NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032484

Metagenome / Metatranscriptome Family F032484

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032484
Family Type Metagenome / Metatranscriptome
Number of Sequences 180
Average Sequence Length 48 residues
Representative Sequence MKKTDNIDKLLIIDHINKVITQKRELNPPTFNGRFRDKVREKYPDYELK
Number of Associated Samples 136
Number of Associated Scaffolds 180

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 16.67 %
% of genes near scaffold ends (potentially truncated) 18.33 %
% of genes from short scaffolds (< 2000 bps) 74.44 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (32.778 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(11.111 % of family members)
Environment Ontology (ENVO) Unclassified
(29.444 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(35.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.18%    β-sheet: 12.99%    Coil/Unstructured: 68.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 180 Family Scaffolds
PF07728AAA_5 16.67
PF08406CbbQ_C 5.00
PF11753DUF3310 2.22
PF11360DUF3110 1.11
PF03104DNA_pol_B_exo1 1.11
PF12850Metallophos_2 0.56
PF07460NUMOD3 0.56
PF03462PCRF 0.56
PF03477ATP-cone 0.56
PF00268Ribonuc_red_sm 0.56
PF01818Translat_reg 0.56
PF04851ResIII 0.56
PF02675AdoMet_dc 0.56
PF13392HNH_3 0.56
PF00271Helicase_C 0.56
PF00154RecA 0.56
PF00395SLH 0.56
PF13476AAA_23 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 180 Family Scaffolds
COG0714MoxR-like ATPaseGeneral function prediction only [R] 5.00
COG0417DNA polymerase B elongation subunitReplication, recombination and repair [L] 1.11
COG0208Ribonucleotide reductase beta subunit, ferritin-like domainNucleotide transport and metabolism [F] 0.56
COG0216Protein chain release factor RF1Translation, ribosomal structure and biogenesis [J] 0.56
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 0.56
COG1186Protein chain release factor PrfBTranslation, ribosomal structure and biogenesis [J] 0.56
COG1586S-adenosylmethionine decarboxylaseAmino acid transport and metabolism [E] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.44 %
UnclassifiedrootN/A25.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000756|JGI12421J11937_10060473All Organisms → Viruses → Predicted Viral1181Open in IMG/M
3300001335|ML8_10069585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1231Open in IMG/M
3300001336|ML7_10076577All Organisms → cellular organisms → Bacteria1426Open in IMG/M
3300001419|JGI11705J14877_10044432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1568Open in IMG/M
3300001580|Draft_10150865All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED361123Open in IMG/M
3300001605|Draft_10221156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1119Open in IMG/M
3300002145|S2t7BSb_10467856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris818Open in IMG/M
3300003388|JGI25910J50241_10085402Not Available894Open in IMG/M
3300003411|JGI25911J50253_10209768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes535Open in IMG/M
3300005346|Ga0074242_10714489All Organisms → Viruses → Predicted Viral2006Open in IMG/M
3300005512|Ga0074648_1003011All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes14664Open in IMG/M
3300005512|Ga0074648_1010366All Organisms → cellular organisms → Bacteria6220Open in IMG/M
3300005512|Ga0074648_1014732All Organisms → Viruses → Predicted Viral4782Open in IMG/M
3300005517|Ga0070374_10636594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris528Open in IMG/M
3300005582|Ga0049080_10029464All Organisms → Viruses → Predicted Viral1916Open in IMG/M
3300005611|Ga0074647_1002566Not Available5790Open in IMG/M
3300005805|Ga0079957_1023089All Organisms → Viruses → Predicted Viral4280Open in IMG/M
3300005805|Ga0079957_1260205Not Available800Open in IMG/M
3300005940|Ga0073913_10000946All Organisms → Viruses → Predicted Viral4343Open in IMG/M
3300005941|Ga0070743_10032453All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Candidatus Poseidoniia → Candidatus Poseidoniales → unclassified Candidatus Poseidoniales → Candidatus Poseidoniales archaeon1802Open in IMG/M
3300005943|Ga0073926_10008296All Organisms → Viruses → Predicted Viral1828Open in IMG/M
3300005955|Ga0073922_1045520Not Available555Open in IMG/M
3300006802|Ga0070749_10243413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1020Open in IMG/M
3300006802|Ga0070749_10247339Not Available1011Open in IMG/M
3300006810|Ga0070754_10006925All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM27482Open in IMG/M
3300007345|Ga0070752_1059995All Organisms → Viruses → Predicted Viral1714Open in IMG/M
3300007538|Ga0099851_1303217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae563Open in IMG/M
3300007538|Ga0099851_1305916Not Available560Open in IMG/M
3300007541|Ga0099848_1199256Not Available719Open in IMG/M
3300007542|Ga0099846_1051922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1553Open in IMG/M
3300007544|Ga0102861_1004325All Organisms → Viruses → Predicted Viral3211Open in IMG/M
3300007559|Ga0102828_1034609Not Available1143Open in IMG/M
