NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F031956

Metagenome / Metatranscriptome Family F031956

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031956
Family Type Metagenome / Metatranscriptome
Number of Sequences 181
Average Sequence Length 43 residues
Representative Sequence MTMTAREAFERGTDTFNAHDIDGFAEVLADDVVFKAPGGIQG
Number of Associated Samples 151
Number of Associated Scaffolds 181

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.90 %
% of genes near scaffold ends (potentially truncated) 96.13 %
% of genes from short scaffolds (< 2000 bps) 95.58 %
Associated GOLD sequencing projects 138
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.160 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.862 % of family members)
Environment Ontology (ENVO) Unclassified
(33.149 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.409 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.43%    β-sheet: 5.71%    Coil/Unstructured: 62.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 181 Family Scaffolds
PF00196GerE 69.06
PF14534DUF4440 1.66
PF13191AAA_16 1.10
PF00440TetR_N 1.10
PF05147LANC_like 1.10
PF12704MacB_PCD 1.10
PF14294DUF4372 0.55
PF03551PadR 0.55
PF01156IU_nuc_hydro 0.55
PF07045DUF1330 0.55
PF00378ECH_1 0.55
PF12706Lactamase_B_2 0.55
PF09361Phasin_2 0.55
PF05988DUF899 0.55
PF04672Methyltransf_19 0.55
PF05025RbsD_FucU 0.55
PF07040DUF1326 0.55
PF06772LtrA 0.55
PF03466LysR_substrate 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 181 Family Scaffolds
COG4403Lantibiotic modifying enzymeDefense mechanisms [V] 1.10
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.55
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.55
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.55
COG1869D-ribose pyranose/furanose isomerase RbsDCarbohydrate transport and metabolism [G] 0.55
COG1957Inosine-uridine nucleoside N-ribohydrolaseNucleotide transport and metabolism [F] 0.55
COG4154L-fucose mutarotase/ribose pyranase, RbsD/FucU familyCarbohydrate transport and metabolism [G] 0.55
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 0.55
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.55
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.55
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.16 %
UnclassifiedrootN/A8.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459023|GZGNO2B01CUPCFAll Organisms → cellular organisms → Bacteria512Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100785487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1972532Open in IMG/M
3300003368|JGI26340J50214_10151423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197580Open in IMG/M
3300004114|Ga0062593_102113463All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300004643|Ga0062591_102066659All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005093|Ga0062594_100262246All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas1276Open in IMG/M
3300005343|Ga0070687_100940627All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005455|Ga0070663_100946544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria746Open in IMG/M
3300005459|Ga0068867_101875621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197565Open in IMG/M
3300005468|Ga0070707_100373729All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300005561|Ga0066699_11221294All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005591|Ga0070761_10474832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197769Open in IMG/M
3300005610|Ga0070763_10608307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197634Open in IMG/M
3300005615|Ga0070702_101268423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300005718|Ga0068866_10098093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971611Open in IMG/M
3300005719|Ga0068861_100177231All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300005764|Ga0066903_101285548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971365Open in IMG/M
3300005764|Ga0066903_105468726All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300005764|Ga0066903_105475473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197669Open in IMG/M
3300005764|Ga0066903_107578142All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300005841|Ga0068863_102289371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300006175|Ga0070712_100978354All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300006175|Ga0070712_101108313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197687Open in IMG/M
