


| Basic Information | |
|---|---|
| Family ID | F031807 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 39 residues |
| Representative Sequence | YFWLYMGSFGIGLGAVAIAFTFRPPRPLPAALPSPSVAG |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.55 % |
| % of genes near scaffold ends (potentially truncated) | 98.90 % |
| % of genes from short scaffolds (< 2000 bps) | 89.50 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.055 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.812 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.652 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.304 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.85% β-sheet: 0.00% Coil/Unstructured: 70.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF03795 | YCII | 11.60 |
| PF11716 | MDMPI_N | 4.97 |
| PF02515 | CoA_transf_3 | 2.76 |
| PF13561 | adh_short_C2 | 2.21 |
| PF13801 | Metal_resist | 2.21 |
| PF00211 | Guanylate_cyc | 2.21 |
| PF01909 | NTP_transf_2 | 1.66 |
| PF00005 | ABC_tran | 1.66 |
| PF00999 | Na_H_Exchanger | 1.66 |
| PF05721 | PhyH | 1.10 |
| PF07992 | Pyr_redox_2 | 1.10 |
| PF01471 | PG_binding_1 | 1.10 |
| PF00528 | BPD_transp_1 | 1.10 |
| PF07995 | GSDH | 1.10 |
| PF12773 | DZR | 1.10 |
| PF00296 | Bac_luciferase | 1.10 |
| PF04909 | Amidohydro_2 | 1.10 |
| PF12681 | Glyoxalase_2 | 1.10 |
| PF02012 | BNR | 1.10 |
| PF07883 | Cupin_2 | 1.10 |
| PF07690 | MFS_1 | 1.10 |
| PF00724 | Oxidored_FMN | 1.10 |
| PF00575 | S1 | 1.10 |
| PF07519 | Tannase | 1.10 |
| PF03401 | TctC | 0.55 |
| PF15071 | TMEM220 | 0.55 |
| PF13088 | BNR_2 | 0.55 |
| PF00891 | Methyltransf_2 | 0.55 |
| PF04248 | NTP_transf_9 | 0.55 |
| PF04199 | Cyclase | 0.55 |
| PF00581 | Rhodanese | 0.55 |
| PF14833 | NAD_binding_11 | 0.55 |
| PF01734 | Patatin | 0.55 |
| PF08281 | Sigma70_r4_2 | 0.55 |
| PF02775 | TPP_enzyme_C | 0.55 |
| PF13602 | ADH_zinc_N_2 | 0.55 |
| PF04542 | Sigma70_r2 | 0.55 |
| PF00011 | HSP20 | 0.55 |
| PF13302 | Acetyltransf_3 | 0.55 |
| PF04986 | Y2_Tnp | 0.55 |
| PF11373 | DUF3175 | 0.55 |
| PF14559 | TPR_19 | 0.55 |
| PF01717 | Meth_synt_2 | 0.55 |
| PF08327 | AHSA1 | 0.55 |
| PF11723 | Aromatic_hydrox | 0.55 |
| PF13522 | GATase_6 | 0.55 |
| PF01075 | Glyco_transf_9 | 0.55 |
| PF00664 | ABC_membrane | 0.55 |
| PF02417 | Chromate_transp | 0.55 |
| PF12849 | PBP_like_2 | 0.55 |
| PF08883 | DOPA_dioxygen | 0.55 |
| PF01547 | SBP_bac_1 | 0.55 |
| PF12836 | HHH_3 | 0.55 |
| PF07302 | AroM | 0.55 |
| PF02518 | HATPase_c | 0.55 |
| PF13480 | Acetyltransf_6 | 0.55 |
| PF09347 | DUF1989 | 0.55 |
| PF00815 | Histidinol_dh | 0.55 |
| PF12710 | HAD | 0.55 |
| PF03466 | LysR_substrate | 0.55 |
| PF01464 | SLT | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 11.60 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 2.76 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 2.21 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.66 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.66 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.66 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.66 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.66 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 1.10 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.10 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.10 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.10 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 1.10 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.55 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.55 |
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.55 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.55 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.55 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.55 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.55 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.55 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.55 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.55 |
| COG3805 | Aromatic ring-cleaving dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.55 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.55 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.61 % |
