Basic Information | |
---|---|
Family ID | F033037 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 178 |
Average Sequence Length | 46 residues |
Representative Sequence | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYK |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 178 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 92.70 % |
% of genes near scaffold ends (potentially truncated) | 99.44 % |
% of genes from short scaffolds (< 2000 bps) | 93.82 % |
Associated GOLD sequencing projects | 123 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (58.427 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (14.607 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.191 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.247 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 178 Family Scaffolds |
---|---|---|
PF14025 | DUF4241 | 1.69 |
PF06067 | DUF932 | 1.69 |
PF13087 | AAA_12 | 0.56 |
PF02467 | Whib | 0.56 |
PF01816 | LRV | 0.56 |
PF04472 | SepF | 0.56 |
PF03029 | ATP_bind_1 | 0.56 |
COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
---|---|---|---|
COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 0.56 |
COG1799 | Cell division protein SepF/YlmF, interacts with FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.56 |
COG2229 | Signal recognition particle receptor subunit beta, a GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.84 % |
Unclassified | root | N/A | 24.16 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001272|B570J13886_106881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300002161|JGI24766J26685_10032192 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
3300002161|JGI24766J26685_10104810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300002277|B570J29592_104056 | Not Available | 681 | Open in IMG/M |
3300003413|JGI25922J50271_10060340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
3300003413|JGI25922J50271_10094599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300003488|JGI25919J51413_1018585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300003490|JGI25926J51410_1045233 | Not Available | 776 | Open in IMG/M |
3300003493|JGI25923J51411_1072053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300003493|JGI25923J51411_1081279 | Not Available | 553 | Open in IMG/M |
3300004112|Ga0065166_10258523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300004240|Ga0007787_10417364 | Not Available | 669 | Open in IMG/M |
3300004771|Ga0007797_1030753 | Not Available | 1473 | Open in IMG/M |
3300004797|Ga0007764_11585447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300005517|Ga0070374_10353009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
3300005527|Ga0068876_10597404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300005581|Ga0049081_10204666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300005581|Ga0049081_10298549 | Not Available | 555 | Open in IMG/M |
3300005582|Ga0049080_10241251 | Not Available | 591 | Open in IMG/M |
3300005583|Ga0049085_10179090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300005662|Ga0078894_10709034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
3300005941|Ga0070743_10089034 | Not Available | 1040 | Open in IMG/M |
3300005941|Ga0070743_10259596 | Not Available | 563 | Open in IMG/M |
3300006484|Ga0070744_10016888 | All Organisms → Viruses → Predicted Viral | 2167 | Open in IMG/M |
3300006805|Ga0075464_10359781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300006875|Ga0075473_10292900 | Not Available | 658 | Open in IMG/M |
3300007547|Ga0102875_1106139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300007552|Ga0102818_1098208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300007559|Ga0102828_1169862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300007620|Ga0102871_1161537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300007639|Ga0102865_1085113 | Not Available | 944 | Open in IMG/M |
3300007649|Ga0102912_1140598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300007708|Ga0102859_1161828 | Not Available | 659 | Open in IMG/M |
3300007954|Ga0105739_1069941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300007974|Ga0105747_1035836 | All Organisms → Viruses → Predicted Viral | 1421 | Open in IMG/M |
3300008021|Ga0102922_1108805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300008107|Ga0114340_1072636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2264 | Open in IMG/M |
