVGAIVVVSGLAVSFLLWLLYVHHASADFAGR |
| Ga0335073_117644892 | 3300033134 | Soil | VDFHALIVDMEQAGIRPRPAVGAIIVISGLAVSFLLWLIYIHHA |
| Ga0370501_0272686_497_604 | 3300034195 | Untreated Peat Soil | MDQAEIRTRPVVGAIVGVSGLAVSFLLWLLYVHHAS |
| ⦗Top⦘ |