| Unclassified | root | N/A | 9.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100664765 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300002560|JGI25383J37093_10049786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1356 | Open in IMG/M |
| 3300004024|Ga0055436_10007565 | All Organisms → cellular organisms → Bacteria | 2281 | Open in IMG/M |
| 3300004156|Ga0062589_101723339 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005166|Ga0066674_10442379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300005167|Ga0066672_10354829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300005180|Ga0066685_10198836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1375 | Open in IMG/M |
| 3300005181|Ga0066678_10503057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
| 3300005332|Ga0066388_104773967 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005334|Ga0068869_100497572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1017 | Open in IMG/M |
| 3300005445|Ga0070708_100354877 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300005471|Ga0070698_102123250 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005534|Ga0070735_10031302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 3692 | Open in IMG/M |
| 3300005545|Ga0070695_100623737 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005545|Ga0070695_101252070 | Not Available | 612 | Open in IMG/M |
| 3300005555|Ga0066692_10506309 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005556|Ga0066707_10357650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300005558|Ga0066698_10907484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300005559|Ga0066700_10602544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300005577|Ga0068857_100714543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 953 | Open in IMG/M |
| 3300005617|Ga0068859_101054613 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300005713|Ga0066905_100166785 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1607 | Open in IMG/M |
| 3300005843|Ga0068860_100471386 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300005981|Ga0081538_10058855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2225 | Open in IMG/M |
| 3300006031|Ga0066651_10728426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 534 | Open in IMG/M |
| 3300006046|Ga0066652_100647010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1002 | Open in IMG/M |
| 3300006796|Ga0066665_10457354 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300006804|Ga0079221_11466631 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006847|Ga0075431_102205796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 505 | Open in IMG/M |
| 3300006852|Ga0075433_10198205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1785 | Open in IMG/M |
| 3300006852|Ga0075433_11938719 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006853|Ga0075420_101166199 | Not Available | 662 | Open in IMG/M |
| 3300006871|Ga0075434_102263661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300006903|Ga0075426_10697724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 761 | Open in IMG/M |
| 3300006904|Ga0075424_101994736 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006904|Ga0075424_102254461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300006914|Ga0075436_101028824 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006969|Ga0075419_10664501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300007076|Ga0075435_100242702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1532 | Open in IMG/M |
| 3300009088|Ga0099830_11571141 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300009090|Ga0099827_10046869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3232 | Open in IMG/M |
| 3300009090|Ga0099827_10941527 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300009098|Ga0105245_10735589 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300009100|Ga0075418_12450521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300009137|Ga0066709_102139824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300009147|Ga0114129_13416343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300009148|Ga0105243_12780920 | Not Available | 530 | Open in IMG/M |