3300008107|Ga0114340_1163163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300008107|Ga0114340_1191147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300008107|Ga0114340_1236887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300008108|Ga0114341_10456067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300008110|Ga0114343_1124581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
3300008110|Ga0114343_1135829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300008113|Ga0114346_1133266 | All Organisms → Viruses → Predicted Viral | 1087 | Open in IMG/M |
3300008113|Ga0114346_1234122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300008113|Ga0114346_1291834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300008113|Ga0114346_1324557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300008259|Ga0114841_1214875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300008995|Ga0102888_1126274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300009068|Ga0114973_10051021 | All Organisms → Viruses → Predicted Viral | 2442 | Open in IMG/M |
3300009068|Ga0114973_10223578 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
3300009079|Ga0102814_10544099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300009161|Ga0114966_10686778 | Not Available | 562 | Open in IMG/M |
3300009184|Ga0114976_10299858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300009184|Ga0114976_10393992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300009419|Ga0114982_1140665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300009419|Ga0114982_1192821 | Not Available | 630 | Open in IMG/M |
3300009450|Ga0127391_1062949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300010312|Ga0102883_1090771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300010354|Ga0129333_10847918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300010354|Ga0129333_11592072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300010354|Ga0129333_11610998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300010370|Ga0129336_10321616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300011268|Ga0151620_1122694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300011268|Ga0151620_1271936 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300012012|Ga0153799_1073787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300012013|Ga0153805_1020141 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
3300012017|Ga0153801_1053764 | Not Available | 708 | Open in IMG/M |
3300012666|Ga0157498_1049957 | Not Available | 641 | Open in IMG/M |
3300013005|Ga0164292_10197867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
3300013372|Ga0177922_10300700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300013372|Ga0177922_10971007 | Not Available | 682 | Open in IMG/M |
3300017701|Ga0181364_1072250 | Not Available | 528 | Open in IMG/M |
3300017785|Ga0181355_1365978 | Not Available | 527 | Open in IMG/M |
3300020159|Ga0211734_10287438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
3300020159|Ga0211734_10942900 | Not Available | 610 | Open in IMG/M |
3300020159|Ga0211734_11163448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300020160|Ga0211733_10441783 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300020162|Ga0211735_10891146 | Not Available | 723 | Open in IMG/M |
3300020172|Ga0211729_10079706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300020172|Ga0211729_10948783 | Not Available | 571 | Open in IMG/M |
3300020205|Ga0211731_10325129 | All Organisms → Viruses → Predicted Viral | 1307 | Open in IMG/M |
3300020205|Ga0211731_11372977 | All Organisms → Viruses → Predicted Viral | 3042 | Open in IMG/M |
3300020514|Ga0208202_1021728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300020524|Ga0208858_1001780 | All Organisms → Viruses → Predicted Viral | 3926 | Open in IMG/M |
3300020527|Ga0208232_1039520 | Not Available | 621 | Open in IMG/M |
3300020549|Ga0207942_1000383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11521 | Open in IMG/M |
3300020575|Ga0208053_1050919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300021519|Ga0194048_10287316 | Not Available | 594 | Open in IMG/M |
3300021962|Ga0222713_10021425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5415 | Open in IMG/M |
3300021962|Ga0222713_10510284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300023174|Ga0214921_10388690 | Not Available | 719 | Open in IMG/M |
3300023184|Ga0214919_10358037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
3300024343|Ga0244777_10602831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300024346|Ga0244775_10830591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300024487|Ga0255222_1033043 | Not Available | 769 | Open in IMG/M |