3300006581|Ga0074048_12389732Not Available502Open in IMG/M
3300006755|Ga0079222_11637942All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300006914|Ga0075436_100284147All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300006954|Ga0079219_11751073All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300007076|Ga0075435_101038335All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300009098|Ga0105245_10114176All Organisms → cellular organisms → Bacteria2515Open in IMG/M
3300009101|Ga0105247_11564308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197540Open in IMG/M
3300009176|Ga0105242_12714550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197545Open in IMG/M
3300009545|Ga0105237_11049521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197822Open in IMG/M
3300009551|Ga0105238_10263101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1705Open in IMG/M
3300009700|Ga0116217_10553242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197719Open in IMG/M
3300009792|Ga0126374_10597913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197814Open in IMG/M
3300010043|Ga0126380_10676548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197826Open in IMG/M
3300010048|Ga0126373_12201205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197612Open in IMG/M
3300010358|Ga0126370_12409724All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300010360|Ga0126372_11385855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197735Open in IMG/M
3300010360|Ga0126372_13164730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197511Open in IMG/M
3300010373|Ga0134128_11816786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197671Open in IMG/M
3300010373|Ga0134128_13236132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197500Open in IMG/M
3300010376|Ga0126381_105088045Not Available504Open in IMG/M
3300010396|Ga0134126_10723908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971129Open in IMG/M
3300012199|Ga0137383_10084657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1972294Open in IMG/M
3300012201|Ga0137365_11020222Not Available599Open in IMG/M
3300012515|Ga0157338_1044851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium615Open in IMG/M
3300012897|Ga0157285_10365011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197510Open in IMG/M
3300012898|Ga0157293_10277106Not Available544Open in IMG/M
3300012961|Ga0164302_10625637All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium785Open in IMG/M
3300012971|Ga0126369_10499131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971274Open in IMG/M
3300012971|Ga0126369_10803013Not Available1023Open in IMG/M
3300012984|Ga0164309_11834669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197520Open in IMG/M
3300012987|Ga0164307_10509100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197911Open in IMG/M
3300012989|Ga0164305_11564072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197587Open in IMG/M
3300013306|Ga0163162_13191238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197526Open in IMG/M
3300013307|Ga0157372_13202763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197522Open in IMG/M
3300013772|Ga0120158_10163527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium1212Open in IMG/M
3300015371|Ga0132258_10683345All Organisms → cellular organisms → Bacteria2583Open in IMG/M
3300015372|Ga0132256_102463348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07622Open in IMG/M
3300015374|Ga0132255_106263059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197504Open in IMG/M
3300016270|Ga0182036_11419251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197581Open in IMG/M
3300016270|Ga0182036_11705717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria532Open in IMG/M
3300016319|Ga0182033_11005686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197742Open in IMG/M
3300016341|Ga0182035_11743055All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300016357|Ga0182032_10939481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197736Open in IMG/M
3300016371|Ga0182034_11922116Not Available522Open in IMG/M
3300016387|Ga0182040_10595181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197895Open in IMG/M
3300016387|Ga0182040_11462987All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300016404|Ga0182037_11085332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197700Open in IMG/M
