


| Basic Information | |
|---|---|
| Family ID | F032273 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPAAPKTEQPKKSK |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 62.57 % |
| % of genes near scaffold ends (potentially truncated) | 39.44 % |
| % of genes from short scaffolds (< 2000 bps) | 74.44 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (37.778 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (13.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (84.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.80% β-sheet: 0.00% Coil/Unstructured: 94.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF00959 | Phage_lysozyme | 1.67 |
| PF13306 | LRR_5 | 1.11 |
| PF03237 | Terminase_6N | 1.11 |
| PF03796 | DnaB_C | 0.56 |
| PF07486 | Hydrolase_2 | 0.56 |
| PF13392 | HNH_3 | 0.56 |
| PF00772 | DnaB | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.11 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.56 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.22 % |
| Unclassified | root | N/A | 37.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2100351011|ASMM170b_contig01482__length_1003___numreads_13 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1003 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10045877 | All Organisms → Viruses → Predicted Viral | 2231 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10050081 | All Organisms → Viruses → Predicted Viral | 2094 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10051866 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium BACL24 MAG-120322-bin51 | 2042 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10076126 | All Organisms → Viruses → Predicted Viral | 1513 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10003404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9721 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10010676 | All Organisms → Viruses → Predicted Viral | 4856 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10069830 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10080689 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10140157 | Not Available | 731 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10171578 | Not Available | 625 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10262257 | Not Available | 521 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10000267 | All Organisms → cellular organisms → Bacteria | 31535 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10012127 | Not Available | 4817 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10063971 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 1523 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10156446 | Not Available | 746 | Open in IMG/M |
| 3300001347|JGI20156J14371_10054732 | All Organisms → Viruses → Predicted Viral | 1634 | Open in IMG/M |
| 3300001347|JGI20156J14371_10071295 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300001347|JGI20156J14371_10090689 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300001348|JGI20154J14316_10112571 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium BACL24 MAG-120322-bin51 | 828 | Open in IMG/M |
| 3300001349|JGI20160J14292_10018286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4082 | Open in IMG/M |
| 3300001351|JGI20153J14318_10081863 | Not Available | 971 | Open in IMG/M |
| 3300001352|JGI20157J14317_10134994 | Not Available | 799 | Open in IMG/M |
| 3300001450|JGI24006J15134_10061250 | All Organisms → Viruses → Predicted Viral | 1486 | Open in IMG/M |
| 3300001460|JGI24003J15210_10025200 | All Organisms → Viruses → Predicted Viral | 2217 | Open in IMG/M |
| 3300001460|JGI24003J15210_10104896 | Not Available | 801 | Open in IMG/M |
| 3300001472|JGI24004J15324_10019053 | All Organisms → Viruses → Predicted Viral | 2347 | Open in IMG/M |
| 3300001589|JGI24005J15628_10047726 | All Organisms → Viruses → Predicted Viral | 1675 | Open in IMG/M |
| 3300001967|GOS2242_1092335 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium BACL24 MAG-120322-bin51 | 1771 | Open in IMG/M |
| 3300002930|Water_100860 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCGC AAA164-I21 | 6030 | Open in IMG/M |
| 3300004097|Ga0055584_100933916 | Not Available | 908 | Open in IMG/M |
| 3300004113|Ga0065183_10253211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 779 | Open in IMG/M |
| 3300004279|Ga0066605_10049331 | All Organisms → Viruses → Predicted Viral | 1910 | Open in IMG/M |
| 3300004279|Ga0066605_10145764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 943 | Open in IMG/M |
| 3300004448|Ga0065861_1004125 | All Organisms → cellular organisms → Bacteria | 10515 | Open in IMG/M |
| 3300004448|Ga0065861_1036308 | Not Available | 962 | Open in IMG/M |
| 3300004448|Ga0065861_1048444 | Not Available | 760 | Open in IMG/M |
| 3300004448|Ga0065861_1048453 | Not Available | 760 | Open in IMG/M |
| 3300004460|Ga0066222_1009203 | Not Available | 986 | Open in IMG/M |