3300024507|Ga0255176_1050576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300024570|Ga0255276_1071184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300024573|Ga0256337_1164192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300024857|Ga0256339_1054829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300024857|Ga0256339_1119266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300025732|Ga0208784_1090952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
3300025732|Ga0208784_1232732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300025757|Ga0256313_1072167 | Not Available | 514 | Open in IMG/M |
3300027121|Ga0255074_1005666 | All Organisms → Viruses → Predicted Viral | 1731 | Open in IMG/M |
3300027133|Ga0255070_1076232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300027140|Ga0255080_1055026 | Not Available | 613 | Open in IMG/M |
3300027151|Ga0255063_1062593 | Not Available | 698 | Open in IMG/M |
3300027205|Ga0208926_1038883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300027206|Ga0208023_1078555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300027214|Ga0208306_1056446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300027214|Ga0208306_1074225 | Not Available | 568 | Open in IMG/M |
3300027224|Ga0208164_1087524 | Not Available | 528 | Open in IMG/M |
3300027227|Ga0208929_1051669 | Not Available | 854 | Open in IMG/M |
3300027247|Ga0208679_1056419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300027261|Ga0208933_1028832 | Not Available | 913 | Open in IMG/M |
3300027320|Ga0208923_1034837 | Not Available | 898 | Open in IMG/M |
3300027486|Ga0255086_1011822 | All Organisms → Viruses → Predicted Viral | 1772 | Open in IMG/M |
3300027488|Ga0255084_1006464 | All Organisms → Viruses → Predicted Viral | 2446 | Open in IMG/M |
3300027578|Ga0255075_1021702 | All Organisms → Viruses → Predicted Viral | 1244 | Open in IMG/M |
3300027631|Ga0208133_1015017 | All Organisms → Viruses → Predicted Viral | 2059 | Open in IMG/M |
3300027631|Ga0208133_1094744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
3300027631|Ga0208133_1123254 | Not Available | 601 | Open in IMG/M |
3300027644|Ga0209356_1029020 | All Organisms → Viruses → Predicted Viral | 1822 | Open in IMG/M |
3300027644|Ga0209356_1073875 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
3300027689|Ga0209551_1226768 | Not Available | 565 | Open in IMG/M |
3300027710|Ga0209599_10210894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300027734|Ga0209087_1210556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300027756|Ga0209444_10231638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300027757|Ga0208671_10262396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300027759|Ga0209296_1368240 | Not Available | 547 | Open in IMG/M |
3300027769|Ga0209770_10026060 | All Organisms → Viruses → Predicted Viral | 2556 | Open in IMG/M |
3300027769|Ga0209770_10081450 | All Organisms → Viruses → Predicted Viral | 1347 | Open in IMG/M |
3300027782|Ga0209500_10142070 | All Organisms → Viruses → Predicted Viral | 1139 | Open in IMG/M |
3300027793|Ga0209972_10396956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300027793|Ga0209972_10496292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300027797|Ga0209107_10443107 | Not Available | 585 | Open in IMG/M |
3300027804|Ga0209358_10083087 | All Organisms → Viruses → Predicted Viral | 1812 | Open in IMG/M |
3300027892|Ga0209550_10632269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300028025|Ga0247723_1005579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5642 | Open in IMG/M |
3300028025|Ga0247723_1055353 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
3300028025|Ga0247723_1123941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300031786|Ga0315908_10660655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300031857|Ga0315909_10209306 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
3300031857|Ga0315909_10711574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300031857|Ga0315909_10745021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300031951|Ga0315904_10772383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300031951|Ga0315904_11144485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300031951|Ga0315904_11481191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300031963|Ga0315901_10411328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
3300031963|Ga0315901_11106498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300032093|Ga0315902_10342789 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
3300032093|Ga0315902_10369273 | All Organisms → Viruses → Predicted Viral | 1315 | Open in IMG/M |