3300007603|Ga0102921_1290162Not Available583Open in IMG/M
3300007622|Ga0102863_1013422Not Available2262Open in IMG/M
3300007735|Ga0104988_10757All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae26533Open in IMG/M
3300007735|Ga0104988_11027All Organisms → Viruses213274Open in IMG/M
3300007960|Ga0099850_1069705All Organisms → Viruses → Predicted Viral1476Open in IMG/M
3300007960|Ga0099850_1075581All Organisms → Viruses → Predicted Viral1409Open in IMG/M
3300007960|Ga0099850_1362875All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae541Open in IMG/M
3300007974|Ga0105747_1276271Not Available566Open in IMG/M
3300007992|Ga0105748_10488546Not Available537Open in IMG/M
3300008012|Ga0075480_10596629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae523Open in IMG/M
3300008021|Ga0102922_1104771Not Available893Open in IMG/M
3300008110|Ga0114343_1092813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1060Open in IMG/M
3300008962|Ga0104242_1024523All Organisms → Viruses → Predicted Viral1038Open in IMG/M
3300009024|Ga0102811_1238108Not Available680Open in IMG/M
3300009068|Ga0114973_10024580All Organisms → Viruses → Predicted Viral3700Open in IMG/M
3300009124|Ga0118687_10418335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris520Open in IMG/M
3300009149|Ga0114918_10188824Not Available1204Open in IMG/M
3300009149|Ga0114918_10333806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae839Open in IMG/M
3300009151|Ga0114962_10299685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris898Open in IMG/M
3300009152|Ga0114980_10403513All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Candidatus Poseidoniia → Candidatus Poseidoniales → unclassified Candidatus Poseidoniales → Candidatus Poseidoniales archaeon784Open in IMG/M
3300009158|Ga0114977_10296146Not Available923Open in IMG/M
3300009159|Ga0114978_10806681Not Available529Open in IMG/M
3300009168|Ga0105104_10127355All Organisms → Viruses → Predicted Viral1373Open in IMG/M
3300009168|Ga0105104_10907053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris517Open in IMG/M
3300009183|Ga0114974_10068111All Organisms → Viruses → Predicted Viral2340Open in IMG/M
3300009183|Ga0114974_10533383All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes655Open in IMG/M
3300009184|Ga0114976_10230426Not Available1010Open in IMG/M
3300009466|Ga0126448_1020232All Organisms → Viruses → Predicted Viral1604Open in IMG/M
3300009469|Ga0127401_1030762All Organisms → Viruses → Predicted Viral1556Open in IMG/M
3300009504|Ga0114946_10608075All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae552Open in IMG/M
3300010296|Ga0129348_1260391Not Available582Open in IMG/M
3300010318|Ga0136656_1050448All Organisms → Viruses → Predicted Viral1497Open in IMG/M
3300010334|Ga0136644_10194138All Organisms → Viruses → Predicted Viral1214Open in IMG/M
3300010354|Ga0129333_10000036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae70806Open in IMG/M
3300010354|Ga0129333_10110710All Organisms → Viruses → Predicted Viral2534Open in IMG/M
3300010354|Ga0129333_10807538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris799Open in IMG/M
3300010354|Ga0129333_11526385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris547Open in IMG/M
3300010370|Ga0129336_10088217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1826Open in IMG/M
3300010995|Ga0139323_101269All Organisms → Viruses → Predicted Viral2578Open in IMG/M
3300012006|Ga0119955_1174846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris549Open in IMG/M
3300012770|Ga0138291_1068548Not Available957Open in IMG/M
(restricted) 3300013126|Ga0172367_10066710All Organisms → Viruses → Predicted Viral2719Open in IMG/M
3300014819|Ga0119954_1001472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae7757Open in IMG/M
3300017708|Ga0181369_1110576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris565Open in IMG/M
3300017710|Ga0181403_1064934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris760Open in IMG/M
3300017722|Ga0181347_1185551Not Available553Open in IMG/M
3300017749|Ga0181392_1036734All Organisms → Viruses → Predicted Viral1527Open in IMG/M
3300017761|Ga0181356_1010875All Organisms → Viruses → Predicted Viral3480Open in IMG/M
3300017770|Ga0187217_1150262Not Available780Open in IMG/M
3300017786|Ga0181424_10066777All Organisms → Viruses → Predicted Viral1554Open in IMG/M
3300017788|Ga0169931_10140677All Organisms → Viruses → Predicted Viral2192Open in IMG/M
3300017788|Ga0169931_10172014Not Available1902Open in IMG/M
3300017963|Ga0180437_10131276All Organisms → Viruses → Predicted Viral2057Open in IMG/M
3300017991|Ga0180434_11220716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris562Open in IMG/M
3300018416|Ga0181553_10512530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris640Open in IMG/M
3300018542|Ga0188841_100074All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Candidatus Poseidoniia → Candidatus Poseidoniales → unclassified Candidatus Poseidoniales → Candidatus Poseidoniales archaeon1805Open in IMG/M