| 3300004461|Ga0066223_1017398 | Not Available | 769 | Open in IMG/M |
| 3300004461|Ga0066223_1037480 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
| 3300005589|Ga0070729_10255469 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium BACL24 MAG-120322-bin51 | 998 | Open in IMG/M |
| 3300005600|Ga0070726_10010844 | All Organisms → cellular organisms → Bacteria | 6162 | Open in IMG/M |
| 3300005821|Ga0078746_1042343 | Not Available | 977 | Open in IMG/M |
| 3300005941|Ga0070743_10002797 | All Organisms → cellular organisms → Bacteria | 6503 | Open in IMG/M |
| 3300005942|Ga0070742_10142662 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium BACL24 MAG-120322-bin51 | 665 | Open in IMG/M |
| 3300006027|Ga0075462_10221094 | Not Available | 566 | Open in IMG/M |
| 3300006029|Ga0075466_1129378 | Not Available | 664 | Open in IMG/M |
| 3300006484|Ga0070744_10146188 | Not Available | 678 | Open in IMG/M |
| 3300006752|Ga0098048_1026245 | All Organisms → Viruses → Predicted Viral | 1917 | Open in IMG/M |
| 3300006752|Ga0098048_1147831 | Not Available | 701 | Open in IMG/M |
| 3300006793|Ga0098055_1069823 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
| 3300006802|Ga0070749_10014817 | All Organisms → Viruses → Predicted Viral | 4969 | Open in IMG/M |
| 3300006803|Ga0075467_10120403 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
| 3300006803|Ga0075467_10165666 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
| 3300006803|Ga0075467_10552529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 590 | Open in IMG/M |
| 3300006810|Ga0070754_10155052 | All Organisms → Viruses → Predicted Viral | 1092 | Open in IMG/M |
| 3300006916|Ga0070750_10322822 | Not Available | 656 | Open in IMG/M |
| 3300006922|Ga0098045_1166488 | Not Available | 502 | Open in IMG/M |
| 3300007229|Ga0075468_10069644 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
| 3300007231|Ga0075469_10099615 | Not Available | 817 | Open in IMG/M |
| 3300007539|Ga0099849_1076782 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
| 3300007540|Ga0099847_1093928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 916 | Open in IMG/M |
| 3300007543|Ga0102853_1065446 | Not Available | 650 | Open in IMG/M |
| 3300007554|Ga0102820_1168382 | Not Available | 530 | Open in IMG/M |
| 3300007692|Ga0102823_1024178 | All Organisms → Viruses → Predicted Viral | 1670 | Open in IMG/M |
| 3300007953|Ga0105738_1054726 | Not Available | 655 | Open in IMG/M |
| 3300009024|Ga0102811_1002111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9259 | Open in IMG/M |
| 3300009024|Ga0102811_1087370 | All Organisms → Viruses → Predicted Viral | 1167 | Open in IMG/M |
| 3300009071|Ga0115566_10816424 | Not Available | 512 | Open in IMG/M |
| 3300009130|Ga0118729_1032427 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium BACL24 MAG-120322-bin51 | 3256 | Open in IMG/M |
| 3300009422|Ga0114998_10517369 | Not Available | 560 | Open in IMG/M |
| 3300009426|Ga0115547_1106819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 919 | Open in IMG/M |
| 3300009434|Ga0115562_1045312 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
| 3300009434|Ga0115562_1313180 | Not Available | 536 | Open in IMG/M |
| 3300009441|Ga0115007_10002516 | All Organisms → cellular organisms → Bacteria | 11262 | Open in IMG/M |
| 3300009442|Ga0115563_1118132 | All Organisms → Viruses → Predicted Viral | 1105 | Open in IMG/M |
| 3300009442|Ga0115563_1344540 | Not Available | 537 | Open in IMG/M |
| 3300009496|Ga0115570_10444399 | Not Available | 547 | Open in IMG/M |
| 3300009507|Ga0115572_10069235 | All Organisms → Viruses → Predicted Viral | 2177 | Open in IMG/M |
| 3300009599|Ga0115103_1768857 | All Organisms → Viruses → Predicted Viral | 1684 | Open in IMG/M |
| 3300010392|Ga0118731_100422161 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300010392|Ga0118731_114338908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1200 | Open in IMG/M |
| 3300010430|Ga0118733_101351760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1421 | Open in IMG/M |
| 3300011118|Ga0114922_10248103 | All Organisms → Viruses → Predicted Viral | 1493 | Open in IMG/M |
| 3300011128|Ga0151669_119706 | Not Available | 529 | Open in IMG/M |
| 3300011253|Ga0151671_1021839 | Not Available | 630 | Open in IMG/M |
| 3300011253|Ga0151671_1083211 | Not Available | 561 | Open in IMG/M |
| 3300011254|Ga0151675_1055807 | Not Available | 559 | Open in IMG/M |
| 3300013010|Ga0129327_10067169 | All Organisms → Viruses → Predicted Viral | 1772 | Open in IMG/M |
| 3300017697|Ga0180120_10291686 | Not Available | 654 | Open in IMG/M |
| 3300017713|Ga0181391_1002483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 5165 | Open in IMG/M |
| 3300017725|Ga0181398_1000619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10649 | Open in IMG/M |
| 3300017727|Ga0181401_1152488 | Not Available | 563 | Open in IMG/M |
| 3300017751|Ga0187219_1011476 | All Organisms → Viruses → Predicted Viral | 3431 | Open in IMG/M |