3300032093|Ga0315902_11191709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300032116|Ga0315903_10374588 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
3300033995|Ga0335003_0290215 | Not Available | 739 | Open in IMG/M |
3300034012|Ga0334986_0563092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300034018|Ga0334985_0767408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300034050|Ga0335023_0534688 | Not Available | 603 | Open in IMG/M |
3300034061|Ga0334987_0628443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300034082|Ga0335020_0173636 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
3300034102|Ga0335029_0198599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1333 | Open in IMG/M |
3300034103|Ga0335030_0180709 | All Organisms → Viruses → Predicted Viral | 1481 | Open in IMG/M |
3300034104|Ga0335031_0704404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300034105|Ga0335035_0271748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
3300034106|Ga0335036_0212157 | All Organisms → Viruses → Predicted Viral | 1334 | Open in IMG/M |
3300034108|Ga0335050_0156094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1236 | Open in IMG/M |
3300034109|Ga0335051_0119393 | All Organisms → Viruses → Predicted Viral | 1361 | Open in IMG/M |
3300034109|Ga0335051_0337840 | Not Available | 723 | Open in IMG/M |
3300034111|Ga0335063_0104715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1705 | Open in IMG/M |
3300034112|Ga0335066_0366256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
3300034112|Ga0335066_0701803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300034122|Ga0335060_0636823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300034166|Ga0335016_0421614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300034200|Ga0335065_0310496 | Not Available | 993 | Open in IMG/M |
3300034200|Ga0335065_0820439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300034279|Ga0335052_0287796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
3300034284|Ga0335013_0278907 | Not Available | 1072 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.61% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.48% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 12.36% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.87% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.30% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.30% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.74% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.49% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.93% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.93% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.25% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.25% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.25% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.69% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.69% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.12% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.12% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.12% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.12% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.56% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.56% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.56% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.56% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.56% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001272 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002277 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003488 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004771 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M | Environmental | Open in IMG/M |
3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007649 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008995 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024487 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025757 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027224 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes) | Environmental | Open in IMG/M |
3300027227 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027247 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027261 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J13886_1068813 | 3300001272 | Freshwater | MKPDDKDKLNKCLEILDTTDLGLTMVWLWTWSTIGNIIEDNTWHATVTLDDMWPH |
JGI24766J26685_100321927 | 3300002161 | Freshwater And Sediment | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNILDD |
JGI24766J26685_101048103 | 3300002161 | Freshwater And Sediment | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTIKQTLEM |
B570J29592_1040563 | 3300002277 | Freshwater | MKPDDKDKLNECLKILDTTDLGLSMVWLWTWSTINNIMEDETYKVKVTQDQM |
JGI25922J50271_100603404 | 3300003413 | Freshwater Lake | MKPADKDKLNECLKILDTTDLGLSLVWLWTWSTINNILDDETYRAKVT |
JGI25922J50271_100945991 | 3300003413 | Freshwater Lake | MKPEDKDKLNECLKILDTTDLGLSMVWLWTWSTINNILEDETYKA |
JGI25919J51413_10185851 | 3300003488 | Freshwater Lake | MIYHLRLEHGMKPADKDKLNECLKILDTTDLGLSLVWLWTWSTIN |
JGI25926J51410_10452331 | 3300003490 | Freshwater Lake | MKPADKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNCTLDE |
JGI25923J51411_10720533 | 3300003493 | Freshwater Lake | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNVT |
JGI25923J51411_10812792 | 3300003493 | Freshwater Lake | MKPEDKDKLNECLAILDKTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMWDHL |
Ga0065166_102585231 | 3300004112 | Freshwater Lake | MKPEDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMWDH |
Ga0007787_104173641 | 3300004240 | Freshwater Lake | MKPQDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEM |
Ga0007797_10307531 | 3300004771 | Freshwater | MKPDDKDKLNKCIEILDTTDLGLSLVWLWTWSTIAQILDDDSYTSSVTLDEVWEPLC |
Ga0007764_115854471 | 3300004797 | Freshwater Lake | MKPQDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTI |
Ga0070374_103530091 | 3300005517 | Freshwater Lake | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMW |
Ga0068876_105974041 | 3300005527 | Freshwater Lake | MKTEDRDKLHKCLEILKGTNLGLPMVWLWTWSTIVDILDDETYHAQ |
Ga0049081_102046661 | 3300005581 | Freshwater Lentic | MKPQDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDET |
Ga0049081_102985491 | 3300005581 | Freshwater Lentic | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDE |
Ga0049080_102412513 | 3300005582 | Freshwater Lentic | MKPGDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYK |
Ga0049085_101790903 | 3300005583 | Freshwater Lentic | MKTEDKDKLNKCLEILDTTDLGLTLVWLWTWSTIGNII |
Ga0078894_107090345 | 3300005662 | Freshwater Lake | MKPEDKDKLNECLKILDTTDLGLSMVWLWTWSTINNILDDDT |
Ga0070743_100890341 | 3300005941 | Estuarine | MKPDDKDKLNKCLDILDTTDLGLSLVWLWTWSTIKNLMEDETF |
Ga0070743_102595963 | 3300005941 | Estuarine | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNI |
Ga0070744_100168887 | 3300006484 | Estuarine | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNILEDETLRAKVTKDQMW |
Ga0075464_103597815 | 3300006805 | Aqueous | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIL |
Ga0075473_102929001 | 3300006875 | Aqueous | MKPQDKDKLNECLAILDTTDLGLSMVWLWTWSTIKNFMEDE |
Ga0102875_11061391 | 3300007547 | Estuarine | MKPEDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCT |
Ga0102818_10982081 | 3300007552 | Estuarine | MKPADKDKLNECLKILDSTDLGLSMVWLWTWSTINNILDDETY |
Ga0102828_11698623 | 3300007559 | Estuarine | MKPDDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDE |
Ga0102871_11615371 | 3300007620 | Estuarine | MKADDRNKLNECLDILDTTDLGLSMVWLWTWSAIKSFMEDQEFRFNF |
Ga0102865_10851132 | 3300007639 | Estuarine | MNPDDKDKLNKCLEILDTTDLKHSLVWLWTWSTIDNILKDDSYKA |
Ga0102912_11405981 | 3300007649 | Estuarine | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFDDTTYRQNCTIDE |
Ga0102859_11618281 | 3300007708 | Estuarine | MKPADKDKLNKCLKILDTTDLGLSMVWLWTWSTIKSIMEDETYRANVSMDQM |
Ga0105739_10699414 | 3300007954 | Estuary Water | MKPEDKDKLNECLKILDTTDLGLSMVWLWTWSTINNIL |
Ga0105747_10358366 | 3300007974 | Estuary Water | MKPADKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYRQNCTI |
Ga0102922_11088051 | 3300008021 | Estuarine | MKPEDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMW |
Ga0114340_10726366 | 3300008107 | Freshwater, Plankton | LKPDDKDKLNKCLEILDTTDLGLSLVWLWTWSTINNIMEDETFKAKVTVDDMWDN |
Ga0114340_11631631 | 3300008107 | Freshwater, Plankton | MKPEDKDKLNECLKILDTTDLGLSMVWLWTWSTIKNFMEDET |
Ga0114340_11911471 | 3300008107 | Freshwater, Plankton | MKTGDKDKLNECLNILEQTDLGLSLVWLWTWSTIKNFM |
Ga0114340_12368873 | 3300008107 | Freshwater, Plankton | MKGRNPLKPDDKDKLNKCLEILDTTDLGLSLVWLWTWSTINNIMEDETFKAKVTVDDMWD |
Ga0114341_104560673 | 3300008108 | Freshwater, Plankton | MKTEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDE |
Ga0114343_11245815 | 3300008110 | Freshwater, Plankton | MKPQDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMWDH |
Ga0114343_11358291 | 3300008110 | Freshwater, Plankton | MKPGDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDET |
Ga0114346_11332661 | 3300008113 | Freshwater, Plankton | MKPGDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDE |
Ga0114346_12341224 | 3300008113 | Freshwater, Plankton | MKSDDKDKLNKCLEILDSTDLGLSLVWLWTWSTINNILEDDTYV |