3300018542|Ga0188841_100253All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Candidatus Poseidoniia → Candidatus Poseidoniales → unclassified Candidatus Poseidoniales → Candidatus Poseidoniales archaeon1064Open in IMG/M
3300018682|Ga0188851_1004245All Organisms → Viruses → Predicted Viral2121Open in IMG/M
3300018682|Ga0188851_1023777All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Candidatus Poseidoniia → Candidatus Poseidoniales → unclassified Candidatus Poseidoniales → Candidatus Poseidoniales archaeon710Open in IMG/M
3300018775|Ga0188848_1015347Not Available827Open in IMG/M
3300019096|Ga0188835_1006435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1095Open in IMG/M
3300019096|Ga0188835_1006567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1083Open in IMG/M
3300019784|Ga0181359_1126294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris908Open in IMG/M
3300019784|Ga0181359_1182254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae692Open in IMG/M
3300020151|Ga0211736_10894240Not Available1101Open in IMG/M
3300020172|Ga0211729_10425992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1297Open in IMG/M
3300021335|Ga0213867_1281255All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae529Open in IMG/M
3300021356|Ga0213858_10165867Not Available1077Open in IMG/M
3300021364|Ga0213859_10000226All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes26003Open in IMG/M
3300021379|Ga0213864_10040638All Organisms → Viruses → Predicted Viral2199Open in IMG/M
3300021425|Ga0213866_10084911All Organisms → Viruses → Predicted Viral1743Open in IMG/M
3300021961|Ga0222714_10168460All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Candidatus Poseidoniia → Candidatus Poseidoniales → unclassified Candidatus Poseidoniales → Candidatus Poseidoniales archaeon1295Open in IMG/M
3300021961|Ga0222714_10187250All Organisms → Viruses → Predicted Viral1206Open in IMG/M
3300021964|Ga0222719_10102835All Organisms → Viruses → Predicted Viral2085Open in IMG/M
3300021964|Ga0222719_10324755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris987Open in IMG/M
3300022063|Ga0212029_1012234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1075Open in IMG/M
3300022187|Ga0196899_1100741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris856Open in IMG/M
3300022190|Ga0181354_1064577All Organisms → Viruses → Predicted Viral1216Open in IMG/M
3300022198|Ga0196905_1007860All Organisms → Viruses → Predicted Viral3627Open in IMG/M
3300022198|Ga0196905_1026715All Organisms → Viruses → Predicted Viral1763Open in IMG/M
3300022200|Ga0196901_1262760Not Available531Open in IMG/M
3300022407|Ga0181351_1079069All Organisms → Viruses → Predicted Viral1315Open in IMG/M
3300022407|Ga0181351_1129531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris935Open in IMG/M
3300022407|Ga0181351_1224320Not Available607Open in IMG/M
3300022752|Ga0214917_10000203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae75893Open in IMG/M
3300022752|Ga0214917_10020599Not Available5424Open in IMG/M
3300022752|Ga0214917_10120870All Organisms → Viruses → Predicted Viral1461Open in IMG/M
3300022752|Ga0214917_10213589All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes936Open in IMG/M
3300023179|Ga0214923_10000476All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM261183Open in IMG/M
3300023184|Ga0214919_10157789All Organisms → Viruses → Predicted Viral1787Open in IMG/M
3300024262|Ga0210003_1023808All Organisms → Viruses → Predicted Viral3617Open in IMG/M
3300024262|Ga0210003_1134357All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED361079Open in IMG/M
3300024346|Ga0244775_10000169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae85296Open in IMG/M
3300024346|Ga0244775_10003922All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae15684Open in IMG/M
3300025135|Ga0209498_1314648Not Available527Open in IMG/M
3300025646|Ga0208161_1000049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae55016Open in IMG/M
3300025646|Ga0208161_1016177All Organisms → Viruses → Predicted Viral2912Open in IMG/M
3300025687|Ga0208019_1022392All Organisms → Viruses → Predicted Viral2454Open in IMG/M
3300027205|Ga0208926_1014139All Organisms → Viruses → Predicted Viral1195Open in IMG/M
3300027211|Ga0208307_1000040Not Available43575Open in IMG/M
3300027547|Ga0209864_1017343Not Available833Open in IMG/M
3300027578|Ga0255075_1084492All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes553Open in IMG/M
3300027586|Ga0208966_1006720All Organisms → Viruses → Predicted Viral3455Open in IMG/M
3300027708|Ga0209188_1123335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1009Open in IMG/M
(restricted) 3300027728|Ga0247836_1012839Not Available7279Open in IMG/M
(restricted) 3300027728|Ga0247836_1018113Not Available5482Open in IMG/M
(restricted) 3300027730|Ga0247833_1210791Not Available718Open in IMG/M
3300027749|Ga0209084_1059850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1795Open in IMG/M
3300027759|Ga0209296_1087318All Organisms → Viruses → Predicted Viral1520Open in IMG/M
3300027772|Ga0209768_10164233Not Available1027Open in IMG/M