| 3300009162|Ga0075423_11492226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300009553|Ga0105249_13175218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300010043|Ga0126380_11967473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300010048|Ga0126373_10261148 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300010048|Ga0126373_12254656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300010304|Ga0134088_10508150 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300010358|Ga0126370_12019363 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010358|Ga0126370_12623956 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010359|Ga0126376_10114036 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2092 | Open in IMG/M |
| 3300010359|Ga0126376_12283987 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010359|Ga0126376_13027303 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010360|Ga0126372_12158848 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300010360|Ga0126372_13219438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300010361|Ga0126378_13280158 | Not Available | 514 | Open in IMG/M |
| 3300010362|Ga0126377_11581684 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010362|Ga0126377_12903044 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010366|Ga0126379_13871509 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010371|Ga0134125_12882069 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010373|Ga0134128_12150103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 615 | Open in IMG/M |
| 3300010376|Ga0126381_101058759 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300010376|Ga0126381_102044121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300010376|Ga0126381_102912883 | Not Available | 681 | Open in IMG/M |
| 3300010391|Ga0136847_13597996 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300010398|Ga0126383_11837876 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 694 | Open in IMG/M |
| 3300010398|Ga0126383_12229984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 634 | Open in IMG/M |
| 3300010399|Ga0134127_12770076 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 570 | Open in IMG/M |
| 3300010400|Ga0134122_13394282 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010401|Ga0134121_12831560 | Not Available | 531 | Open in IMG/M |
| 3300011270|Ga0137391_10634859 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300012171|Ga0137342_1044201 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300012202|Ga0137363_11341472 | Not Available | 604 | Open in IMG/M |
| 3300012205|Ga0137362_10023073 | All Organisms → cellular organisms → Bacteria | 4829 | Open in IMG/M |
| 3300012205|Ga0137362_10405196 | Not Available | 1181 | Open in IMG/M |
| 3300012205|Ga0137362_10858942 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 776 | Open in IMG/M |
| 3300012208|Ga0137376_10493571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1062 | Open in IMG/M |
| 3300012355|Ga0137369_10157489 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1797 | Open in IMG/M |
| 3300012361|Ga0137360_10013053 | All Organisms → cellular organisms → Bacteria | 5348 | Open in IMG/M |
| 3300012362|Ga0137361_10064290 | All Organisms → cellular organisms → Bacteria | 3082 | Open in IMG/M |
| 3300012362|Ga0137361_10162096 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300012362|Ga0137361_10352325 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1351 | Open in IMG/M |
| 3300012400|Ga0134048_1370231 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300012582|Ga0137358_10286331 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300012924|Ga0137413_10852783 | Not Available | 704 | Open in IMG/M |
| 3300012927|Ga0137416_10421482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1135 | Open in IMG/M |
| 3300012930|Ga0137407_11975124 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012944|Ga0137410_10561690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
| 3300012976|Ga0134076_10556502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300013306|Ga0163162_10792520 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300015241|Ga0137418_10170494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1902 | Open in IMG/M |