| 3300017751|Ga0187219_1033316 | All Organisms → Viruses → Predicted Viral | 1791 | Open in IMG/M |
| 3300017752|Ga0181400_1000447 | All Organisms → cellular organisms → Bacteria | 17683 | Open in IMG/M |
| 3300017752|Ga0181400_1001324 | Not Available | 10272 | Open in IMG/M |
| 3300017767|Ga0181406_1007997 | Not Available | 3494 | Open in IMG/M |
| 3300017824|Ga0181552_10080661 | All Organisms → Viruses → Predicted Viral | 1841 | Open in IMG/M |
| 3300018413|Ga0181560_10307346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 741 | Open in IMG/M |
| 3300020166|Ga0206128_1146434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 958 | Open in IMG/M |
| 3300020185|Ga0206131_10051662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2746 | Open in IMG/M |
| 3300020185|Ga0206131_10068253 | Not Available | 2228 | Open in IMG/M |
| 3300020187|Ga0206130_10012194 | All Organisms → cellular organisms → Bacteria | 8514 | Open in IMG/M |
| 3300020187|Ga0206130_10014126 | All Organisms → cellular organisms → Bacteria | 7667 | Open in IMG/M |
| 3300020187|Ga0206130_10025582 | All Organisms → cellular organisms → Bacteria | 4983 | Open in IMG/M |
| 3300020385|Ga0211677_10058572 | All Organisms → Viruses → Predicted Viral | 1753 | Open in IMG/M |
| 3300020595|Ga0206126_10011154 | All Organisms → cellular organisms → Bacteria | 6974 | Open in IMG/M |
| 3300021365|Ga0206123_10334776 | Not Available | 636 | Open in IMG/M |
| 3300021957|Ga0222717_10001605 | All Organisms → cellular organisms → Bacteria | 18286 | Open in IMG/M |
| 3300021957|Ga0222717_10077714 | All Organisms → Viruses → Predicted Viral | 2104 | Open in IMG/M |
| 3300021960|Ga0222715_10298830 | Not Available | 916 | Open in IMG/M |
| 3300021960|Ga0222715_10378080 | Not Available | 781 | Open in IMG/M |
| 3300022053|Ga0212030_1038771 | Not Available | 670 | Open in IMG/M |
| 3300022065|Ga0212024_1061408 | Not Available | 664 | Open in IMG/M |
| 3300022169|Ga0196903_1032507 | Not Available | 616 | Open in IMG/M |
| 3300022178|Ga0196887_1024360 | All Organisms → Viruses → Predicted Viral | 1757 | Open in IMG/M |
| 3300022178|Ga0196887_1088206 | Not Available | 713 | Open in IMG/M |
| 3300022187|Ga0196899_1161228 | Not Available | 617 | Open in IMG/M |
| 3300022220|Ga0224513_10259533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 688 | Open in IMG/M |
| 3300022221|Ga0224506_10294908 | Not Available | 730 | Open in IMG/M |
| 3300022923|Ga0255783_10161029 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
| 3300022925|Ga0255773_10081299 | All Organisms → Viruses → Predicted Viral | 1777 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10151070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 757 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10570111 | Not Available | 514 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10018662 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium BACL24 MAG-120322-bin51 | 1943 | Open in IMG/M |
| 3300023568|Ga0228696_1033725 | Not Available | 586 | Open in IMG/M |
| 3300023702|Ga0232119_1005203 | All Organisms → Viruses → Predicted Viral | 1989 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10000412 | All Organisms → cellular organisms → Bacteria | 11154 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10466436 | Not Available | 549 | Open in IMG/M |
| 3300024185|Ga0228669_1004938 | All Organisms → cellular organisms → Bacteria | 3933 | Open in IMG/M |
| 3300024236|Ga0228655_1017811 | All Organisms → Viruses → Predicted Viral | 1796 | Open in IMG/M |
| 3300024248|Ga0228676_1072455 | Not Available | 766 | Open in IMG/M |
| 3300024321|Ga0228626_1048146 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300024326|Ga0228652_1102894 | Not Available | 656 | Open in IMG/M |
| (restricted) 3300024340|Ga0255042_10047987 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300024346|Ga0244775_10046229 | All Organisms → Viruses → Predicted Viral | 3810 | Open in IMG/M |
| 3300024359|Ga0228628_1083595 | Not Available | 627 | Open in IMG/M |
| 3300024359|Ga0228628_1085780 | Not Available | 615 | Open in IMG/M |
| 3300024420|Ga0228632_1055512 | Not Available | 927 | Open in IMG/M |
| (restricted) 3300024517|Ga0255049_10580693 | Not Available | 522 | Open in IMG/M |
| (restricted) 3300024528|Ga0255045_10046617 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| 3300025083|Ga0208791_1021380 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300025084|Ga0208298_1022055 | All Organisms → Viruses → Predicted Viral | 1402 | Open in IMG/M |
| 3300025127|Ga0209348_1043672 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300025138|Ga0209634_1024277 | Not Available | 3318 | Open in IMG/M |
| 3300025570|Ga0208660_1069277 | Not Available | 830 | Open in IMG/M |
| 3300025577|Ga0209304_1085159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 744 | Open in IMG/M |
| 3300025590|Ga0209195_1116216 | Not Available | 576 | Open in IMG/M |