3300027782|Ga0209500_10111378All Organisms → Viruses → Predicted Viral1340Open in IMG/M
3300027797|Ga0209107_10000631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae20282Open in IMG/M
3300027972|Ga0209079_10022403All Organisms → Viruses → Predicted Viral2098Open in IMG/M
(restricted) 3300027977|Ga0247834_1061458All Organisms → Viruses → Predicted Viral1914Open in IMG/M
(restricted) 3300028114|Ga0247835_1222983Not Available629Open in IMG/M
(restricted) 3300028569|Ga0247843_1108650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris1238Open in IMG/M
(restricted) 3300028569|Ga0247843_1304680Not Available547Open in IMG/M
3300029930|Ga0119944_1016208Not Available1055Open in IMG/M
3300029930|Ga0119944_1050180Not Available500Open in IMG/M
3300029933|Ga0119945_1037211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris538Open in IMG/M
3300031539|Ga0307380_10590050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris958Open in IMG/M
3300031539|Ga0307380_10695164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes858Open in IMG/M
3300031539|Ga0307380_10769447All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Candidatus Poseidoniia → Candidatus Poseidoniales → unclassified Candidatus Poseidoniales → Candidatus Poseidoniales archaeon800Open in IMG/M
3300031565|Ga0307379_10072948All Organisms → Viruses → Predicted Viral3823Open in IMG/M
3300031565|Ga0307379_11527997Not Available530Open in IMG/M
3300031566|Ga0307378_10329199All Organisms → Viruses → Predicted Viral1431Open in IMG/M
3300031566|Ga0307378_10721287Not Available853Open in IMG/M
3300031578|Ga0307376_10171773All Organisms → Viruses → Predicted Viral1491Open in IMG/M
3300031578|Ga0307376_10192906All Organisms → Viruses → Predicted Viral1393Open in IMG/M
3300031578|Ga0307376_10293073All Organisms → Viruses → Predicted Viral1088Open in IMG/M
3300031673|Ga0307377_10371574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM011068Open in IMG/M
3300031673|Ga0307377_11054544All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes542Open in IMG/M
3300031673|Ga0307377_11070589All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Candidatus Poseidoniia → Candidatus Poseidoniales → unclassified Candidatus Poseidoniales → Candidatus Poseidoniales archaeon536Open in IMG/M
3300031707|Ga0315291_10266376All Organisms → Viruses → Predicted Viral1701Open in IMG/M
3300031707|Ga0315291_10697487All Organisms → Viruses902Open in IMG/M
3300031746|Ga0315293_10500536All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Candidatus Poseidoniia → Candidatus Poseidoniales → unclassified Candidatus Poseidoniales → Candidatus Poseidoniales archaeon939Open in IMG/M
3300031873|Ga0315297_10342824All Organisms → Viruses → Predicted Viral1250Open in IMG/M
3300031885|Ga0315285_10729278Not Available633Open in IMG/M
3300031885|Ga0315285_10762838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae612Open in IMG/M
3300031999|Ga0315274_10154276All Organisms → Viruses → Predicted Viral2910Open in IMG/M
3300031999|Ga0315274_10479653Not Available1414Open in IMG/M
3300032053|Ga0315284_11521444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → Synechococcus lacustris709Open in IMG/M
3300032092|Ga0315905_10176215All Organisms → Viruses → Predicted Viral2118Open in IMG/M
3300032143|Ga0315292_11388588Not Available572Open in IMG/M
3300032163|Ga0315281_10137161All Organisms → Viruses → Predicted Viral2791Open in IMG/M
3300032173|Ga0315268_10256271All Organisms → Viruses → Predicted Viral1685Open in IMG/M
3300032342|Ga0315286_12232984Not Available503Open in IMG/M
3300034072|Ga0310127_122794All Organisms → Viruses → Predicted Viral1073Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.11%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake10.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater8.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake7.78%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment7.22%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil7.22%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.44%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.89%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.89%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.78%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface2.22%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.22%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.22%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand2.22%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.67%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic1.67%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.67%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment1.67%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.11%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.11%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment1.11%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.11%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.11%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment1.11%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment1.11%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond1.11%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments1.11%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.56%