| 3300015241|Ga0137418_10473619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1007 | Open in IMG/M |
| 3300016319|Ga0182033_11003905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300016371|Ga0182034_11092902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 691 | Open in IMG/M |
| 3300016422|Ga0182039_10422226 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300017656|Ga0134112_10003034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5191 | Open in IMG/M |
| 3300017656|Ga0134112_10113628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
| 3300018031|Ga0184634_10490055 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300019254|Ga0184641_1001907 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 597 | Open in IMG/M |
| 3300019362|Ga0173479_10152009 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300020004|Ga0193755_1178549 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300020060|Ga0193717_1187591 | Not Available | 571 | Open in IMG/M |
| 3300020580|Ga0210403_10594522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 894 | Open in IMG/M |
| 3300021073|Ga0210378_10070168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
| 3300021080|Ga0210382_10505757 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300021088|Ga0210404_10886965 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300021362|Ga0213882_10027118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2201 | Open in IMG/M |
| 3300021377|Ga0213874_10325104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 584 | Open in IMG/M |
| 3300021404|Ga0210389_10415478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300021407|Ga0210383_11387266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300021432|Ga0210384_10376669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1278 | Open in IMG/M |
| 3300021432|Ga0210384_11021704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 729 | Open in IMG/M |
| 3300021433|Ga0210391_10597112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 867 | Open in IMG/M |
| 3300021474|Ga0210390_11515941 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
| 3300021560|Ga0126371_11871252 | Not Available | 720 | Open in IMG/M |
| 3300022708|Ga0242670_1039112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300025538|Ga0210132_1022126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 888 | Open in IMG/M |
| 3300025928|Ga0207700_10569382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1007 | Open in IMG/M |
| 3300025933|Ga0207706_10845629 | Not Available | 775 | Open in IMG/M |
| 3300025944|Ga0207661_11213067 | Not Available | 694 | Open in IMG/M |
| 3300025961|Ga0207712_11443559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300025972|Ga0207668_11689052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 572 | Open in IMG/M |
| 3300026035|Ga0207703_11937288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300026089|Ga0207648_11380373 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 662 | Open in IMG/M |
| 3300026295|Ga0209234_1127258 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300026318|Ga0209471_1240353 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300026320|Ga0209131_1016774 | All Organisms → cellular organisms → Bacteria | 4458 | Open in IMG/M |
| 3300026322|Ga0209687_1263746 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 537 | Open in IMG/M |
| 3300026326|Ga0209801_1365882 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300026327|Ga0209266_1191117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300026330|Ga0209473_1051098 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300026376|Ga0257167_1018848 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300026529|Ga0209806_1045889 | All Organisms → cellular organisms → Bacteria | 2080 | Open in IMG/M |
| 3300026529|Ga0209806_1104283 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300026536|Ga0209058_1221563 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300026538|Ga0209056_10440057 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 756 | Open in IMG/M |
| 3300026552|Ga0209577_10026774 | All Organisms → cellular organisms → Bacteria | 5047 | Open in IMG/M |