Ga0114346_12918343 | 3300008113 | Freshwater, Plankton | MKPQDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNCT |
Ga0114346_13245573 | 3300008113 | Freshwater, Plankton | MKPEDKDKLNKCLEILDSTDLGLSLVWLWTWSTINNILDDETY |
Ga0114841_12148754 | 3300008259 | Freshwater, Plankton | MKPEDKDKLNECLKILDTTDLGLSMVWLWTWSTITNILDDETYKAKVTQD |
Ga0102888_11262741 | 3300008995 | Estuarine | MKPEDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEM |
Ga0114973_100510218 | 3300009068 | Freshwater Lake | MKPADKDKLNECLRILDTTDLGLSMVWLWTWSTIKSIMEDETYRANVS |
Ga0114973_102235785 | 3300009068 | Freshwater Lake | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYRQNCTIDEMW |
Ga0102814_105440993 | 3300009079 | Estuarine | MKPDDKDKLNKCLEILDTTDLGLTMVWLWTWSTIGNIIEDNTWHATV |
Ga0114966_106867781 | 3300009161 | Freshwater Lake | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDET |
Ga0114976_102998581 | 3300009184 | Freshwater Lake | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQN |
Ga0114976_103939924 | 3300009184 | Freshwater Lake | MKPEDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQN |
Ga0114982_11406654 | 3300009419 | Deep Subsurface | MKPDDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIMEDETYKVKVTQD |
Ga0114982_11928211 | 3300009419 | Deep Subsurface | MKPEDKDKLNECLKILDTTDLGLSMVWLWTWSTITNILDD |
Ga0127391_10629493 | 3300009450 | Meromictic Pond | MRPEDKDKLNQCLDILDTTDLGLSMVWLWTWSTIGNILGD |
Ga0102883_10907714 | 3300010312 | Estuarine | MKPADKDKLNQCLDILDTTDLGLYLVWLWTWSTVKNIFEDE |
Ga0129333_108479184 | 3300010354 | Freshwater To Marine Saline Gradient | MKGRNPLKPDDKDKLNKCLEILDTTDLGLSLVWLWTWSTINNIMEDETYKAKVTIDGMWD |
Ga0129333_115920721 | 3300010354 | Freshwater To Marine Saline Gradient | MKAGDKEKLNQCLDILDTTDLGLSLVWLYTWSTIKNLME |
Ga0129333_116109983 | 3300010354 | Freshwater To Marine Saline Gradient | LKPDDKDKLNKCLEILDTTDLGLSLVWLWTWSTINNIMEDETFK |
Ga0129336_103216165 | 3300010370 | Freshwater To Marine Saline Gradient | MKPQDKDKLNECLDILDTTDLGLSLVWLWTWSTIKNFMED |
Ga0151620_11226944 | 3300011268 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMWDHL |
Ga0151620_12719361 | 3300011268 | Freshwater | MKPEDKDKLNKCLEILDSTDLGLSLVWLWTWSTINNIL |
Ga0153799_10737871 | 3300012012 | Freshwater | VKPEDKDKLNKCLEILDDTDLGLSLVWLWTWSTINNILE |
Ga0153805_10201416 | 3300012013 | Surface Ice | MKPQDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFE |
Ga0153801_10537643 | 3300012017 | Freshwater | MKPEDKDKLNTCLEILDSTDLGLSMVWLWTWSTINNILDDETYKRNVTQDQMWEH |
Ga0157498_10499573 | 3300012666 | Freshwater, Surface Ice | MKPQDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEM |
Ga0164292_101978678 | 3300013005 | Freshwater | MKPDDKDKLNECLKILDTTDLGLSMVWLWTWSTINNIFEDETYK |
Ga0177922_103007001 | 3300013372 | Freshwater | MKPADKDKLNECLKILDTTDLGLSLVWLWTWSTINNIF |
Ga0177922_109710071 | 3300013372 | Freshwater | MKPDDKDKLNACLEILDSTDLGLSMVWLWTWSTINN |
Ga0181364_10722503 | 3300017701 | Freshwater Lake | MLYHLRLEHVMKPEDKDKLNECLAILDKTDLGLSLVWLWTWSTINNIFEDETY |
Ga0181355_13659781 | 3300017785 | Freshwater Lake | MLYHLRLEHVMKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYRHIS |
Ga0211734_102874381 | 3300020159 | Freshwater | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMWDH |
Ga0211734_109429003 | 3300020159 | Freshwater | MKPDDKDKLNQCLEILDTTDLGLSLVWLWTWSTITNILDDPEY |
Ga0211734_111634481 | 3300020159 | Freshwater | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINN |
Ga0211733_104417831 | 3300020160 | Freshwater | MKPEDKDKLNECLKILDSTDLGLSLVWLWTWSTINNVLDDDT |
Ga0211735_108911462 | 3300020162 | Freshwater | MKSDDKDKLNKCLEILDTTDLGLSMVWLWTWSTIRDIMNDTSSWNIKVQ |
Ga0211729_100797063 | 3300020172 | Freshwater | MKPEDKDKLNECLAILDKTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMWDH |
Ga0211729_109487833 | 3300020172 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYRKNCTIDEMWDH |
Ga0211731_103251295 | 3300020205 | Freshwater | MKSDDKDKLNQCLEILDTTDLGLSLVWLWTWSTIVNILDDPEYKA |
Ga0211731_1137297710 | 3300020205 | Freshwater | MKPDDKDKLNQCLEILDTTDLGLSLVWLWTWSTIVNILDDPEYKA |
Ga0208202_10217284 | 3300020514 | Freshwater | MKPGDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETY |
Ga0208858_10017801 | 3300020524 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQ |
Ga0208232_10395201 | 3300020527 | Freshwater | MKPDDKDKLNKCLEILDTTDLGLSMVWLWTWSTINN |
Ga0207942_10003831 | 3300020549 | Freshwater | MKPDDKDKLNKCLEILDSTDLGLSLVWLWTWSTINNIFEDESYKQ |
Ga0208053_10509191 | 3300020575 | Freshwater | MKPDDKDKLNECLSILDSTDLGLSLVWLWTWSTINNIFED |
Ga0194048_102873161 | 3300021519 | Anoxic Zone Freshwater | MKPEDKDKLNECLEILDTTDLGLSMVWLWTWSTINNILEDDTYQSKATKDEMW |