Benthic LakeEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake0.56%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.56%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.56%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.56%
Wetlands BenthicEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic0.56%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment0.56%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.56%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.56%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.56%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300001335Wetlands benthic microbial communities from British Columbia, Canada - ML8EnvironmentalOpen in IMG/M
3300001336ML7EnvironmentalOpen in IMG/M
3300001419Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m)EnvironmentalOpen in IMG/M
3300001580Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6EngineeredOpen in IMG/M
3300001605Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling BasinEngineeredOpen in IMG/M
3300002145S2t7BSb (114f)EnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300005346Saline sediment microbial community from Etoliko Lagoon, GreeceEnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005611Saline surface water microbial communities from Etoliko Lagoon, GreeceEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005943Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14EnvironmentalOpen in IMG/M
3300005955Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007622Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02EnvironmentalOpen in IMG/M
3300007735Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014OctEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008021Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3EnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008962Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009469Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009504Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep SedimentEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010995ECM14MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300012006Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101BEnvironmentalOpen in IMG/M
3300012770Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300014819Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011AEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300017991Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaGEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018542Metatranscriptome of marine microbial communities from Baltic Sea - GS677_3p0EnvironmentalOpen in IMG/M
3300018682Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1EnvironmentalOpen in IMG/M
3300018775Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8EnvironmentalOpen in IMG/M
3300019096Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025135Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027205Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027211Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027547Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027578Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027728 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14mEnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300029933Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12421J11937_1006047333300000756Freshwater And SedimentMKKPDRIDKLLNIDHNNKVITQKRELNPPSFNARFRGKVREKYPDYELK*
ML8_1006958523300001335Wetlands BenthicMEFKNMKNLLIIDHLNKTIKQKRELNPPTFNARFRDKVREQYPDYELK*
ML7_1007657733300001336Benthic LakeMKNLLIIDHLNKTIKQKRELNPPTFNARFRDKVREQYPDYELK*
JGI11705J14877_1004443213300001419Saline Water And SedimentMKKLLIIDHANKMITQKRELNPPTFNARFRDKVREQ
Draft_1015086533300001580Hydrocarbon Resource EnvironmentsMKKNDNIDKLLNIDHNNKVITQKRELNPPTFNCRFRNKVREKYPDYELK*
Draft_1022115623300001605Hydrocarbon Resource EnvironmentsMKKTNKIEKLLNIDHNNKVITQKRELNPPTFNARFRDKVREEYPDYDLQ*
S2t7BSb_1046785613300002145MarineMKKTDSMNKLLIIDHINKVITQKRELNPPSFNGRFRDKIRDQYPDYELK*KNLINF
JGI25910J50241_1008540223300003388Freshwater LakeMDKLLIIDHTNKSITQKRELNPPTFNCLFRDKVKQKYPDYELK*
JGI25911J50253_1020976813300003411Freshwater LakeMKKPNSIDKLLIIDHTNKVITQKRNLNPPSFNGRFRSKVREKYPDYELK*
Ga0074242_1071448953300005346Saline Water And SedimentMEFKNMKKLLIIDHANKTIEQKRELNPPTFNARFRDKVREQYPDYELK*
Ga0074648_1003011283300005512Saline Water And SedimentMKKLLIIDHLNKTIKQKRELNPPTFNARFRDKVREQYPDYELK*
Ga0074648_101036683300005512Saline Water And SedimentMEFKNMKKLLIIDHANKMITQKRELNPPTFNARFRDKVREQ
Ga0074648_101473233300005512Saline Water And SedimentMKKTDNIDKLLNIDHINKIITQKRELNPPSFNGRFRDKVREKYPSYELK*
Ga0070374_1063659413300005517Freshwater LakeMKKPNSIDKLLIIDHTNKVITQKRELNPPSFNGRFRSKVREKYPDYELK*
Ga0049080_1002946433300005582Freshwater LenticMKKTDNMDKLLIIDHNTKVITQKRELNPPTFNGQFRDRVKQKYPDYELK*