| 3300027521|Ga0209524_1118428 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 553 | Open in IMG/M |
| 3300027655|Ga0209388_1072814 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300027671|Ga0209588_1051379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1333 | Open in IMG/M |
| 3300027695|Ga0209966_1147462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 547 | Open in IMG/M |
| 3300027862|Ga0209701_10373249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 802 | Open in IMG/M |
| 3300027880|Ga0209481_10461195 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300027882|Ga0209590_10579634 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300030336|Ga0247826_10778131 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300030743|Ga0265461_13235438 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031544|Ga0318534_10651080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 597 | Open in IMG/M |
| 3300031708|Ga0310686_109551974 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300031720|Ga0307469_10023221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3427 | Open in IMG/M |
| 3300031720|Ga0307469_10302048 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1319 | Open in IMG/M |
| 3300031740|Ga0307468_101129776 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 700 | Open in IMG/M |
| 3300031740|Ga0307468_101288708 | Not Available | 664 | Open in IMG/M |
| 3300031744|Ga0306918_11303264 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 559 | Open in IMG/M |
| 3300031753|Ga0307477_10964663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300031754|Ga0307475_11558378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300031765|Ga0318554_10064742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2020 | Open in IMG/M |
| 3300031768|Ga0318509_10320343 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 868 | Open in IMG/M |
| 3300031820|Ga0307473_10227893 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300031833|Ga0310917_11020762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 554 | Open in IMG/M |
| 3300031845|Ga0318511_10360353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300031890|Ga0306925_12255905 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300031910|Ga0306923_10133701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2823 | Open in IMG/M |
| 3300031941|Ga0310912_10703268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 783 | Open in IMG/M |
| 3300031945|Ga0310913_10760540 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 684 | Open in IMG/M |
| 3300032001|Ga0306922_11679581 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 629 | Open in IMG/M |
| 3300032009|Ga0318563_10384336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
| 3300032055|Ga0318575_10176750 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1068 | Open in IMG/M |
| 3300032059|Ga0318533_10008001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6255 | Open in IMG/M |
| 3300032076|Ga0306924_11367113 | Not Available | 757 | Open in IMG/M |
| 3300032089|Ga0318525_10070116 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1760 | Open in IMG/M |
| 3300032180|Ga0307471_102047562 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300032205|Ga0307472_101206610 | Not Available | 723 | Open in IMG/M |
| 3300032205|Ga0307472_102117821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300032205|Ga0307472_102186160 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 558 | Open in IMG/M |
| 3300033004|Ga0335084_11546264 | Not Available | 655 | Open in IMG/M |
| 3300033433|Ga0326726_11449708 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 668 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.05% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.29% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.21% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.66% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.10% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.10% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.55% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.55% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1006647652 | 3300000559 | Soil | WLYMGSFGIGLGAVAIAFTFRQPGPSTVTLPSPSAAH* |