3300016404|Ga0182037_11579927All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300016445|Ga0182038_10674962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197898Open in IMG/M
3300017821|Ga0187812_1102024All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300017966|Ga0187776_10389573Not Available929Open in IMG/M
3300017973|Ga0187780_10221848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971320Open in IMG/M
3300017973|Ga0187780_10280933All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300018058|Ga0187766_10351702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197965Open in IMG/M
3300018060|Ga0187765_10851864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197613Open in IMG/M
3300020580|Ga0210403_11437054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197521Open in IMG/M
3300020581|Ga0210399_10094942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1972434Open in IMG/M
3300021088|Ga0210404_10277825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197917Open in IMG/M
3300021358|Ga0213873_10274025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197539Open in IMG/M
3300021358|Ga0213873_10311560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300021362|Ga0213882_10177842All Organisms → cellular organisms → Bacteria → Terrabacteria group875Open in IMG/M
3300021362|Ga0213882_10405398All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300021374|Ga0213881_10167664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197965Open in IMG/M
3300021374|Ga0213881_10459834All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300021377|Ga0213874_10060535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971185Open in IMG/M
3300021384|Ga0213876_10575119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197599Open in IMG/M
3300021404|Ga0210389_11052031All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300021406|Ga0210386_11825280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197500Open in IMG/M
3300021407|Ga0210383_10254840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971506Open in IMG/M
3300021407|Ga0210383_11740409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197510Open in IMG/M
3300021433|Ga0210391_10458167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971001Open in IMG/M
3300021475|Ga0210392_10264103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971224Open in IMG/M
3300021477|Ga0210398_10316349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971273Open in IMG/M
3300021953|Ga0213880_10048420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971031Open in IMG/M
3300025899|Ga0207642_10008639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3505Open in IMG/M
3300025900|Ga0207710_10709241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197528Open in IMG/M
3300025912|Ga0207707_11250443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium599Open in IMG/M
3300025914|Ga0207671_10700931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197805Open in IMG/M
3300025921|Ga0207652_11403330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197602Open in IMG/M
3300025925|Ga0207650_11668364All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300025926|Ga0207659_11920735All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300025928|Ga0207700_10957032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197766Open in IMG/M
3300025929|Ga0207664_10596623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus992Open in IMG/M
3300025929|Ga0207664_11397747All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300025934|Ga0207686_11720285All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300025935|Ga0207709_11295144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300025937|Ga0207669_10684065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300025937|Ga0207669_11565441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197562Open in IMG/M
3300025961|Ga0207712_10816810All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300026035|Ga0207703_10517569Not Available1122Open in IMG/M
3300026041|Ga0207639_11451561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium644Open in IMG/M
3300027570|Ga0208043_1038131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora1452Open in IMG/M
3300027909|Ga0209382_12260039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197512Open in IMG/M
3300028587|Ga0247828_11030524All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300028589|Ga0247818_10198547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971317Open in IMG/M