Ga0074647_1002566103300005611Saline Water And SedimentMKKLLIIDHANKTIEQKRELNPPTFNARFRDKVREQYPDYELK*
Ga0079957_102308933300005805LakeMKKTDNIDKLLNIDHTNKIITQKRELNPPSFNGRFRDKVREKYPDYELK*
Ga0079957_126020533300005805LakeMKKTDNIDKLLIIDHTNKVITQKRELNPPTFNGRFRDKVREKYPDYDLK*
Ga0073913_1000094623300005940SandMKKTNNIDKLLNIDHNNKIITQKRELNPPSFNARFRNEVRDKYPDYELE*
Ga0070743_1003245333300005941EstuarineMKKPDNIDKLLIIDHANKVITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0073926_1000829623300005943SandMKKTDRIDKLLNIDHINKVISQKRELNPPSFNSRFRDKVRDKYPDYELK*
Ga0073922_104552013300005955SandMKKPDNIDKLLIIDHANKVITQKRELNPPTFNGRFRDKVREKYPDYELK*NI
Ga0070749_1024341333300006802AqueousMKKLLVIDHVNKTIEQKRELNPPTFNARFRDKVREQYPDYELK*
Ga0070749_1024733913300006802AqueousKTDNIDKFLIIDHTNKVITQKRKLNPPTFNGRFRAKVREKYPDYELK*
Ga0070754_1000692533300006810AqueousMKKTDNIDKLLIIDHINKVITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0070752_105999533300007345AqueousMEFKNMKKLLVIDHVNKTIEQKRELNPPTFNARFRDKVREQYPDYELK*
Ga0099851_130321723300007538AqueousMKKTDNIDKLLNIDHINKIITQKRDLNPPTFNGRFRDSVREKYPDYELK*
Ga0099851_130591623300007538AqueousMKKTDKNIKLLNIDHKNKVITQKRELNPPTFNALFRDKVRENYSNYELK*
Ga0099848_119925623300007541AqueousMKNMKKTDNIDKLLNIDHLNKIITQKRVLNPPTFIGIFRYKVREKYPDY*
Ga0099846_105192223300007542AqueousLVKRKCNLNKKIMKKSDNIDKLLNIDHINKIITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0102861_100432533300007544EstuarineMKKPDSIDKLLNIDHTNKVIAQKRELNPPSFNARFRGKVREKYPDYELK*
Ga0102828_103460913300007559EstuarineMKKTNNIDKLLNIDHNNKIITQKRELNPPSFNARFRNEVRDKYPDYELK*
Ga0102921_129016213300007603EstuarineTNKVITQKRELNPPSFNARFRGKVKEKYPDYELK*
Ga0102863_101342233300007622EstuarineMKKTDNIDKLLIIDHTNKVITQKRELNPPSFNARFRGKVKEKYPDYELK*
Ga0104988_10757193300007735FreshwaterLVKRNYNLNESQMKKTDNMDKLLIIDHNTKVITQKRELNPPTFNGQFRDRVKQKYPDYELK*
Ga0104988_110271153300007735FreshwaterMKKTDDMDKLLVIDHSNKIISQKRELNPPSFNARFRDKVRKKYPDYELK*
Ga0099850_106970533300007960AqueousMEFKNMKKLLIIDHVNKTIEQKRELNPPTFNARFRDKVREQYPDYELK*
Ga0099850_107558133300007960AqueousMEFKNMKKLLIIDHANKTIKQKRELNPPTFNARFRDKVREQYPDYELK*
Ga0099850_136287523300007960AqueousMMTFKNLLVDNIDKLLIIDHINKVITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0105747_127627123300007974Estuary WaterMKKINSIDKLLIIDHTNKSITQKRELNPPTFNCLFRDKVKQKYPDYELK*
Ga0105748_1048854613300007992Estuary WaterKMKKINSIDKLLIIDHTNKSITQKRELNPPTFNCLFRDKVKQKYPDYELK*
Ga0075480_1059662913300008012AqueousNIDKLLIIDHINKVITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0102922_110477113300008021EstuarineMKKTDNIDKLLIIDHTNKVITQKRELNPPSFNARFRGKVREKYPDYELK*
Ga0114343_109281323300008110Freshwater, PlanktonMKKTDNIDKLLIIDHANKVITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0104242_102452323300008962FreshwaterMKKTDSIDKLLIIDHNNKVITQKRELNPPSFNGRFRDRVREKYPDYELK*
Ga0102811_123810823300009024EstuarineMKKNDNIDKLLIIDHANKVITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0114973_1002458063300009068Freshwater LakeMKKTNNIDKLLNIDHNNKIITQKRELNPPSFNARFRNEVREKYPDYELK*
Ga0118687_1041833523300009124SedimentMKKSDNIDKLLNIDHLNKIITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0114918_1018882433300009149Deep SubsurfaceIDHTSKVITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0114918_1033380613300009149Deep SubsurfaceMKKLLVIDHTNKTIEQKRELNPPTFNARFRDKVREQYPGYELK*
Ga0114962_1029968513300009151Freshwater LakeMKKTDSIDKLLNIDHNNKVITQKRELNPPSFNGRFRDRVREKYPDYELK*
Ga0114980_1040351323300009152Freshwater LakeMKKTDRIDKLLNIDHINKVISQKRELNPPSFNSRFRDKVREKYPEYELK*
Ga0114977_1029614623300009158Freshwater LakeDHNNKIITQKRELNPPSFNARFRNEVRDKYPDYELK*
Ga0114978_1080668113300009159Freshwater LakeMKKTNNIDKLLNIDHNNKIITQKRELNPPSFNARFRNEIRDKYPDYELE*
Ga0105104_1012735523300009168Freshwater SedimentMKKPDSIDKLLNIDHNDKVITQKRELNPPSFNARFRGKIREKYPDYELK*
Ga0105104_1090705323300009168Freshwater SedimentLVKKSYNLNEIQMKKTDSIDKLLIIDHTNKVITQKRELNPPTFNGRFRDKVRKKYPDYELK*
Ga0114974_1006811133300009183Freshwater LakeMKKTDSIDKLLIIDHNTKVITQKRELNPPSFNSRFRDKVRDKYPDYELK*
Ga0114974_1053338313300009183Freshwater LakeMKKTDNIDKLLSIDHNNKIITQKRELNPPSFNARFRNEVKEKYPDYQLK*
Ga0114976_1023042633300009184Freshwater LakeMKKTNNIDKLLNIDYNNKIITQKRELNPPSFNARFRNEVKEKYPDYQLK*
Ga0126448_102023223300009466Meromictic PondMKKPDNIDKLLIIDHANKVITQKRELNPPTFNVRFRDKVREKYPDYELK*
Ga0127401_103076223300009469Meromictic PondLVKKSYNLNEIQMKKTDSIDKLLIIDHTNKVITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0114946_1060807513300009504SedimentMKKTDSIDKLLNIDHKNKIITQKRELNPPTFNARFRDKVREKYPDYQLK*
Ga0129348_126039113300010296Freshwater To Marine Saline GradientKIMKKSDNIDKLLNIDHLNKIITQKRELNPPTFNGRFRDKVREKYPDYELK*
Ga0136656_105044833300010318Freshwater To Marine Saline GradientMKKSDNIDKLLNIDHLNKIITQKRELNPPTFNGRFRDKVREKYPDYKLK*
Ga0136644_1019413833300010334Freshwater LakeMKKTDSIDKLLNIDHNNKVITQKRELNPPSFNARFRNEVREKYPDYELK*
Ga0129333_10000036223300010354Freshwater To Marine Saline GradientMKKTDRIDKLLNIDHINKVITQKRELNPPTFNARFRDKVREKYPDYELK*
Ga0129333_1011071033300010354Freshwater To Marine Saline GradientMKKTNKIEKLLNIDHNNKVITQKRELNPPTFNARFRDKVREEYPDYELK*