| JGI25383J37093_100497864 | 3300002560 | Grasslands Soil | SYVWLFIGSAGIGLGAVAIALTFKAPRQLGAALPSPSVS* |
| Ga0055436_100075656 | 3300004024 | Natural And Restored Wetlands | GSYFWLYMGSFGIGLGAVAIAVTFRAPRRLPAALAAPSLAR* |
| Ga0062589_1017233391 | 3300004156 | Soil | SYAWLFIGSAAIGLGAVAIAFTFRPPRSLPAVLPSPSVAH* |
| Ga0066674_104423791 | 3300005166 | Soil | GSYFWLYMGSFGIGLGAVAIAFTFRPPRQLPAALPVPSAAH* |
| Ga0066672_103548291 | 3300005167 | Soil | FGSYVWLFIGSAGIGLGAVAIALTFRPPRQLSPALPSPSLAH* |
| Ga0066685_101988363 | 3300005180 | Soil | LGSYFWLYMGSFGIGLGAVAIAFTFRPPRRLPAALPSPVVAG* |
| Ga0066678_105030572 | 3300005181 | Soil | YFWLYIGSFGIGLGAVAIAITFRPPRREPAAMPAPSLAH* |
| Ga0066388_1047739672 | 3300005332 | Tropical Forest Soil | SYFWLFIGSAGIGLGAAAIAFTFRAPRQVPAGIPTASLAH* |
| Ga0068869_1004975721 | 3300005334 | Miscanthus Rhizosphere | YFWLYMGSFGIGLGAVAIAFTFRPPRRVPVVLPAPSLAH* |
| Ga0070708_1003548772 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GYFWLFLGSFGIGVAAVAIAVTFRAPGPAPVVLATPSAAH* |
| Ga0070698_1021232502 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SYAWLFIGSCGIGLGAVAIAFTFRPPRELPAVLPDPSMAH* |
| Ga0070735_100313021 | 3300005534 | Surface Soil | SYFWLYIGSFGIGLGAVAIALTFRPPATRPLVLASSLA* |
| Ga0070695_1006237373 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GSYAWLFIGSAAIGLGAVAIALTFRPPRELSAALPSPSVAH* |
| Ga0070695_1012520702 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TSGSYAWLFIGSAAIGLGAVAIAFTFRPPRSLSAALPSPSVAH* |
| Ga0066692_105063091 | 3300005555 | Soil | WLFIGSAGIGLGAVGIALTFRAPRPLSPALPTPSLAH* |
| Ga0066707_103576503 | 3300005556 | Soil | GSYFWLYIGSFGIGLGAVAIAFTFSPAGELGAAVPSPSMAHGV* |
| Ga0066698_109074842 | 3300005558 | Soil | SFGIGLGAVAIAFTFRPPRERSVGLPRPSVTQSA* |
| Ga0066700_106025441 | 3300005559 | Soil | FWLYIGSFGIGLGAVAIALTFRPPREISVALPGASVTQRA* |
| Ga0068857_1007145432 | 3300005577 | Corn Rhizosphere | GSYFWLYMGSFGIGLGAVAIALTFRPPRAARALVPAPSAGG* |
| Ga0068859_1010546132 | 3300005617 | Switchgrass Rhizosphere | LYMGSFGIGLGAVAIALTFRPPRAARALVPAPSAGG* |
| Ga0066905_1001667852 | 3300005713 | Tropical Forest Soil | FWLYVGSFGIGLGAVAIAFTFRPPRRAPAALPTPSLAT* |
| Ga0068860_1004713862 | 3300005843 | Switchgrass Rhizosphere | GSYFWLYMGSFGIGLGAVAIAITFRPPRPVMSAMPRPVAAL* |
| Ga0081538_100588551 | 3300005981 | Tabebuia Heterophylla Rhizosphere | YAALGSYAWLFMGWGGIGLGAVAIACTFRPPRPLPAALPSPSVAH* |
| Ga0066651_107284262 | 3300006031 | Soil | SYFWLYIGSFGIGLGAVAIAFSFRPPRQLAAALPSPSLAH* |
| Ga0066652_1006470101 | 3300006046 | Soil | SYAWLYIGSTAIGLGAIAIALTFRPPRVLLVGLPAPSPAG* |
| Ga0066665_104573544 | 3300006796 | Soil | WLFVGSFGIGLGAVAIAATFRAPRPLLAAAVPSPSIS* |
| Ga0079221_114666312 | 3300006804 | Agricultural Soil | VGSFGIGLGAVAIAFTFRPPHDLSLGLPSPSVTQSA* |
| Ga0075431_1022057961 | 3300006847 | Populus Rhizosphere | LWLYVGSSAIGLGAIAIAVTFRPPRRVALALPNPAPAG* |
| Ga0075433_101982054 | 3300006852 | Populus Rhizosphere | YFWLYMGSFGIGLGAVAIAFTFRPPRPLPAALPSPSVAG* |
| Ga0075433_119387192 | 3300006852 | Populus Rhizosphere | FWLFIASATIGVGAVAVAFTFRSPRQAPATLASPQEVTS* |
| Ga0075420_1011661992 | 3300006853 | Populus Rhizosphere | MVFIASSAIGVGAVAIALTFRPPRAVPVALPSPSAAH* |
| Ga0075434_1022636612 | 3300006871 | Populus Rhizosphere | WLFIGSFGIGLGAVAIALTFRPPRALPAALPSPSPAS* |
| Ga0075426_106977242 | 3300006903 | Populus Rhizosphere | FWLYMGSFGIGLGAVAIAFTFRPPRRVLAALPTPSPAH* |
| Ga0075424_1019947362 | 3300006904 | Populus Rhizosphere | GSYAWLFIGSCAIGLGAVAIASTFRPPRAIAVPLPVPSPAR* |
| Ga0075424_1022544611 | 3300006904 | Populus Rhizosphere | LFIGSFGIGLGAVAIALTFRPPRALPAALPSPSPAS* |
| Ga0075436_1010288241 | 3300006914 | Populus Rhizosphere | SYAWLFIGSFGIGLGAVAIALTFRPPRTLAAVLPSALAAG* |
| Ga0075419_106645013 | 3300006969 | Populus Rhizosphere | GSYFWLFAGSAGIGLGAVAIAATFRPPQPVQVPLPTPSLAG* |
| Ga0075435_1002427022 | 3300007076 | Populus Rhizosphere | GYFWLYMGSFGIGLGAVAIAFTFRPPRRVLAALPTPSPAH* |
| Ga0099830_115711412 | 3300009088 | Vadose Zone Soil | YMGSFGIGLGAVAIAFTFRPPRQLPAALPVPSVAH* |
| Ga0099827_100468691 | 3300009090 | Vadose Zone Soil | FGSYFWLYMGSFGIGLGAVAIAFTFRAPRQLPVALPSPSVAH* |
| Ga0099827_109415271 | 3300009090 | Vadose Zone Soil | MGSFGIGLGAVAIAMTFRPPSRAPAAAPSPSLAH* |
| Ga0105245_107355891 | 3300009098 | Miscanthus Rhizosphere | MGSFGIGLGAVAIAITFRPPRPVMSAMPRPVAAL* |