3300028596|Ga0247821_10523410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197757Open in IMG/M
3300029636|Ga0222749_10538763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197635Open in IMG/M
3300030707|Ga0310038_10360442All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300031544|Ga0318534_10268604Not Available983Open in IMG/M
3300031546|Ga0318538_10767592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197523Open in IMG/M
3300031679|Ga0318561_10601839Not Available605Open in IMG/M
3300031679|Ga0318561_10642712All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031681|Ga0318572_10545035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197691Open in IMG/M
3300031681|Ga0318572_10898136All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300031682|Ga0318560_10645605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197573Open in IMG/M
3300031708|Ga0310686_113209023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197986Open in IMG/M
3300031716|Ga0310813_12290142All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031744|Ga0306918_10268303Not Available1307Open in IMG/M
3300031744|Ga0306918_11363429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197544Open in IMG/M
3300031751|Ga0318494_10332240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197878Open in IMG/M
3300031751|Ga0318494_10576316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197657Open in IMG/M
3300031768|Ga0318509_10092370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971621Open in IMG/M
3300031770|Ga0318521_10967117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium521Open in IMG/M
3300031778|Ga0318498_10366245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium642Open in IMG/M
3300031778|Ga0318498_10379094Not Available630Open in IMG/M
3300031779|Ga0318566_10330743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197753Open in IMG/M
3300031799|Ga0318565_10217710All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300031805|Ga0318497_10697770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300031820|Ga0307473_10244233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971097Open in IMG/M
3300031854|Ga0310904_10587238All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300031879|Ga0306919_11423477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197523Open in IMG/M
3300031890|Ga0306925_11211578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197756Open in IMG/M
3300031893|Ga0318536_10259026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria884Open in IMG/M
3300031894|Ga0318522_10078651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971202Open in IMG/M
3300031910|Ga0306923_10745838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971086Open in IMG/M
3300031912|Ga0306921_11775291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197664Open in IMG/M
3300031912|Ga0306921_12475999All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300031941|Ga0310912_10449054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971005Open in IMG/M
3300031941|Ga0310912_11228953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197570Open in IMG/M
3300031942|Ga0310916_11219028All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300031946|Ga0310910_10152611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971768Open in IMG/M
3300031947|Ga0310909_10615363All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300031954|Ga0306926_11039248Not Available973Open in IMG/M
3300032001|Ga0306922_10101052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1973050Open in IMG/M
3300032001|Ga0306922_10964089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197882Open in IMG/M
3300032001|Ga0306922_11393374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197705Open in IMG/M
3300032008|Ga0318562_10432252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197765Open in IMG/M
3300032009|Ga0318563_10269549Not Available920Open in IMG/M
3300032009|Ga0318563_10568502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197612Open in IMG/M
3300032010|Ga0318569_10376204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197662Open in IMG/M
3300032025|Ga0318507_10304908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197693Open in IMG/M
3300032055|Ga0318575_10232996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197928Open in IMG/M
3300032068|Ga0318553_10113129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971390Open in IMG/M