| 3300025621|Ga0209504_1028772 | All Organisms → Viruses → Predicted Viral | 1958 | Open in IMG/M |
| 3300025621|Ga0209504_1164794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 517 | Open in IMG/M |
| 3300025641|Ga0209833_1007832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 5104 | Open in IMG/M |
| 3300025645|Ga0208643_1099175 | Not Available | 801 | Open in IMG/M |
| 3300025645|Ga0208643_1120679 | Not Available | 695 | Open in IMG/M |
| 3300025645|Ga0208643_1140113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 623 | Open in IMG/M |
| 3300025759|Ga0208899_1048844 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium BACL24 MAG-120322-bin51 | 1825 | Open in IMG/M |
| 3300025874|Ga0209533_1000541 | All Organisms → cellular organisms → Bacteria | 35863 | Open in IMG/M |
| 3300025883|Ga0209456_10033659 | All Organisms → Viruses → Predicted Viral | 2311 | Open in IMG/M |
| 3300026460|Ga0247604_1088274 | Not Available | 713 | Open in IMG/M |
| 3300026479|Ga0228622_1003028 | All Organisms → cellular organisms → Bacteria | 6489 | Open in IMG/M |
| 3300027757|Ga0208671_10166767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 797 | Open in IMG/M |
| 3300027757|Ga0208671_10191692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 736 | Open in IMG/M |
| 3300027790|Ga0209273_10060419 | All Organisms → Viruses → Predicted Viral | 1732 | Open in IMG/M |
| 3300027810|Ga0209302_10039330 | All Organisms → Viruses → Predicted Viral | 2581 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10057182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1514 | Open in IMG/M |
| 3300028008|Ga0228674_1210171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 621 | Open in IMG/M |
| 3300028125|Ga0256368_1008116 | All Organisms → Viruses → Predicted Viral | 1723 | Open in IMG/M |
| 3300028131|Ga0228642_1162011 | Not Available | 527 | Open in IMG/M |
| 3300028598|Ga0265306_10802967 | Not Available | 521 | Open in IMG/M |
| 3300028599|Ga0265309_11316556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 504 | Open in IMG/M |
| 3300031622|Ga0302126_10325584 | Not Available | 513 | Open in IMG/M |
| 3300031626|Ga0302121_10173237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → unclassified Opitutaceae → Opitutaceae bacterium BACL24 MAG-120322-bin51 | 615 | Open in IMG/M |
| 3300031774|Ga0315331_10180172 | All Organisms → Viruses → Predicted Viral | 1573 | Open in IMG/M |
| 3300031851|Ga0315320_10017265 | All Organisms → cellular organisms → Bacteria | 5766 | Open in IMG/M |
| 3300032277|Ga0316202_10028979 | All Organisms → Viruses → Predicted Viral | 2674 | Open in IMG/M |
| 3300032277|Ga0316202_10033953 | All Organisms → Viruses → Predicted Viral | 2437 | Open in IMG/M |
| 3300032277|Ga0316202_10211505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 900 | Open in IMG/M |
| 3300034375|Ga0348336_108899 | Not Available | 917 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.33% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 8.33% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 7.78% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 7.22% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.22% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 6.11% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 4.44% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.89% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.89% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.78% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.78% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.78% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.22% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.22% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.22% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.22% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.67% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.11% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.11% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.11% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.11% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.11% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.56% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.56% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.56% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.56% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.56% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2100351011 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cm | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004113 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2) | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007953 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3um | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009130 | Combined Assembly of Gp0139511, Gp0139512 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300023568 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023702 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024185 | Seawater microbial communities from Monterey Bay, California, United States - 84D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