Ga0129333_1080753823300010354Freshwater To Marine Saline GradientMKKTDNMDKLLIIDHNNKIISQKRELNPPTFNARFRDKVREKYPDYKLK*
Ga0129333_1152638523300010354Freshwater To Marine Saline GradientMKKTNKIENLLNIDHNNKVITQKRELNPPTFNARFRDKVRKEYPDYELK*
Ga0129336_1008821723300010370Freshwater To Marine Saline GradientMKKTDKLDKLLIIDHTNKVITQKRELNPPTFNARFRDKVREKYPDYELK*
Ga0139323_10126963300010995SedimentMKKSDNIDKLLNIDHLNKIITQKRELNPPTFNGRFRDKVREKYSDYKLK*
Ga0119955_117484623300012006FreshwaterMKKPNSIDKLLIIDHNAKVITQKRELNPPSFNGRFRSKVREKYPEYELK*
Ga0138291_106854823300012770Freshwater LakeMKKTNNIDKLLNIDYNNKIITQKRELNPPSFNARFRNEVREKYPDYELK*
(restricted) Ga0172367_1006671033300013126FreshwaterMKKTDNIDKLLVIDHINKIISQKRELNPPSFNARFRDKVRKKYPEYELK*
Ga0119954_100147243300014819FreshwaterMKKPNSIDKLLIIDHNAKVITQKRELNPPSFNGRFRSKVREKYPEYQLK*
Ga0181369_111057623300017708MarineMKKLLIFDHVNKTIEQKRELNPPSWNGRFRDKVKEEY
Ga0181403_106493423300017710SeawaterMELKNMKKLLIFDHVNKTIEQKRELNPPSWNGRFRDKVKEEFPDYTLK
Ga0181347_118555123300017722Freshwater LakeMNKLLIIDHTNKSITQKRELNPPTFNCLFRDKVKQKY
Ga0181392_103673433300017749SeawaterMEFKNMKKLLIFDHVNKTIEQKRELNPPSWNGRFRDKVKEEFPDYTLK
Ga0181356_101087533300017761Freshwater LakeMKKPNSIDKLLIIDHTNKVITQKRELNPPSFNGRFRSKIREKYPDYELK
Ga0187217_115026233300017770SeawaterMEFKNMKKLLIFDHVNKTIEQKRELNPPSWNGRFRDKVKEEYPDYTLK
Ga0181424_1006677733300017786SeawaterMEFKNMKKLLIFDHVNKTIEQKRELNPPSWNGRFRDKVKKEFPDYTLK
Ga0169931_1014067733300017788FreshwaterMKKTDNIDKLLVIDHINKIISQKRELNPPSFNARFRDKVRKKYPEYELK
Ga0169931_1017201433300017788FreshwaterMKKTDNMDKLLIIDHTNKVISQKRELNPPTFNARFRDKVREKYPDYELK
Ga0180437_1013127633300017963Hypersaline Lake SedimentMKKLLIIDHENKTIEQKRELNPPTFNARFRDKVREQYPDYELK
Ga0180434_1122071623300017991Hypersaline Lake SedimentMEFKNMKKLLIIDHVNKTIEQKRELNPPTFNARFRDKVREQYPDYELK
Ga0181553_1051253023300018416Salt MarshMKKPNSIDKLLIIDHNAKVITQKRELNPPSFNGRFRSKVREKYPEYELK
Ga0188841_10007423300018542Freshwater LakeMKKLDSIDKLLNIDHNNKVITQKRELNPPSFNARFRGKVREKYPDYELK
Ga0188841_10025323300018542Freshwater LakeMKKTDNIDKLLIIDHTNKVITQKRELNPPSFNARFRGKVREKYPDYELK
Ga0188851_100424533300018682Freshwater LakeMKKTDSMNKLLIIDHINKVITQKRELNPPSFNGRFRDKIRDEYPDYELK
Ga0188851_102377733300018682Freshwater LakeHNNKVITQKRELNPPSFNARFRGKVKEKYPDYELK
Ga0188848_101534723300018775Freshwater LakeMSKKPDTIDKLLNIDHNNRVITQKRELNPPSFNARFRGKVREKYPDYELK
Ga0188835_100643513300019096Freshwater LakeSMNKLLIIDHINKVITQKRELNPPSFNGRFRDKIRDEYPDYELK
Ga0188835_100656713300019096Freshwater LakeAIDKLLNIDHNNRVITQKRELNPPSFNARFRGKVREKYPDYELK
Ga0181359_112629433300019784Freshwater LakeMKKSDNIDKLLIIDHNTKVITQKRELNPPTFNGRFRDKVRE
Ga0181359_118225423300019784Freshwater LakeMDKLLIIDHTNKSITQKRELNPPTFNCLFRDKVKQKYPDYELK
Ga0211736_1089424013300020151FreshwaterMKKPDRIDKLLNIDHNNKVITQKRELNPPSFNAHFRGKVREKYPDYELK
Ga0211729_1042599223300020172FreshwaterMKKTDNMDKLLIIDHNNKIISQKRELNPPTFNARFRDKVREKYPDYKLK
Ga0213867_128125513300021335SeawaterDNIDKLLNIDYLNKIITQKRELNPPTFNGRFRDKVREKYPDYELK
Ga0213858_1016586733300021356SeawaterMTQHNVSARIDKLLNIDHINKVITQKRELNPPTFNSRFRDKVREKYPDYELK
Ga0213859_10000226683300021364SeawaterMKKLLIIDHLNKTIEQKRELNPPTFNAHFRDKVREQYPDYELK
Ga0213864_1004063813300021379SeawaterMKKSDNIDKLLNIDHLNKIITQKRELNPPTFNGRFRDKVREKYPDY
Ga0213866_1008491123300021425SeawaterMKKTDKNIKLLNIDHKNKVITQKRELNPPTFNALFRDKVRENYSNYELK
Ga0222714_1016846033300021961Estuarine WaterMKKTDNIDKFLIIDHTNKVITQKRKLNPPTFNGRFRAKVREKYPDYELK
Ga0222714_1018725013300021961Estuarine WaterMKKTNNIDKLLNIDHNNKIITQKRELNPPSFNARFRNEVRDKYPDYELE
Ga0222719_1010283533300021964Estuarine WaterMKKLLVIDHTNKIIEQKRELNPPTFNARFRDKVREQYPDYELK
Ga0222719_1032475523300021964Estuarine WaterMKKLLVIDHVNKTIEQKRELNPPTFNARFRDKVREQYPDYELK
Ga0212029_101223433300022063AqueousMKKLLIIDHANKTIEQKRELNPPTFNARFRDKVREQYPDYELK
Ga0196899_110074123300022187AqueousMKKTDNIDKLLIIDHINKVITQKRELNPPTFNGRFRDKVREKYPDYELK
Ga0181354_106457723300022190Freshwater LakeMKKPNSIDKLLIIDHTNKVITQKRELNPPSFNGRFRSKVREKYPDYELK
Ga0196905_100786033300022198AqueousMKKSDNIDKLLNIDHLNKIITQKRELNPPTFNGRFRDKVREKYPDYELK
Ga0196905_102671533300022198AqueousMKKTDNIDKLLNIDHFNKIITQKRELNPPTFNGRFRDKVREKYPDYKLK
Ga0196901_126276013300022200AqueousDKLLNIDHLNKIITQKRELNPPTFNGRFRDKVREKYPDYKLK
Ga0181351_107906943300022407Freshwater LakeMKKQDNIDKLLFIDHINKVISQKTQLNPPSLNSRFRDKVREKYPDYELK
Ga0181351_112953133300022407Freshwater LakeMKKSDNIDKLLIIDHNTKVITQKRELNPPTFNGRFRDKVREKYPDYELK
Ga0181351_122432023300022407Freshwater LakeMKKTNSIDKFLNIDHNNKIITQKRELNPPSFNARFRNEVRDKYPDYELK
Ga0214917_10000203163300022752FreshwaterMKKTNNIDKLLNIDYNNKIITQKRELNPPSFNARFRNEVREKYPDYELK
Ga0214917_1002059973300022752FreshwaterMKKSDNIDKLLIIDHNTKVITQKRELNPPSFNGRFRDRVREKYPDYELK
Ga0214917_1012087033300022752FreshwaterMKKTDNMDKLLIIDHNTKVITQKRELNPPTFNGQFRDRVKQKYPDYELK
Ga0214917_1021358923300022752FreshwaterMKKPNSIDKLLIIDHNAKVITQKRELNPPSFNGRFRSKVREKYPDYELKXKRKFGECLVQ
Ga0214923_10000476153300023179FreshwaterMKKPNSIDKLLIIDHNAKVITQKRELNPPSFNGRFRSKVREKYPEYQLK
Ga0214919_1015778933300023184FreshwaterMKKPNSIDKLLIIDHNAKVITQKRELNPPSFNGRFRSKVREKYLEYELK
Ga0210003_102380813300024262Deep SubsurfaceMKKTDNIDKLLIIDHTSKVITQKRELNPPTFNGRFRDKVREKYPDYELK
Ga0210003_113435733300024262Deep SubsurfaceMKKTDNIDKLLIIDHTSKVITQKRELNPPTFNGRFRDKVREKYPDYE