3300032068|Ga0318553_10602100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197575Open in IMG/M
3300032076|Ga0306924_10424234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1521Open in IMG/M
3300032076|Ga0306924_10821154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971035Open in IMG/M
3300032089|Ga0318525_10542315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197595Open in IMG/M
3300032090|Ga0318518_10568520Not Available579Open in IMG/M
3300032174|Ga0307470_10012911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3533Open in IMG/M
3300032180|Ga0307471_100984965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971010Open in IMG/M
3300032261|Ga0306920_102723907Not Available675Open in IMG/M
3300032261|Ga0306920_104177451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197521Open in IMG/M
3300032828|Ga0335080_10838542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197947Open in IMG/M
3300032892|Ga0335081_11995842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197619Open in IMG/M
3300033158|Ga0335077_10296233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1971772Open in IMG/M
3300033290|Ga0318519_10320815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197910Open in IMG/M
3300033550|Ga0247829_11562344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium544Open in IMG/M
3300034819|Ga0373958_0203859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 197519Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.76%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.76%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock2.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.21%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.66%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.66%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.66%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.66%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.10%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.10%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.10%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.10%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.10%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.10%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.55%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.55%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.55%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.55%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.55%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FA3_003610702170459023Grass SoilMTMTTREAFERGTDTFNAHDIDGFAEVLADEVVFTAPG
INPhiseqgaiiFebDRAFT_10078548723300000364SoilMTMTPRQAFEKGTATFNAHDLDGFAEVLDDDVVFRAPGGTHG
JGI26340J50214_1015142313300003368Bog Forest SoilMAMSAREAFEKGTQTFSAHNIEGFAEVLADDVTTPSSPASG
Ga0062593_10211346323300004114SoilMTTREAFERGTDTFNAHDINAFAGVLADDVVFVAPGGMRG
Ga0062591_10206665913300004643SoilMTTTTREAFERGTQTFNDHDIDGFAEVLADDVVFTAPGAHGGGKGPCVEFYGGWLNAFPD
Ga0062594_10026224613300005093SoilMTTTREAFERGTQTFNDHDIEGFAEVLAEDVVFTAPGVSGEGKGPCIEFYGGWLDAFP
Ga0070687_10094062723300005343Switchgrass RhizosphereMAMTAREAFERGTATFNAHDIDGFAKVLADDVVFKAPGGMQGGGKAACAA
Ga0070663_10094654413300005455Corn RhizosphereMTTTMTTREAFQQGTDTFNAHDLRGFAEVLDDDVAVAAPGGMRSEGKDA
Ga0068867_10187562113300005459Miscanthus RhizosphereMTTREAFERGTDTFNAHDIAGFAEVLADDVVFVAPGPTRGEGKAA
Ga0070707_10037372913300005468Corn, Switchgrass And Miscanthus RhizosphereMTTREAFERGTDTFNAHDINAFTDVLADDVVFTAPGGMRGEGKA
Ga0066699_1122129413300005561SoilMAMTTREAFERGTDTFNNHDLDGFAEVVDDDVVFQAPGGIRG
Ga0070761_1047483223300005591SoilMTMTAREAFEKGTATFNAHDIDGFKEVLADNVVFTAPGGLKGEGKE
Ga0070763_1060830713300005610SoilMTMTVREAFAKGTETFNAHDIDGFSDVLADKAVFRAPGGMRGEGKTACAQFF
Ga0070702_10126842313300005615Corn, Switchgrass And Miscanthus RhizosphereMTMTAREAFERGTATFNAHDLDGFTEVLADDVVFTAPGGV
Ga0068866_1009809323300005718Miscanthus RhizosphereMTTREAFERGTDTFNAHDIGGFTEVLADDVVVVAPGPVRGEGRAACA
Ga0068861_10017723123300005719Switchgrass RhizosphereMTTREAFERGTDTFNAHDINAFTDVLADDVVFTAPGGMRGEG
Ga0066903_10128554813300005764Tropical Forest SoilMAMTLREAFEKGTQTFNDHDIDGFTRVLADDVTYH
Ga0066903_10546872613300005764Tropical Forest SoilMAMTAREAFERGTNTFNAHDMKGFAEVLADDVAFAAPGGIRGVGKTGCIEFFGAWF
Ga0066903_10547547313300005764Tropical Forest SoilMTMTARVAFEKGTATFNAHDLDGFTQVLADDVVFKAPGGM
Ga0066903_10757814213300005764Tropical Forest SoilMTRTVQEAFERGTATFNAHDIDGFAEVLSDDVVFEAAGGIRGTGKA
Ga0068863_10228937123300005841Switchgrass RhizosphereMTISTHAAFERGTETFNAHDIDGFTSVLADDVTYRAPGGISGQG