| 3300024321 | Seawater microbial communities from Monterey Bay, California, United States - 31D | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024359 | Seawater microbial communities from Monterey Bay, California, United States - 34D | Environmental | Open in IMG/M |
| 3300024420 | Seawater microbial communities from Monterey Bay, California, United States - 40D | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024528 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23 | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300026460 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028131 | Seawater microbial communities from Monterey Bay, California, United States - 53D | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ASMM170b_04561850 | 2100351011 | Coastal Water And Sediment | MGKGCAPRKGHNQEKQSKNYDAIDWSKKTKSTKSKLPQTEQPKSK |
| DelMOSum2010_100458773 | 3300000101 | Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPRTEQPRSKGK* |
| DelMOSum2010_100500814 | 3300000101 | Marine | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPAVQKMDKPAKSK* |
| DelMOSum2010_100518665 | 3300000101 | Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK* |
| DelMOSum2010_100761265 | 3300000101 | Marine | LSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK* |
| DelMOSum2011_1000340414 | 3300000115 | Marine | MKGAVTMSTKGSGPRKGHNAEKQRKNYDDIDWSKKPPAPRTEQPKPSK* |
| DelMOSum2011_100106769 | 3300000115 | Marine | TMSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK* |
| DelMOSum2011_100698301 | 3300000115 | Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPRTEQPKASK* |
| DelMOSum2011_100806893 | 3300000115 | Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPTAPKTEQPLSKEK* |
| DelMOSum2011_101401571 | 3300000115 | Marine | KGHNAEKQRKNYDDIDWSKKPSAPRTEQPRSKSK* |
| DelMOSum2011_101715784 | 3300000115 | Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSNKTKSTKSKPPPTEQPKASK* |
| DelMOSpr2010_102622574 | 3300000116 | Marine | MKGAATMSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKT |
| DelMOWin2010_100002679 | 3300000117 | Marine | MGKGSAPRKGHNAEKQRENYDEIDWSKKPAKTSKPNVPKQK* |
| DelMOWin2010_100121273 | 3300000117 | Marine | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPKVQKVDKQAKSK* |
| DelMOWin2010_100639712 | 3300000117 | Marine | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPAVQKMDKPAKSK* |
| DelMOWin2010_101564462 | 3300000117 | Marine | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPAKSKKC* |
| JGI20156J14371_100547322 | 3300001347 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPKTEQPRPKSK* |
| JGI20156J14371_100712953 | 3300001347 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPRTEQPKGSK* |
| JGI20156J14371_100906891 | 3300001347 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDCIDWSKKPTAPRTEQPRSKSK* |
| JGI20154J14316_101125711 | 3300001348 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPRTEQPHSKGK* |
| JGI20160J14292_100182864 | 3300001349 | Pelagic Marine | MSTKGSGPRKGHNQEKQRKNYDDIDWSKKPPAPRTEQPKSSK* |
| JGI20153J14318_100818632 | 3300001351 | Pelagic Marine | GPRKGHNAEKQRKNYDDIDWSKKPSAPRTEQPRSKSK* |
| JGI20157J14317_101349941 | 3300001352 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGS |
| JGI24006J15134_100612501 | 3300001450 | Marine | MGKGCAPRKGHNQDKQRKNYEDIDWSKKPVAPKTEQPQKSK* |
| JGI24003J15210_100252001 | 3300001460 | Marine | MGKGCAPRKGHDAAKQRKNYDDIDWSKKPAAPKTEQPQKSK* |
| JGI24003J15210_101048962 | 3300001460 | Marine | MGKGCAPRKGHDAAKQRKNYDDIDWSKKPIAPKTEQPQKSK* |
| JGI24004J15324_100190532 | 3300001472 | Marine | MGKGCAPRKGHNQDKQRKNYDDIDWSKKPVAPKTEQPTKSK* |
| JGI24005J15628_100477262 | 3300001589 | Marine | MGKGCAPRKGHDAAKQRKNYDXIDWSXKPVAPKTEQPQKSK* |
| GOS2242_10923354 | 3300001967 | Marine | MGKGCAPRKGHNAEKQRKNYDMIDWGKKPKSPRTEQPKEKTR* |
| Water_1008605 | 3300002930 | Estuary Water | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPKVQKMDKPAKSK* |
| Ga0055584_1009339162 | 3300004097 | Pelagic Marine | MSTKGSGPRKGHNQEKQRKNYDDIDWGKKPTAPKTEQPRSKSTGKLASPESK* |
| Ga0065183_102532112 | 3300004113 | Pelagic Marine | MSTKGSGPRKGHNQEKQRKNYDDIDWSKKTKSTKSKLPPAEQPKSK* |
| Ga0066605_100493313 | 3300004279 | Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPAVQKMHKSQKSK* |
| Ga0066605_101457643 | 3300004279 | Marine | MSTKGSGPRKGHNQEKQRKNYDDIDWSKKTKSNKIKLPRTEQPRTK* |
| Ga0065861_10041253 | 3300004448 | Marine | MGKGCAPRKGHNPAKQRKNYDDIDWGKKPSAPKTEQPSKSGNGGD* |
| Ga0065861_10363082 | 3300004448 | Marine | MGKGCTPRKGHNVEKQRKNYDDIDWSKKPTAPRTEQPAKSKK* |
| Ga0065861_10484442 | 3300004448 | Marine | MGKGCAPRKGHDAAKQRKNYDDIDWSKKPVAPKTEQPQKSK* |
| Ga0065861_10484532 | 3300004448 | Marine | MGKGCAPRKGHNQDKQRKNYDDIDWSKKPVAPKTEQPQKSK* |
| Ga0066222_10092032 | 3300004460 | Marine | MSTKGSGPRKGHNQEKQRKNYDDIDWSKKPSSPKTEQPKNKK* |