Ga0244775_10000169463300024346EstuarineMKKPDNIDKLLIIDHANKVITQKRELNPPTFNGRFRDKVREKYPDYELK
Ga0244775_10003922203300024346EstuarineMKKTNNIDKLLNIDHNNKIITQKRELNPPSFNARFRNEVRDKYPDYELK
Ga0209498_131464813300025135SedimentMKKTDSIDKLLNIDHKNKIITQKRELNPPTFNARFRDKVREKYPDYQLK
Ga0208161_1000049443300025646AqueousMKKSDNIDKLLNIDHLNKIITQKRELNPPTFNGRFRDKVREKYPDYKLK
Ga0208161_101617733300025646AqueousMKKTDNIDKLLNIDHINKIITQKRDLNPPTFNGRFRDSVREKYPDYELK
Ga0208019_102239213300025687AqueousMKKLLIIDHANKTIKQKRELNPPTFNARFRDKVREQYPDYELK
Ga0208926_101413923300027205EstuarineMKKPDSIDKLLNIDHTNKVIAQKRELNPPSFNARFRGKVREKYPDYELK
Ga0208307_100004033300027211EstuarineMKKTDNIDKLLIIDHTNKVITQKRELNPPSFNARFRGKVKEKYPDYELK
Ga0209864_101734313300027547SandIMKKTNNIDKLLNIDHNNKIITQKRELNPPSFNARFRNEVRDKYPDYELE
Ga0255075_108449213300027578FreshwaterMKKTNNIDKLLNIDHNNKIITQKRELNPPSFNARFRNEVRDKY
Ga0208966_100672033300027586Freshwater LenticMKKPNSIDKLLIIDHTNKVITQKRNLNPPSFNGRFRSKVREKYPDYELK
Ga0209188_112333533300027708Freshwater LakeMKKTDSIDKLLNIDHNNKVITQKRELNPPSFNGRFRDRVREKYPDYELK
(restricted) Ga0247836_101283923300027728FreshwaterMKKPNSIDKLLIIDHTNKVITQKRKLNPPSFNGRFRSKVREKYPDYELK
(restricted) Ga0247836_1018113103300027728FreshwaterMKKNDSIDKLLIIDHINKVITQKRELNPPSFNGRFRDRVRDRYPEYELKSGSSE
(restricted) Ga0247833_121079113300027730FreshwaterMKKPNSIDKLLIIDHTNKVITQKRKLNPPSFNGRFRSKVREKYPDYELKXKTKSGECPV
Ga0209084_105985033300027749Freshwater LakeMKKTDSIDKLLIIDHNNKVITQKRELNPPSFNGRFRDRVREKYPDYELK
Ga0209296_108731833300027759Freshwater LakeMKKTDNIDKLLSIDHNNKIITQKRELNPPSFNARFRNEVKEKYPDYQLK
Ga0209768_1016423333300027772Freshwater LakeNSIDKLLIIDHTNKVITQKRNLNPPSFNGRFRSKVREKYPDYELK
Ga0209500_1011137823300027782Freshwater LakeMKKTDRIDKLLNIDHINKVISQKRELNPPSFNSRFRDKVREKYPEYELK
Ga0209107_10000631233300027797Freshwater And SedimentLKKVKQMKKPDRIDKLLNIDHNNKVITQKRELNPPSFNARFRGKVREKYPDYELK
Ga0209079_1002240313300027972Freshwater SedimentMKKPDNIDKLLIIDHANKVITQKRELNPPSFNARFRGKIREKYPDYELK
(restricted) Ga0247834_106145823300027977FreshwaterMKKIDSIDKLLIIDHTNKSITQKRELNPPTFNCRFRDKVKQKYPDYELK
(restricted) Ga0247835_122298323300028114FreshwaterMKKTDNMDKLLIIDHNTKVITQKRELNPPTFNGQFRDRVKQKY
(restricted) Ga0247843_110865053300028569FreshwaterMINILKDTMKKINNMDKLLIIDHVNKVIIQERELNPPTWNCHFRSRVKEKYPDYELK
(restricted) Ga0247843_130468033300028569FreshwaterMKKIDNIDKLLIIDYNTKVITQKRELNPPTFNCRFRDKVKQKYPDYQLK
Ga0119944_101620823300029930AquaticMKKTDSIDKLLIIDHANKVITQKRELNPPTFNALFKSKVKEKYPDYKLK
Ga0119944_105018023300029930AquaticKNQMKKTDDMDKLLVIDHSNKIISQKRELNPPSFNARFRDKVRKKYPDYELK
Ga0119945_103721113300029933AquaticMKKTDDMDKLLVIDHSNKIISQKRELNPPSFNARFRDKVRKKYPDYELK
Ga0307380_1059005033300031539SoilMKKLLVIDHTNKTIEQKRELNPPTFNARFRDKVREQYPGYELK
Ga0307380_1069516423300031539SoilMSKKPDSIDKLLNIDHNNKVITQKRELNPPSFNARFRGKVREKYPGYELK
Ga0307380_1076944723300031539SoilMKKTDNIDKLLIIDHTNKVITQKRELNPPSFNARFRGKVREKYPDYEL
Ga0307379_1007294833300031565SoilMKKPDSINKLLSIDHTNKVITQKRELNPPSFNARFRGKVREKYPGYELK
Ga0307379_1152799733300031565SoilMSKKPDSIDKLLNIDHNNKVITQKRELNPPSFNARFRGKVREKYPDYELK
Ga0307378_1032919943300031566SoilMKKPDSIDKLLNIDHTNKVITQKRELNPPSFNARFRGKVREKYPDYELK
Ga0307378_1072128723300031566SoilMKKPDSIDKLLNIDHNNKVITQKRELNPPSFNARFRGKVKEKYPDYELK
Ga0307376_1017177333300031578SoilMKKTDSMNKLLIIDHINKVITQKRELNPPSFNGRFRDKIRDQYPDYELK
Ga0307376_1019290623300031578SoilMKKTDNIDKLLIIDHTNKVITQKRELNPPSFNARFCGNVREKYPDYELK
Ga0307376_1029307323300031578SoilMKKPDNIDKLLNIDHNNKVITQKRELNPPSFNARFRGKVKEKYPDYELK
Ga0307377_1037157433300031673SoilMKKPDSINKLLSIDHTNKVITQKRELNPPSFNARFRGKVREKYPDYELK
Ga0307377_1105454423300031673SoilMKKPNSIDKLLIIDHTNKVITQKRELNPPSFNGRFRSKVREKYPDYELKXKPKSGECLVQ
Ga0307377_1107058923300031673SoilLLNIDHTNKVITQKRELNPPSFNARFRGKVREKYPDYELK
Ga0315291_1026637623300031707SedimentMKKTDNIDKLLNIDHNNKIITQKRELNPPSFNARFRNEVRDKYPDYELK
Ga0315291_1069748733300031707SedimentMKKINSIDKLLIIDHTNKSITQKRELNPPTFNCLFRDKVKQKYHDYELK
Ga0315293_1050053623300031746SedimentMKKTDNIDKLLIIDHTNKVITQKRELNPPSFNARFGGKIRE
Ga0315297_1034282423300031873SedimentMKKTDNIDKLLIIDHTNKVITQKRELNPPSFNARFGGKIREKYPDYELK
Ga0315285_1072927833300031885SedimentMKKINSIDKLLVIDHTNKSITQKRELNPPTFNCLFRDKVKQKYPDYELK
Ga0315285_1076283823300031885SedimentMKIDNIDKFLIIDHKNKIISQKRELNPPSFNARFRCEIKKKYPDYELK
Ga0315274_1015427643300031999SedimentMKKINSIDKLLIIDHTNKSITQKRELNPPTFNCLFRDKVKQKYPDYELK
Ga0315274_1047965313300031999SedimentMKKTDNIDKLLIIDHTNKVITQKRELNPPSFNARFGGKVREKYPDYELK
Ga0315284_1152144423300032053SedimentMKKTDRIDKLLNIDHINKVISQKRELNPPSFNGRFRDKVREKYPDYELK
Ga0315905_1017621513300032092FreshwaterKKSYNLNEIQMKKSDNIDKLLIIDHNTKVITQKRELNPPTFNGRFRDKVREKYPDYELK
Ga0315292_1138858823300032143SedimentMKKPDSIDKLLNIDHTNKVITQKRELNPPSFNARFRSKVREKYPDYELK
Ga0315281_1013716123300032163SedimentMKKPDRIDKLLNIDHNNKVITQKRELNPPSFNARFRGKVREKYPDYELK
Ga0315268_1025627123300032173SedimentMKKTDSIDKLLNIDHINKVISQKRELNPPSFNGRFRDKVREKYPDYELK
Ga0315286_1223298413300032342SedimentMKKPDSIDKLLNIDHTNKVIAQKRELNPPSFNARFRGKVREK
Ga0310127_122794_228_3743300034072Fracking WaterMEFKNMKKLLVIDHVNKTIEQKRELNPPTFNARFRDKVREQYPDYELK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.