Ga0070712_10097835423300006175Corn, Switchgrass And Miscanthus RhizosphereMTMTAHEAFERGTDTFNAHDVEGFAAVLADDVVFRAPGGMRGQGK
Ga0070712_10110831313300006175Corn, Switchgrass And Miscanthus RhizosphereMTMTAREAFEKGTATFNTHDLDGFTEVLADDVVFKAPGGVQGKGKTDCAAF
Ga0074048_1238973223300006581SoilMTTTLREAFEKGTEAFNAHDIDRFADVLADDVVFRAP
Ga0079222_1163794213300006755Agricultural SoilMSTTVREAFERGTETFNAHDLDGFAAVLADEVTFEAPGGLRGEGKAAC
Ga0075436_10028414713300006914Populus RhizosphereMNTREAFEKGTETFNFHDIKGFAGVLADDVVFEAPGG
Ga0079219_1175107323300006954Agricultural SoilMTMTARDAFERGTDTFNAHDIDGFAAVLSDDVVFQA
Ga0075435_10103833513300007076Populus RhizosphereMTMTVHEAFVKGTETFNAHDIDGFTSVLADDVVFQAPGGISGAGKA
Ga0105245_1011417643300009098Miscanthus RhizosphereMSMSTREAFQRGTDTFNAHDIDGFAEVLADDVVFKA
Ga0105247_1156430813300009101Switchgrass RhizosphereMTTREAFERGTDTFNAHDIDGFTEVLADDVVVVAPGPVRGEGRAACAA
Ga0105242_1271455013300009176Miscanthus RhizosphereMAMTVREAFEKGTETFNAHDIDGFTSVLAGDVVYRAPGGISGQGKEACA
Ga0105237_1104952113300009545Corn RhizosphereMTTREAFERGTDTFNAHDIAGFAEVLADDVVFVAPGPNRGE
Ga0105238_1026310113300009551Corn RhizosphereMTTREAFERGTDTFNAHDIAGFAEVLADDVAFVAPGPMRGEGKAACA
Ga0116217_1055324213300009700Peatlands SoilMAMTIREAFAKGTETFNAHDIDGFTSVLADDVVVR
Ga0126374_1059791313300009792Tropical Forest SoilMAMTVREAFEKGTDTFNAHDIDGFTSVLADDAVFRAPGGM
Ga0126380_1067654813300010043Tropical Forest SoilMAMTVREAFQKGTDTFNDHDIDGFSSVLADDVTYSAPGISGRGK
Ga0126373_1220120523300010048Tropical Forest SoilMAMTVREAFEKGTDTFNAHDIDGFTSVLADDVTYSAPGGITGQG
Ga0126370_1240972413300010358Tropical Forest SoilMTAREAFERGTKTFNAHDIKGFAEVLADDVVFQAPGGLRGEGKTACSE
Ga0126372_1138585513300010360Tropical Forest SoilMTAREAFERGTATFNAHDLDGFAEVLADQVVFKAPGGIEGEGKAAC
Ga0126372_1316473013300010360Tropical Forest SoilMTAREAFEKGTAAFNAHDLDGFAEVLADNVVFEAPGG
Ga0134128_1181678613300010373Terrestrial SoilMAMTVREAFHKGTDTFNAHDIDGFTSVLADDVVFQAPGGV
Ga0134128_1323613213300010373Terrestrial SoilMTAREAFEKGTATFNAHDIDGFTKVLVDDVVFKAPGGIDGEGKGACAAFFGSWFTAF
Ga0126381_10508804523300010376Tropical Forest SoilMARTVREAFERGTETFNAHDIDGFADALSDNVTFEAPGGLRGDGKTA
Ga0134126_1072390823300010396Terrestrial SoilMAMTVREAFEKGTDTFNAHDIDGFTSVLADDVVFRAPGGMSGQGKA
Ga0137383_1008465713300012199Vadose Zone SoilMAMTVHEAFVKGTETFNAHDIDGFSSVLADDVVFHAPGGISGE
Ga0137365_1102022223300012201Vadose Zone SoilMTDTAREAFQKGTETFNARNIDGFAEVLADDVVVEAPGGVRGEGKAA*
Ga0157338_104485123300012515Arabidopsis RhizosphereMAMTTRDAFEKGTDTFNAHDLAGFADVLADDVVFKAPGGMHGNG
Ga0157285_1036501113300012897SoilMGTVRHGSAMTVREAFERGTETFNAHDIDGFAAVLADDVVF
Ga0157293_1027710623300012898SoilMSVTTREAFERGTDTFNAHDIDGFAGVLADDVVFTAPGGMRG
Ga0164302_1062563713300012961SoilMTPREAFERGTETFNAHDITGFAAVLADDVVFEAPGG
Ga0126369_1049913113300012971Tropical Forest SoilMTAREAFERGTTTFNAHDLDGFAEVLADQVVFKAPGGMQGEGKVACAAF
Ga0126369_1080301323300012971Tropical Forest SoilMAMTVRKAFDKGTQTFNAHDIDGFTSVLADDVSYTAPGGMTGQG
Ga0164309_1183466913300012984SoilMTMAVRQAFEKGTATFNAHDLDGFTEVLADDVVFKAPGG
Ga0164307_1050910013300012987SoilMTVREAFEKGTETFNAHDIDGFTGVLADDVVYRAPGGISGQGKEA
Ga0164305_1156407213300012989SoilMTAREAFEKGTATFNAHDLDGFAKVLADDVVFKAPGGLHGEGK
Ga0163162_1319123823300013306Switchgrass RhizosphereMTMTAREAFEKGTATFNAQDLDGFKEVLADDVVFKAPG
Ga0157372_1320276313300013307Corn RhizosphereMTAREAFEKGTATFNAHDLDAFTEVLADDVAFKAPG
Ga0120158_1016352723300013772PermafrostMTMTVREAFEKGTEAYNAHDIDGFAEVLADDVAFRAPGGLGGQGRAACAE
Ga0132258_1068334513300015371Arabidopsis RhizosphereMSRSPTPERHAMAMTVREAFERGTETFNAHDLDGFAEVLEDDVVFEASGGMRGAGKPACLAFYGS*
Ga0132256_10246334813300015372Arabidopsis RhizosphereVTITVREAFERGTETFNSHDIAGFMEVLADDVTFEAPGGLRGEGKEACT
Ga0132255_10626305923300015374Arabidopsis RhizosphereMPLTPREAFEIGTRTFNAHDLDGFADVLADDVVFDAPG
Ga0182036_1141925123300016270SoilMTMTARVAFEKGTATFNAHDLDGFTQVLADDVVFKAPGGMHG
Ga0182036_1170571713300016270SoilMPMTIREAFERGTETFNAHDIDSFAEVLADDVAFKAPGGVDGQGK
Ga0182033_1100568613300016319SoilMTMTAREAFERGTDTFNAHDIDGFAEVLADNVVFKAPGGIQ
Ga0182035_1174305513300016341SoilMAMTAREAFEKGTKTFNAHDIDGFAGVLADDVVFEAPGGVRGKGKA
Ga0182032_1093948113300016357SoilMGMSAREAFERGTNAFNAHDTKGFAEVLADDVAFAA
Ga0182034_1192211623300016371SoilMAMTAREAFEKGTETFNAHDIKGFADVLADDVAFEA
Ga0182040_1059518113300016387SoilMAMTARKAFERGTDTFNDHNIEGFRGVLADDVIFQAP
Ga0182040_1146298713300016387SoilMVMTAREAFEKGTNTFNAHDMEGFAEVLAEDVACG
Ga0182037_1108533213300016404SoilMAMTVREAFDKGTDTFNAHDIDGFTSVLADDAVFRAPGGMTGQGKA
Ga0182037_1157992713300016404SoilMMAMSTREAFERGTDTFNAHDIEGFTAVLADDVVF
Ga0182038_1067496223300016445SoilMTMTAREAFERGTDTFNAHDIDGFAEVLADDVVFKAPGGIQG