Ga0222713_1002142514 | 3300021962 | Estuarine Water | LRLEHGMKPDDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNILDDETYRAKVTQDD |
Ga0222713_105102844 | 3300021962 | Estuarine Water | MKAEDKDKLNECLKILDTTDLGLSLVWLWTWSTIQGFR |
Ga0214921_103886903 | 3300023174 | Freshwater | MKPDDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQN |
Ga0214919_103580371 | 3300023184 | Freshwater | MKPEDKDKLNKCLEILDSTDLGLSMVWLWTWSTINNILDDETYKRNV |
Ga0244777_106028311 | 3300024343 | Estuarine | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNMMEDKTFKVNVTQDQMW |
Ga0244775_108305911 | 3300024346 | Estuarine | MKPADKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQN |
Ga0255222_10330431 | 3300024487 | Freshwater | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQN |
Ga0255176_10505761 | 3300024507 | Freshwater | MKPDDKDKLNKCLDILDTTDLGLSLVWLWTWSTIKNFME |
Ga0255276_10711844 | 3300024570 | Freshwater | MKTDDKDKLNKCLEILDTTDLGLSLVWLWTWSTIKNFFDDETFIMKK |
Ga0256337_11641921 | 3300024573 | Freshwater | MKPGDKDKLNQCLDILDTTDLGLSLVWLWTWSTIKNFMADE |
Ga0256339_10548294 | 3300024857 | Freshwater | MKAGDKDKLNQCLDILDTTDLGLSLVWLWTWSTIKNLMQDG |
Ga0256339_11192663 | 3300024857 | Freshwater | MKTDDKDKLNKCLEILDTTDLGLSLVWLWTWSTIKNFM |
Ga0208784_10909525 | 3300025732 | Aqueous | MKGKNPLKPDDKDKLNKCLEILDTTDLGLSLVWLWTWSTINNIMEDETFKAKVTIDDMWD |
Ga0208784_12327321 | 3300025732 | Aqueous | MKPGDKDKLNECLDILDTTDLGLSLVWLWTWSTIKNFMADET |
Ga0256313_10721673 | 3300025757 | Freshwater | MKPADKDKLNECLKILDTTDLGLSLVWLWTWSTINNILDDET |
Ga0255074_10056668 | 3300027121 | Freshwater | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCT |
Ga0255070_10762323 | 3300027133 | Freshwater | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNILD |
Ga0255080_10550263 | 3300027140 | Freshwater | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQKCTIDEMWD |
Ga0255063_10625931 | 3300027151 | Freshwater | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFE |
Ga0208926_10388831 | 3300027205 | Estuarine | MKPDDKDKLNKCLEILDTTDLGLTMVWLWTWSTIGNIIEDNTWHATVTLDDMWGHL |
Ga0208023_10785553 | 3300027206 | Estuarine | MKPEDKDKLNKCLEILDSTDLGLSLVWLWTWSTINNILDDETYRA |
Ga0208306_10564462 | 3300027214 | Estuarine | MKPEDKDKLNKCLEILDTTDLGLSLVWLWTWSTINNIMEDETYKVKVTQDQM |
Ga0208306_10742251 | 3300027214 | Estuarine | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMW |
Ga0208164_10875243 | 3300027224 | Estuarine | MIYHLRLEHGMKPADKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYRQNCTID |
Ga0208929_10516691 | 3300027227 | Estuarine | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMWD |
Ga0208679_10564191 | 3300027247 | Estuarine | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTIN |
Ga0208933_10288321 | 3300027261 | Estuarine | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTIDEMWDHL |
Ga0208923_10348374 | 3300027320 | Estuarine | MKPADKDKLNECLKILDTTDLGLSMVWLWTWSTINNILEDETFRAN |
Ga0255086_10118221 | 3300027486 | Freshwater | MKPQDKDKLNECLSILDTTDLGLSLVWLWTWSTIKNFMGDETFIMKK |
Ga0255084_10064641 | 3300027488 | Freshwater | MKPQDKDKLNECLSILDTTDLGLSLVWLWTWSTIKNFMGDE |
Ga0255075_10217021 | 3300027578 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTIN |
Ga0208133_10150171 | 3300027631 | Estuarine | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNILEDETLRAKVTKDQMWD |
Ga0208133_10947441 | 3300027631 | Estuarine | MKPADKDKLNQCLDILDTTDLGLSLVWLWTWSTVKNIFEDETYKQNCTIDE |
Ga0208133_11232541 | 3300027631 | Estuarine | MTYRLRLEHVMKPADKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQN |
Ga0209356_10290201 | 3300027644 | Freshwater Lake | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNVTI |
Ga0209356_10738755 | 3300027644 | Freshwater Lake | MKPDDKDKLNECLSILDSTDLGLSLVWLWTWSTINNIFEDET |
Ga0209551_12267683 | 3300027689 | Freshwater Lake | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFE |
Ga0209599_102108941 | 3300027710 | Deep Subsurface | MKPADKDKLNECLKILDTTDLGLSMVWLWTWSTIKNFMEDETFIMKCTEDK |
Ga0209087_12105561 | 3300027734 | Freshwater Lake | MKPADKDKLNECLKILDTTDLGLSLVWLWTWSTIN |
Ga0209444_102316383 | 3300027756 | Freshwater Lake | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFED |
Ga0208671_102623961 | 3300027757 | Estuarine | MKPADKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFD |
Ga0209296_13682401 | 3300027759 | Freshwater Lake | MKPGDKDKLNECISILDSTDLGLSLVWLWTWSTIKDILSDS |
Ga0209770_100260601 | 3300027769 | Freshwater Lake | MKPEDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTID |
Ga0209770_100814501 | 3300027769 | Freshwater Lake | MKPEDKDKLNECLKILDTTDLGLSMVWLWTWSTINNILEDETYKAKVT |
Ga0209500_101420706 | 3300027782 | Freshwater Lake | MKPDDKDKLNKCLEILDSTDLGLSMVWLWTWSTINNIL |