| Ga0066223_10173983 | 3300004461 | Marine | TATMGKGCTPRKGHNVEKQRKNYDDIDWSKKPSSPKTEQPKNKK* |
| Ga0066223_10374802 | 3300004461 | Marine | MGKGCAPRKGHNQDKQRKNYDDIDWSKKPDPPKPKTGGSK* |
| Ga0070729_102554693 | 3300005589 | Marine Sediment | MSTKGSGPRKGHNQDKQRKNYDDIDWGKKPTAPKTEQPRSKSK* |
| Ga0070726_100108445 | 3300005600 | Marine Sediment | MSTKGSGPRKGHNQDKQRKNYDDIDWGKKPTAPKTEQPRSKSTGKLASPESK* |
| Ga0078746_10423432 | 3300005821 | Marine Sediment | MGKGCAPRKGHDAAKQRKNYDDIDWSKKPVAPKTEQPKKSK* |
| Ga0070743_100027974 | 3300005941 | Estuarine | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPAKPSKPSKSK* |
| Ga0070742_101426622 | 3300005942 | Estuarine | MSTKGSGPRKGHNAEKQRKNYDCIDWSKKPSAPRTEQPRPKSK* |
| Ga0075462_102210941 | 3300006027 | Aqueous | ETATMGKGCAPRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPAKSKKC* |
| Ga0075466_11293782 | 3300006029 | Aqueous | MSTKGSGPRKGHNAEKQRKNYDDINWSKKPTAPRTEQPRSKSK* |
| Ga0070744_101461881 | 3300006484 | Estuarine | LSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGS |
| Ga0098048_10262451 | 3300006752 | Marine | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPTAPSTEQPKAKKQ* |
| Ga0098048_11478311 | 3300006752 | Marine | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPAAPKTEQPKKSK* |
| Ga0098055_10698233 | 3300006793 | Marine | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPSSPRTEQPKDKEK* |
| Ga0070749_100148171 | 3300006802 | Aqueous | MSTKGSGPRKGHNAEKQRKNYDCIDWSKKPSAPRTEQPRSKSTGKLASPESK* |
| Ga0075467_101204031 | 3300006803 | Aqueous | TKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPRTEQPRSKSTGKLASPESK* |
| Ga0075467_101656661 | 3300006803 | Aqueous | MSTKGSGPRKGHNAEKQRKNYDAIDWSNKTKSTKSKPPPTEQPKASK* |
| Ga0075467_105525291 | 3300006803 | Aqueous | TKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK* |
| Ga0070754_101550522 | 3300006810 | Aqueous | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPVAPKTEQPQKSK* |
| Ga0070750_103228221 | 3300006916 | Aqueous | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPKVQKIDKQAKSK* |
| Ga0098045_11664881 | 3300006922 | Marine | RRTQMGKGCAPRKGHNAAKQRKNYDDIDWSKKPAAPKTEQPKKSK* |
| Ga0075468_100696443 | 3300007229 | Aqueous | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPRTEQPRSKSTGKLASPESK* |
| Ga0075469_100996153 | 3300007231 | Aqueous | MKGAATMSTKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPRT |
| Ga0099849_10767822 | 3300007539 | Aqueous | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPVAPKTKQPQKSK* |
| Ga0099847_10939281 | 3300007540 | Aqueous | PRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPAKSKKC* |
| Ga0102853_10654461 | 3300007543 | Estuarine | GHNQDKQRKNYDDIDWSKKPTAPKTEQPRSKSTGKLASPESK* |
| Ga0102820_11683821 | 3300007554 | Estuarine | GKGCAPRKGHNAEKQRKNYDEIDWSKKPAKPSKPTKSK* |
| Ga0102823_10241781 | 3300007692 | Estuarine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKTKSNKIKLPRTEQPR |
| Ga0105738_10547262 | 3300007953 | Estuary Water | MSTKGSGPRKGHNQDKQRKNYDDIDWSKKPTAPKTEQPRSKSTGKLASPESK* |
| Ga0102811_10021111 | 3300009024 | Estuarine | GSGPRKGHNAEKQRKNYDDIDWSKKTKSNKIKLPRTEQPRTK* |
| Ga0102811_10873703 | 3300009024 | Estuarine | MNTLSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK* |
| Ga0115566_108164241 | 3300009071 | Pelagic Marine | TMGKGCAPRKGHNAEKQRKNYDDIDWSKKPKVQKMDKPAKSK* |
| Ga0118729_10324276 | 3300009130 | Marine | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPTAPKAEQPTKSKKCS* |
| Ga0114998_105173691 | 3300009422 | Marine | KQMSTKGSGPRKGHNQDKQRKNYDDIDWGKKPTAPKTEQPRSKSTGKLASPKSK* |
| Ga0115547_11068192 | 3300009426 | Pelagic Marine | MKGAATMSTKGSGPRKGHNAEKQRKNYDDIDWSNKTKSTKSKPPPTEQPKASK* |
| Ga0115562_10453121 | 3300009434 | Pelagic Marine | QMSTKGSGPRKGHNAEKQRKNYDDINWSKKPTAPRTEQPRSKDK* |
| Ga0115562_13131801 | 3300009434 | Pelagic Marine | LSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKG |
| Ga0115007_100025169 | 3300009441 | Marine | MSTKGSGPRKGHNQDKQRKNYDDIDWSKKPSSPKTEQPKNKK* |
| Ga0115563_11181323 | 3300009442 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK*RIKHLELIR |
| Ga0115563_13445403 | 3300009442 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPRSKDK* |
| Ga0115570_104443993 | 3300009496 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPRTEQPRSKSTGKLASPES |
| Ga0115572_100692352 | 3300009507 | Pelagic Marine | MGKGSAPRKGHNAQKQRENYDEIDWSKKPAKTSVPKQK* |
| Ga0115103_17688574 | 3300009599 | Marine | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPAKPSKPKKSK* |
| Ga0118731_1004221613 | 3300010392 | Marine | MSTKGSGPRKGHNQDKQRKNYDDIDWGKKPTAPKTEQPRSKS |
| Ga0118731_1143389083 | 3300010392 | Marine | MKGAVTMSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK* |
| Ga0118733_1013517603 | 3300010430 | Marine Sediment | MKGAATMSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK* |
| Ga0114922_102481031 | 3300011118 | Deep Subsurface | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPAVQKMDKPAK |
| Ga0151669_1197061 | 3300011128 | Marine | MGKGCAPRKGHDAAKQRKNYDDIDWSKKPVAPKTEQQQKSK* |
| Ga0151671_10218392 | 3300011253 | Marine | GCAPRKGHDAAKQRKNYDDIDWSKKPVAPKTEQPQKSK* |
| Ga0151671_10832112 | 3300011253 | Marine | MGKGCAPRKGHNAEKQRKNYDEIDWSKRPSVQKMDKPAKSK* |
| Ga0151675_10558072 | 3300011254 | Marine | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPSVQKMDKPAKSK* |
| Ga0129327_100671691 | 3300013010 | Freshwater To Marine Saline Gradient | APRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPAKSKKC* |
| Ga0180120_102916861 | 3300017697 | Freshwater To Marine Saline Gradient | PRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPAKSKKC |
| Ga0181391_10024836 | 3300017713 | Seawater | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPAAPKTEQPGKSK |
| Ga0181398_10006192 | 3300017725 | Seawater | MGKGCTPRKGHDAAKQRKNYDDIDWSKKPVAPKTEQPKKSK |
| Ga0181401_11524882 | 3300017727 | Seawater | IMGKGHQPRKGHNPAKQRKNYDKIDWSKKPSVQKMDKPAKSK |
| Ga0187219_10114761 | 3300017751 | Seawater | TMGKGCAPRKGHNAEKQRKNYDEIDWSKKPAKPSKPKKSK |
| Ga0187219_10333161 | 3300017751 | Seawater | GCAPRKGHNAAKQRKNYDDIDWSKKPAAPKTEQPGKSK |
| Ga0181400_100044715 | 3300017752 | Seawater | MGKGCTPRKGHNAAKQRKNYDDIDWSKKPVAPKTEQPKKSK |
| Ga0181400_10013245 | 3300017752 | Seawater | MGKGCAPRKGHNAAKQRENYDDIDWSKKPSSPRTEQPKTKEK |
| Ga0181406_10079972 | 3300017767 | Seawater | MGKGCAPRKGHDAAKQRKNYEDIDWSKKPAAPKTEQPQKSK |
| Ga0181552_100806613 | 3300017824 | Salt Marsh | MSTKGSGPRKGHNAEKQRKNYDDIDWSKIPLAPKTEQPKGSK |
| Ga0181560_103073461 | 3300018413 | Salt Marsh | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK |
| Ga0206128_11464343 | 3300020166 | Seawater | MKGAVTMSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK |
| Ga0206131_100516624 | 3300020185 | Seawater | MSTKGSGPRKGHDQEKQRKNYDDIDWSKKTKSTKSKLPPTEQPKSK |
| Ga0206131_100682531 | 3300020185 | Seawater | MSTKGSGPRKGHNQEKQRKNYDDIDWSKKTKSTKSKLPPTEQPKSKXLTQKIRTSS |
| Ga0206130_1001219411 | 3300020187 | Seawater | NQMSTKGSGPRKGHDQEKQRKNYDDIDWSKKTKSTKSKLPPTEQPKSK |
| Ga0206130_100141268 | 3300020187 | Seawater | MSTKGSGPRKGHNQEKQRKNYDDIDWGKKPTAPKTEQPRSKSTGKLASPESK |
| Ga0206130_100255827 | 3300020187 | Seawater | LSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK |
| Ga0211677_100585722 | 3300020385 | Marine | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPAVQKMDKPTKSKK |
| Ga0206126_100111547 | 3300020595 | Seawater | MGKGCAPRKGHNAEKQRKNYDEINWSKKPKAPRTEQPKASK |
| Ga0206123_103347761 | 3300021365 | Seawater | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQP |
| Ga0222717_1000160519 | 3300021957 | Estuarine Water | MGKGCAPRKGHNAAKQRKNYDEIDWSKKPAVQKINKAAKSK |
| Ga0222717_100777144 | 3300021957 | Estuarine Water | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPAKSKK |
| Ga0222715_102988304 | 3300021960 | Estuarine Water | ITTMGKGCAPRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPAKSKK |
| Ga0222715_103780802 | 3300021960 | Estuarine Water | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPAVQKMDKPAKSK |
| Ga0212030_10387711 | 3300022053 | Aqueous | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPTAPRTEQPAKSK |
| Ga0212024_10614083 | 3300022065 | Aqueous | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPKVQKIDKQAKSK |
| Ga0196903_10325074 | 3300022169 | Aqueous | MGKGCAPRKGHNAEKQRKNYDDIGWSKKPTAPRTE |
| Ga0196887_10243606 | 3300022178 | Aqueous | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPAKSKKC |
| Ga0196887_10882062 | 3300022178 | Aqueous | PRKGHNAEKQRKNYDDIDWSKKPSAPRTEQPRSKSK |
| Ga0196899_11612281 | 3300022187 | Aqueous | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPKVQKMDKPAKSK |
| Ga0224513_102595331 | 3300022220 | Sediment | NTLSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK |
| Ga0224506_102949082 | 3300022221 | Sediment | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPAAPKTEQPQKSK |
| Ga0255783_101610291 | 3300022923 | Salt Marsh | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTE |
| Ga0255773_100812991 | 3300022925 | Salt Marsh | KGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK |
| (restricted) Ga0233411_101510702 | 3300023112 | Seawater | ATMGKGCAPRKGHNAEKQRKNYDEIDWSKKPAKPSKPSKSK |
| (restricted) Ga0233412_105701112 | 3300023210 | Seawater | CAPRKGHNAEKQRKNYDEIDWSKKPAKPSKPSKSK |
| (restricted) Ga0233410_100186624 | 3300023276 | Seawater | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPAVQKMHKSQKS |
| Ga0228696_10337251 | 3300023568 | Seawater | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPTAPSTEQP |
| Ga0232119_10052033 | 3300023702 | Seawater | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPAVQKMDKPAKSK |
| (restricted) Ga0255040_100004128 | 3300024059 | Seawater | MSTKGSGPRKGHNAAKQRKNYDDIDWSKKPAVQKIHKSQKLK |
| (restricted) Ga0255039_104664362 | 3300024062 | Seawater | KGSGPRKGHNQDKQRKNYDDIDWSKKPTAPKTEQPRSKSK |
| Ga0228669_10049382 | 3300024185 | Seawater | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPAKPSKPSKSK |
| Ga0228655_10178113 | 3300024236 | Seawater | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPAVQKMDKPARSK |
| Ga0228676_10724552 | 3300024248 | Seawater | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPAVQKMDKPDKSK |
| Ga0228626_10481464 | 3300024321 | Seawater | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPAVQKMDKP |
| Ga0228652_11028941 | 3300024326 | Seawater | MGKGHQPRKGHNPAKQRKNYDKIDWSKKPSVQKMDKPQK |
| (restricted) Ga0255042_100479871 | 3300024340 | Seawater | TLSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK |
| Ga0244775_100462295 | 3300024346 | Estuarine | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPAVQKIDKPAKSK |
| Ga0228628_10835951 | 3300024359 | Seawater | MGKGHQPRKGHNPAKQRKNYDKIDWSKKPSVQKMDKP |
| Ga0228628_10857801 | 3300024359 | Seawater | KGHNAEKQRKNYDDIDWSKKPTAPSTEQPAKSKKC |
| Ga0228632_10555122 | 3300024420 | Seawater | YLNMGKGHQPRKGHNPAKQRKNYDKIDWSKKPSVQKMDKPQKSK |
| (restricted) Ga0255049_105806932 | 3300024517 | Seawater | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPAVQKMHKSQKSK |
| (restricted) Ga0255046_104288933 | 3300024519 | Seawater | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKTKSTKSKLTSDKRTPTK |
| (restricted) Ga0255045_100466173 | 3300024528 | Seawater | MSTKGSGPRKGHNQDKQRKNYDDIDWSKKPTAPKTEQPRSKSK |
| Ga0208791_10213801 | 3300025083 | Marine | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPTAPSTEQPKAKKQ |
| Ga0208298_10220552 | 3300025084 | Marine | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPAAPKTEQPKKSK |
| Ga0209348_10436722 | 3300025127 | Marine | MGKGCAPRKGHNAAKQRKNYDDIDWSKKPVAPKTEQPQKSK |
| Ga0209634_10242771 | 3300025138 | Marine | MGKGCAPRKGHDAAKQRKNYDDIDWSKKPVAPKTEQPQK |
| Ga0208660_10692773 | 3300025570 | Aqueous | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPRT |
| Ga0209304_10851592 | 3300025577 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSNKTKSTKSKPPPTEQPKASK |
| Ga0209195_11162161 | 3300025590 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDCIDWSKKPSAPRTEQPRSKSTGKLASPE |
| Ga0209504_10287724 | 3300025621 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPRTEQPRSKSTGKLASPESK |
| Ga0209504_11647943 | 3300025621 | Pelagic Marine | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPAK |
| Ga0209833_10078323 | 3300025641 | Pelagic Marine | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPRTEQPKGSK |
| Ga0208643_10991751 | 3300025645 | Aqueous | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPRTEQPRSKSK |
| Ga0208643_11206794 | 3300025645 | Aqueous | MSTKGSGPRKGHNAEKQRKNYDDIDWSKKPSAPRTEQPRSKS |
| Ga0208643_11401131 | 3300025645 | Aqueous | STKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK |
| Ga0208899_10488442 | 3300025759 | Aqueous | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPKVQKVDKQAKSK |
| Ga0209533_100054121 | 3300025874 | Pelagic Marine | MKGAATMSTKGSGPRKGHNAEKQRKNYDDIDWSNKTKSTKSKPPPTEQPKASK |
| Ga0209456_100336594 | 3300025883 | Pelagic Marine | GCAPRKGHNAEKQRKNYDDIDWSKKPKVQKMDKPAKSK |
| Ga0247604_10882741 | 3300026460 | Seawater | QPVYLNMGKGHQPRKGHNPAKQRKNYDKIDWSKKPSVQKMDKPQKSK |
| Ga0228622_10030285 | 3300026479 | Seawater | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPTKPSKPKKSK |
| Ga0208671_101667672 | 3300027757 | Estuarine | TKRRITTMGKGCAPRKGHNAEKQRKNYDEIDWSKKPAKPSKPSKSK |
| Ga0208671_101916921 | 3300027757 | Estuarine | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPAKPSKPK |
| Ga0209273_100604192 | 3300027790 | Marine Sediment | MSTKGSGPRKGHNQDKQRKNYDDIDWGKKPTAPKTEQPRSKSTGKLASPESK |
| Ga0209302_100393302 | 3300027810 | Marine | MSTKGSGPRKGHNQDKQRKNYDDIDWSKKPSSPKTEQPKNKK |
| (restricted) Ga0233413_100571821 | 3300027996 | Seawater | RQMSTKGSGPRKGHNAEKQRKNYDDIDWSKKTKSNKIKLPRTEQPRTK |
| Ga0228674_12101713 | 3300028008 | Seawater | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPTAPRTEQPAKSK |
| Ga0256368_10081162 | 3300028125 | Sea-Ice Brine | MGKGCAPRKGHNQDKQRKNYDDIDWSKKPVAPKTEQPQKSK |
| Ga0228642_11620112 | 3300028131 | Seawater | PRKGHNAEKQRKNYDDIDWSKKPTAPSTEQPAKSKKC |
| Ga0265306_108029671 | 3300028598 | Sediment | MSTKGSGPRKGHNAEKQRKNYDCIDWSKKPSAPRTEQPRPKNK |
| Ga0265309_113165561 | 3300028599 | Sediment | KWRNTMSTKGSGPRKGHNAEKQRKNYDDIDWSKKPLAPKTEQPKGSK |
| Ga0302126_103255841 | 3300031622 | Marine | RTQMGKGCAPRKGHDAAKQRKNYDDIDWSKKPVAPKTEQPTKSK |
| Ga0302121_101732372 | 3300031626 | Marine | MGKGCAPRKGHDAAKQRKNYDDIDWSKKPVAPKTEQPTKSK |
| Ga0315331_101801722 | 3300031774 | Seawater | MGKGHQPRKGHNPAKQRKNYDKIDWSKKPAVQKMDKPQKPK |
| Ga0315320_100172657 | 3300031851 | Seawater | MGKGCSPRKGHNAEKQRKNYEEIDWSKKPSVQKMHKPSKSK |
| Ga0316202_100289792 | 3300032277 | Microbial Mat | MGKGCAPRKGHNAEKQRKNYDDIDWSKKPAVQKMDKPVKSK |
| Ga0316202_100339533 | 3300032277 | Microbial Mat | MGKGSAPRKGHNAQKQRKNYDEIDWSKKPQVQKMDKPAKTSVPKQK |
| Ga0316202_102115054 | 3300032277 | Microbial Mat | MGKGCAPRKGHNAEKQRKNYDEIDWSKKPAVQKMDKPAKSK |
| Ga0348336_108899_73_198 | 3300034375 | Aqueous | MGKGCSPRKGHDAAKQRKNYDDIDWSKKPVAPKTEQPQKSK |
| ⦗Top⦘ |