Ga0187812_110202423300017821Freshwater SedimentMAMTIREAFEKGTDTFNAHDIDGFASVLADDVVYQAP
Ga0187776_1038957323300017966Tropical PeatlandMTMTPREAFEKGTAAFNAYDIDAFAEVLADDVVFTVPALAA
Ga0187780_1022184823300017973Tropical PeatlandMAKTVREAFDKGTDTFNAHDIDGFTSVLADDAVFRAPGGINGQGKAAC
Ga0187780_1028093333300017973Tropical PeatlandMTMTVRESFQRGTEAFNAHDIDGFATVLADDVVLRAPGGMSGA
Ga0187766_1035170223300018058Tropical PeatlandMAMTNREAFAKGTDTFNAHDIDGFASVLADDVVYQAPGGLSGQGK
Ga0187765_1085186423300018060Tropical PeatlandMAMTVREAFEQGTQTFNAHDIDGFTSVLADDVTYHAP
Ga0210403_1143705413300020580SoilMAMTTRAAFEKGTATFNAHDIAGFAEVLADDVVFTAPGGMHGDGKATCAAF
Ga0210399_1009494213300020581SoilMTMTVHEAFVKGTETFNAHDIDGFTSVLADDVVFQAPGGISGEGQ
Ga0210404_1027782513300021088SoilMTMTVRQAFEKGTATFNAHDLEGFAEVLADDVVFKAPGGMH
Ga0213873_1027402513300021358RhizosphereMTMTTRESFERGTDTFNAHDMDGFAEVVAEDVVVVAPG
Ga0213873_1031156013300021358RhizosphereMTMTTREAFERGTDTFNAHDLDGFAEVLADDVVFAAPGGMHG
Ga0213882_1017784213300021362Exposed RockMTISMREAFERGTDAFNAHDMDGFAEVVADDVVVVAP
Ga0213882_1040539823300021362Exposed RockMTMNTREAFERGTDTFNAHDLDGFAEVIADDVVFAAPGGIHGE
Ga0213881_1016766423300021374Exposed RockMTMTTRESFERGTDTFNAHDMDGFAEVVAEDVVVVAPGVRCDGK
Ga0213881_1045983413300021374Exposed RockMTISMREAFERGTDAFNAHDMDGFAEVIADDVVVV
Ga0213874_1006053513300021377Plant RootsMTITTTAQDAFEKGTETFNAHDIAGFSDVLADDVN
Ga0213876_1057511923300021384Plant RootsMTMTTRESFERGTDTFNAHDMDGFAEVVAEDVVVV
Ga0210389_1105203113300021404SoilMAMTAHEAFVKGTETFNAHDIDGFTSVLADDVVFQAPGGLSGKGKA
Ga0210386_1182528023300021406SoilMTMTAREAFEKGTATFNAHDIDGFAQVLADDVTFKAPGGVRGEGKAA
Ga0210383_1025484023300021407SoilMAITVREAFEKGTDTFNAHDIDGFTSVLADDVTYSAPGGMS
Ga0210383_1174040913300021407SoilMTMTAREAFEKGTATFNAHDIDGFKEVLADNVVFTAPG
Ga0210391_1045816713300021433SoilMAMTVREAFEKGTETFNAHDIDGFTSVLADDAAFRAPGGMT
Ga0210392_1026410323300021475SoilMTMTVRQAFEKGTATFNAHDLEGFAEVLADDVIFKAPGGMHGEGKAA
Ga0210398_1031634913300021477SoilMAMTVREAFEKGTETFNAHDIDGFTSVLADDAAFRAPGGMTGQ
Ga0213880_1004842013300021953Exposed RockMTMTTREAFERGTDTFNAHDLDGFAEVIADDVVFTAPG
Ga0207642_1000863933300025899Miscanthus RhizosphereMTTREAFERGTDTFNAHDIGGFTEVLADDVVVVAPGPVRGE
Ga0207710_1070924113300025900Switchgrass RhizosphereMTTREAFERGTDTFNAHDIDGFAEVLADDVVFVAPGPMRGEGRA
Ga0207707_1125044323300025912Corn RhizosphereVTTLTTREVFQAGTDAFNAHDIDAFAELLADDVVFDA
Ga0207671_1070093123300025914Corn RhizosphereMTTREAFARGTDTFNAHDIAGFAEVLADDVVFVAPG
Ga0207652_1140333013300025921Corn RhizosphereMAMTVREAFEKGTETFNAHDIDGFTSVLAGDVVYRAPGGISGQGKEACAGF
Ga0207650_1166836423300025925Switchgrass RhizosphereMTTTMTTREAFQQGTDTFNAHDLRGFAEVLDDDVAVAAPGGMRSEGKDACVAFFGSWLNG
Ga0207659_1192073513300025926Miscanthus RhizosphereMTMTAREAFQRGTDTFNAHDIDGFADVLADDVVFE
Ga0207700_1095703223300025928Corn, Switchgrass And Miscanthus RhizosphereMTMTAREAFERGTDTFNAHDIHGFAAVLADNVVFQAPGGMRGHG
Ga0207664_1059662333300025929Agricultural SoilMAVSTREAFERGTETFNAHDIEGFREVLADDVVFEAPGGMR
Ga0207664_1139774713300025929Agricultural SoilMAMTVREVFEKGTDTFNAHDIDGFTSVLADDVTYSAPGG
Ga0207686_1172028523300025934Miscanthus RhizosphereMTMTAREAFEKGTDTFNAHDVDGFAAVLADDVAFVAPGGIRRTRISIL
Ga0207709_1129514413300025935Miscanthus RhizosphereMADSVREAFDKGTDAFNAHDLGAFGETMADDVVQTAPGG
Ga0207669_1068406513300025937Miscanthus RhizosphereMGDSVREAFDKGTEAFNAHDLGAFGETMADDVVQAAPGGM
Ga0207669_1156544113300025937Miscanthus RhizosphereMTTREAFERGTDTFNAHDIGGFTEVLADDVVVVAPGPVRGEGRAACAAFF
Ga0207712_1081681013300025961Switchgrass RhizosphereMTTREAFERGTETFNAHDINAFAGVLGDDVVFTAPGGMRGEGKAACVAFY
Ga0207703_1051756923300026035Switchgrass RhizosphereMTTREAFERGTDTFNAHDINAFTDVLADDVVFTAPGGMR
Ga0207639_1145156123300026041Corn RhizosphereVTTLTTREVFQAGTDAFNAHDIDAFAELLADDVVFDAPG
Ga0208043_103813133300027570Peatlands SoilMAMTVREAFEKGTETFNAHDIDGFTSVLADDAVFRAPGGM
Ga0209382_1226003913300027909Populus RhizosphereMTTREAFEKGTERFNAHDVQGFAEVLADDVVFSAPGGVRGQ
Ga0247828_1103052423300028587SoilMAMTTRDAFEKGTDTFNAHDLVGFAEVLADDVVFRAPGGMQGAGKAACV
Ga0247818_1019854713300028589SoilMTTREAFERGTDTFNAHDLAGFADVLADDVAFVAPGGVRGE
Ga0247821_1052341023300028596SoilMAITTREAFERGTDTFNAHDLDGFAAVLADDVVFTAPGAVYA
Ga0222749_1053876323300029636SoilMTMTVRQAFEKGTATFNAHDLEGFAEVLADDVIFKAPGGM
Ga0310038_1036044223300030707Peatlands SoilMAMTIREAFAKGTETFNAHDIDGFTSVLADDVVVRAPGGMSGQGK
Ga0318534_1026860423300031544SoilMTMTVREAFEKGTETFNAHDINGFADVLADDAVFRAPGGTGGE
Ga0318538_1076759213300031546SoilMTMTARKAFEKGTATFNAHDLHGFAEVLADNVVFKAPGGMQGEGKAAC
Ga0318561_1060183913300031679SoilMTMTVREAFEKGTETFNAHDINGFADVLADDAVFRAPGG