Ga0209972_103969561 | 3300027793 | Freshwater Lake | MKPEDKDKLNECLKILDTTDLGLSMVWLWTWSTINNILDDETYKAKVTQ |
Ga0209972_104962922 | 3300027793 | Freshwater Lake | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNILDDETYKAKVTQDQMWDNLC |
Ga0209107_104431071 | 3300027797 | Freshwater And Sediment | MIYHLRLEHGMKPADKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDE |
Ga0209358_100830876 | 3300027804 | Freshwater Lake | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNILDDETYKAKVTQDQMWEHL |
Ga0209550_106322693 | 3300027892 | Freshwater Lake | MKPEDKDKLNKCLEILDSTDLGLSLVWLWTWSTINNILDDETYRAKVTQDQMWD |
Ga0247723_10055791 | 3300028025 | Deep Subsurface Sediment | MKPEDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQNCTI |
Ga0247723_10553531 | 3300028025 | Deep Subsurface Sediment | MKPADKDKLNECLKILDTTDLGLSLVWLWTWSTINNILDDETYRAS |
Ga0247723_11239413 | 3300028025 | Deep Subsurface Sediment | VKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNILDDET |
Ga0315908_106606551 | 3300031786 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYRHNVTIDQMWDHL |
Ga0315909_102093061 | 3300031857 | Freshwater | MKAEDKDKLNECLKILDTTDLGLSLVWLWTWSTIK |
Ga0315909_107115741 | 3300031857 | Freshwater | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNILDDETYKAKVTQDQMW |
Ga0315909_107450213 | 3300031857 | Freshwater | MTYHLRLEHGMKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTIN |
Ga0315904_107723834 | 3300031951 | Freshwater | MKPQDKDKLNECLDILDTTDLGLSLVWLWTWSTIKNFMADKT |
Ga0315904_111444851 | 3300031951 | Freshwater | MKPGDKDKLNKCLEILDTTDLGLSMVWLYTWSTIKDLMQDEEWKCTQTEDQMW |
Ga0315904_114811911 | 3300031951 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNRFE |
Ga0315901_104113286 | 3300031963 | Freshwater | MKPQDKDKLNECLKILDSTDLGLSLVWLWTWSTINN |
Ga0315901_111064981 | 3300031963 | Freshwater | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNILDDETYKAKVTQDQM |
Ga0315902_103427891 | 3300032093 | Freshwater | MKPEDKDKLNKCLEILDTTDLGLSMVWLWTWSTINNILDDETYKAKVTQDQMWD |
Ga0315902_103692737 | 3300032093 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYK |
Ga0315902_111917093 | 3300032093 | Freshwater | MKPQDKDKLNECLDILDTTDLGLSLVWLWTWSTIKNFMADETF |
Ga0315903_103745881 | 3300032116 | Freshwater | MKTEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYRQNC |
Ga0335003_0290215_628_738 | 3300033995 | Freshwater | MKPGDKDKLNECISILDSTDLGLSLVWLWTWSTIKDI |
Ga0334986_0563092_2_112 | 3300034012 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNI |
Ga0334985_0767408_1_108 | 3300034018 | Freshwater | MKPEDKDKLNECLRILDTTDLGLSLVWLWTWSTINN |
Ga0335023_0534688_3_122 | 3300034050 | Freshwater | MKPDDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIMED |
Ga0334987_0628443_2_127 | 3300034061 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSMVWLWTWSTINNLLEDET |
Ga0335020_0173636_943_1080 | 3300034082 | Freshwater | MKPEDKDKLNECLRILDTTDLGLSLVWLWTWSTINNIFEDETYKQN |
Ga0335029_0198599_2_127 | 3300034102 | Freshwater | MKPEDKNKLDKCLEILDTTDLGLSLVWLWTWSTINNILEDET |
Ga0335030_0180709_3_146 | 3300034103 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYRQNCT |
Ga0335031_0704404_3_110 | 3300034104 | Freshwater | MKPEDKDKLNECLKILDSTDLGLSLVWLWTWSTINN |
Ga0335035_0271748_2_124 | 3300034105 | Freshwater | MKPEDKDKLNACLEILDSTDLGLSMVWLWTWSTIDNILKDD |
Ga0335036_0212157_1177_1332 | 3300034106 | Freshwater | MKPGDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQKCTIDEM |
Ga0335050_0156094_1_162 | 3300034108 | Freshwater | MKPEDKDKLNECLKILDDTDLGLSLVWLWTWSTINNILEDDTYVAKATQDEMWD |
Ga0335051_0119393_1210_1359 | 3300034109 | Freshwater | MKPEDKDKLNACLEILDSTDLGLSMVWLWTWSTIDNILKDDNYKAKVTMD |
Ga0335051_0337840_614_721 | 3300034109 | Freshwater | MKPQDKEKLNACLEILDSTDLGLSMVWLWTWSTIKN |
Ga0335063_0104715_1_141 | 3300034111 | Freshwater | MKPEDKDKLNECLKILDSTDLGLSLVWLWTWSTINNIFEDETYKQKV |
Ga0335066_0366256_1_150 | 3300034112 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQKCTID |
Ga0335066_0701803_334_510 | 3300034112 | Freshwater | MTYHLRLEHVMKPQDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETYKQNCTI |
Ga0335060_0636823_406_531 | 3300034122 | Freshwater | MKTEDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDET |
Ga0335016_0421614_2_142 | 3300034166 | Freshwater | MKPDDKDKLNKCLEILDSTDLGLSLVWLWTWSTINGILEDDTYVAKA |
Ga0335065_0310496_868_993 | 3300034200 | Freshwater | MKPEDKDKLNACLEILDSTDLGLSMVWLWTWSTIDNILKDDN |
Ga0335065_0820439_405_518 | 3300034200 | Freshwater | MKPEDKDKLNECLKILDTTDLGLSLVWLWTWSTISNIM |
Ga0335052_0287796_2_160 | 3300034279 | Freshwater | MKSEDKHKLNACLEILDSTDLGLSMVWLWTWSTIDNILKDDNWHAEVTLDQMW |
Ga0335013_0278907_956_1072 | 3300034284 | Freshwater | MKPDDKDKLNQCLDILDSTDLGLSLVWLWTWSTINNILD |
⦗Top⦘ |