Ga0318561_1064271213300031679SoilMGTTVREAFETGTETFNAHDLDGFAAVLADDVNFTAPGGLHGEGK
Ga0318572_1054503523300031681SoilMAMTIREAFEKGTDTFNAHDIDGFTSVLADDVTYRAPGGIAGQGK
Ga0318572_1089813613300031681SoilMAMTVRQAFDKGTETFNAHDIDGFTSVLADDVSYTAPG
Ga0318560_1064560523300031682SoilMTMTAREAFEKGTATFNAHDLHGFAEVLADNVVFKAPGGMQGEGKA
Ga0310686_11320902313300031708SoilMAMTIREAFEKGTETFNAHDIDGFTGVLADDVVFRAPGEMNGQGKAAC
Ga0310813_1229014223300031716SoilMTMTADEAFEAGTAAFNAHDFDAFADLLTDDVVFEL
Ga0306918_1026830313300031744SoilMTMTVREAFEKGTETFNAHDINGFADVLADDAVFRAPGGTGG
Ga0306918_1136342923300031744SoilMAMTARKAFERGTDTFNDHDIEGFRGVLADDVIFQAPGGMRGEGKAA
Ga0318494_1033224023300031751SoilMAMTVHEAFVKGTETFNAHDIDGFTSVLADDVVFCAPGGMR
Ga0318494_1057631623300031751SoilMAMTIREAFEKGTDTFNAHDIDGFTSVLADDVTYRAPGGISGQGKT
Ga0318509_1009237023300031768SoilMTMTTREAFEKGTDTFNAHDIEGFASVLAHDVVYQAPGGVSGRGRTA
Ga0318521_1096711723300031770SoilMAMTVREAFDKGTETFNAHDIDGFTSVLADDVSYTAPG
Ga0318498_1036624513300031778SoilMTMTTREAFEKGTDTFNAHDIEGFASVLADDVVYQAPGGVSGRG
Ga0318498_1037909413300031778SoilMAMTTREAFEKGTATFNAHDIGGFAEVLADDVGFEAPGGMRGHGKTACVEFYS
Ga0318566_1033074323300031779SoilMAMTIREVFEKGTDTFNAHDIDGFASVLADDVTYRAPGGISGQ
Ga0318565_1021771033300031799SoilMAMTARKAFERGTDTFNDHDIEGFRGVLADDVIFQAPGGMRG
Ga0318497_1069777013300031805SoilMTMTVREAFDKETEAFNAHDIGGFSAMLADDAMFRAPGGMSGAGKQA
Ga0307473_1024423323300031820Hardwood Forest SoilMTMTVHEAFVKGTETFNAHDIDGFTSVLADDVVFQAPGGISGEGQTACAGFF
Ga0310904_1058723813300031854SoilMTMTTREAFERGTDTFNAHDINAFTDVLADDVVFTAPGGMRGE
Ga0306919_1142347713300031879SoilMAMTVREAFDKGTETFNAHDIDGFTSVLADDVSYTAPGGMTGQGKTAC
Ga0306925_1121157813300031890SoilMAMSAREAFERGTNTFNAHDMKGFAEVLADDVAFAAP
Ga0318536_1025902623300031893SoilMALTVREAFEKGTDTFNAHDIEGFTSVLADDAVFHAPGGMT
Ga0318522_1007865123300031894SoilMTMTPRDAFERGTDAFNAHDMDGFAEVVADDVVGT
Ga0306923_1074583823300031910SoilMAMTIREAFEKGTDTFNAHDIDGFTSVLADDVTYRAPGG
Ga0306921_1177529113300031912SoilMAMSAREAFERGTNTFNARDMKGFAEVLADDVVFVAPGGIRGEGKTSCAEFFG
Ga0306921_1247599913300031912SoilMAMTAREAFEKGTKTFNAHDIDGFAGVLADDVVFEAPGGVRGKG
Ga0310912_1044905413300031941SoilMTMTVREAFERGTATFNAHDLDGFAEVLADDVVFKAPGGAHGRG
Ga0310912_1122895313300031941SoilMTAREAFEKGTATFNAHDLGGFAEVLADDVVFNAPGGAH
Ga0310916_1121902823300031942SoilMTMTVHEAFERGTDTFNTHDLDGFAEVLAADVVFEAAKRSEYADC
Ga0310910_1015261113300031946SoilMTMTAREAFEKGTATFNAHDLHGFAEVLADNVVFKAPGGMQGEG
Ga0310909_1061536323300031947SoilMTMTAREAFERGTVTFNSHDIDGFAEVLANDLVFEAPGGLRGQGKASCIEFYGSWFGAF
Ga0306926_1103924823300031954SoilMTMTAREAFERGTKTFNAHDIEGFAEVLADDVVFEAP
Ga0306922_1010105213300032001SoilMAMTVHQAFVTGTETFNAHDIDGFTSVLADDVVFQAPGGMAGQGKAA
Ga0306922_1096408923300032001SoilMAMTVREAFDKGTETFNAHDIDGFTSVLADDVSYTAPGGMTGRGKT
Ga0306922_1139337413300032001SoilMTMTAREAFEKGTATFNAHDLDGFAEVLADDVFFKAPGGAH
Ga0318562_1043225213300032008SoilMGMSAREAFERGTNAFNAHDMKGFAEVLADDVAFAAPGGIRGQGKTSCTEF
Ga0318563_1026954913300032009SoilMTMTVREAFEKGTETFNAHDINGFADVLADDAVFRA
Ga0318563_1056850213300032009SoilMTMTAREAFERGTATFNAHDIDGFAKVLADDVVFRAPGSIRGSGKA
Ga0318569_1037620423300032010SoilMGMSAREAFERGTNAFNAHDMKGFAEVLADDVAFGAPGGIRGQGKTS
Ga0318507_1030490813300032025SoilMAMTVREAFDKGTETFNAHDIDGFTSVLADDVSYTA
Ga0318575_1023299623300032055SoilMAITVREAFDKGTETFNAHDIDGFTSVLADDVSYTAPGGMTGR
Ga0318553_1011312923300032068SoilMAMTVHQAFVTGTETFNAHDIDGFTSVLADDVVFQAPGGMAGQGK
Ga0318553_1060210013300032068SoilMAMTAREAFEKGTETFNAHDIDGFTGVLADDVVYRAPGGVSGQGKAACAA
Ga0306924_1042423433300032076SoilMAMTAREAFEKGTKTFNAHDIDGFAGVLANDVVFEA
Ga0306924_1082115423300032076SoilMGMSAREAFERGTNAFNAHDMKGFAEVLADDVAFGAPGGIR
Ga0318525_1054231523300032089SoilMAMTAREAFEKGTETFNAHDIDGFTGVLADDVVYRAPGGVTGQG
Ga0318518_1056852013300032090SoilMAMTTREDFEKGTATFNAHDIGGFAEVLADDVGFEAPGGMRGHGKTACV
Ga0307470_1001291133300032174Hardwood Forest SoilMAMTVREAFEKGTETFNAHDIDGFTGVLADDVVYRAPGGISGQGKE
Ga0307471_10098496523300032180Hardwood Forest SoilMAMTVREAFEKGTDTFNAHDIDGFTSVLDDDVVYQAPGG
Ga0306920_10272390713300032261SoilMTMTVHEAFERGMDTFNTHVLDGFAEVLVADVVFE
Ga0306920_10417745113300032261SoilMAMTVREAFQKGTDTFNAHDIDGFTSVLAEDAVYQ
Ga0335080_1083854213300032828SoilMAMTVREAFGKGTETFNAHDIDGFTGVLADDVVFH
Ga0335081_1199584213300032892SoilMAMTVREAFERGTQTFNAHDIDRFTSVLADDVTYHAPGGMSG
Ga0335077_1029623333300033158SoilMTMTIQEAFERGTDTFNAHDMDGFAEVVADDVVVVAPGVRCD
Ga0318519_1032081523300033290SoilMAMTVREAFDKGTETFNAHDIDGFTSVLADDVSYTAPGGMTGQGK
Ga0247829_1156234413300033550SoilMTMTTREAFERGTDTFNAHDTDGFAGVLADDAVFTAPGGLRGAG
Ga0373958_0203859_3_1073300034819Rhizosphere SoilMTMTAREAFERGTATFNAHDLDGFTEVLADDVVFT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.