| Ga0075418_124505211 | 3300009100 | Populus Rhizosphere | SLGSYFWLYMGSFGIGLGAVAIAFTFRPPRRIPAALPSPSVAG* |
| Ga0066709_1021398243 | 3300009137 | Grasslands Soil | GSFGIGLGAVVIALTFRPPRELSLALPSPSVTQSA* |
| Ga0114129_134163432 | 3300009147 | Populus Rhizosphere | SYVWLYIASSGIGLGAIAIALTFRAPRTLPAALPSPGLAG* |
| Ga0105243_127809202 | 3300009148 | Miscanthus Rhizosphere | FWLFVSSSAIGLGAVAIALTFRPPRPAGLPLPVPSPAR* |
| Ga0075423_114922263 | 3300009162 | Populus Rhizosphere | WLFIGSAGIGLGAVAIALTFKAPRPLGAALPSPSVS* |
| Ga0105249_131752182 | 3300009553 | Switchgrass Rhizosphere | YFWMYMGSAGIGLGAVAIAFTFRPPERQPVALAAAGVA* |
| Ga0126380_119674732 | 3300010043 | Tropical Forest Soil | YIGSFGIGLGAVAIAFTFRAPRQLSLALPSPRVA* |
| Ga0126373_102611484 | 3300010048 | Tropical Forest Soil | YIGSFGIGLGAVAIALTFRPPREFSLALASPRVA* |
| Ga0126373_122546562 | 3300010048 | Tropical Forest Soil | NYFWLFIGSFGIGLGAVAIALTFRPPRELSLALPRSRLAQGAE* |
| Ga0134088_105081501 | 3300010304 | Grasslands Soil | FWLYMGSFGIGLGAVAIAFTFRPPRRLPAAMPSPIAAG* |
| Ga0126370_120193631 | 3300010358 | Tropical Forest Soil | TFGSYFWLFIGSAGIGLGAAAIAFTFRAPRQVPAGIPTASLAH* |
| Ga0126370_126239561 | 3300010358 | Tropical Forest Soil | YMGSFGIGLGAVAIAFTFRPPRRQPAALPSPSLAT* |
| Ga0126376_101140363 | 3300010359 | Tropical Forest Soil | FWLYMGSFGIGLGAVAIAFTFRPPRRQPAVLPSPSLAT* |
| Ga0126376_122839872 | 3300010359 | Tropical Forest Soil | LYMGSFGIGLGAVAIELTFRPPRRLPAALPSPSVAG* |
| Ga0126376_130273031 | 3300010359 | Tropical Forest Soil | IGACAIGLGAVAIALMFRPPRSIPAALPAPSVAH* |
| Ga0126372_121588482 | 3300010360 | Tropical Forest Soil | FGSYFWLFIGSAGIGLGAAAIAFTFRAPRQVPAGIPTASLAH* |
| Ga0126372_132194381 | 3300010360 | Tropical Forest Soil | YDMFGSYFWLYMGSLGIGLGAVAIALTFDPPRAQPVARPSLAH* |
| Ga0126378_132801581 | 3300010361 | Tropical Forest Soil | GSFGIGLGAFAIALTFRPPREFSIPLPGPGIVQRA* |
| Ga0126377_115816842 | 3300010362 | Tropical Forest Soil | YMGSFGIGLGAVAIAFTFRPPPRRLAAALPSPSIAG* |
| Ga0126377_129030441 | 3300010362 | Tropical Forest Soil | WLYLGSFGIGLGAVAIAFTFRPPRRALAALPTPSPAV* |
| Ga0126379_138715092 | 3300010366 | Tropical Forest Soil | DTFGSYFWLFIGSAGIGLGAAAIAFTFRAPRPAPAGIPTASLAH* |
| Ga0134125_128820692 | 3300010371 | Terrestrial Soil | SGSYFWLFIGSAAIGLGAVAIALTFRPPRTIPAALPSPLAAG* |
| Ga0134128_121501031 | 3300010373 | Terrestrial Soil | YFWMYIGSFGIGLGAVAIAFTFRPPERQQVALAMA* |
| Ga0126381_1010587593 | 3300010376 | Tropical Forest Soil | FWLFIGSAGIGLGAAAIAFTFRAPRQVPAGIPTASLAH* |
| Ga0126381_1020441211 | 3300010376 | Tropical Forest Soil | SYFWMYVGSFGIGLGAVAIAVTFRPPQRQAVALAVA* |
| Ga0126381_1029128831 | 3300010376 | Tropical Forest Soil | LYIGSFGIGLGAVAIALTFRPPRQVSFELPGRGVTQSA* |
| Ga0136847_135979963 | 3300010391 | Freshwater Sediment | FWLYMGSFGIGLGAVAIAFTFRAPSRLPAALASPSAAH* |
| Ga0126383_118378761 | 3300010398 | Tropical Forest Soil | LYIGSFGIGLGAVAIALTFRPPREFSIPLPGPGIVQRA* |
| Ga0126383_122299841 | 3300010398 | Tropical Forest Soil | IGSFGIGLGAVAIALTFRPPREVLVGLPSPRITQSA* |
| Ga0134127_127700761 | 3300010399 | Terrestrial Soil | SYLWLFVGSSAIGVGAIAIAVTFRPPRRLLAALPSYTPAG* |
| Ga0134122_133942822 | 3300010400 | Terrestrial Soil | WLFIGSFAIGLGAVAIALTFRPPRTAAAVLPSPVAAG* |
| Ga0134121_128315602 | 3300010401 | Terrestrial Soil | WLFVASAGIGLGAVAIASAFRPPRTLPAGLPSPSAAR* |
| Ga0137391_106348592 | 3300011270 | Vadose Zone Soil | WLFMGSFGIGLGAVAIAFTFRPPRVLAVAQPRPSLAH* |
| Ga0137342_10442011 | 3300012171 | Soil | MGSFGIGLGAVAIAATFHPPGRAPAAVPVPTPAH* |
| Ga0137363_113414722 | 3300012202 | Vadose Zone Soil | WLYIGSFGIGLGAVPIALTFRPPREVSVFPPSPTVPQRP* |
| Ga0137362_100230731 | 3300012205 | Vadose Zone Soil | SYFWLFMGSFGIGLGAVAIAFTFRPPRALALAQPRPSLAH* |
| Ga0137362_104051961 | 3300012205 | Vadose Zone Soil | LYIGSFGIGLGAVAIALTFRPPRELSVGLPGASVTQSA* |
| Ga0137362_108589421 | 3300012205 | Vadose Zone Soil | FWLYIGSFGIGLGAVAIALTFRPPRELPVALPSPSVAQSA* |
| Ga0137376_104935713 | 3300012208 | Vadose Zone Soil | WLYIGSFAIGLGAVAIAITFRPPRREPAAMPAPSLAH* |
| Ga0137369_101574891 | 3300012355 | Vadose Zone Soil | FWLYIGSCGIGLGAVAIACTIRPPSDVPAALLSPSRAA* |
| Ga0137360_100130539 | 3300012361 | Vadose Zone Soil | YFWLFMGSFGIGLGAVAIAFTFRPPRGLLVAQPRPSLAH* |
| Ga0137361_100642904 | 3300012362 | Vadose Zone Soil | SGSYAWLFIASSGIGAGAVAISLTFRPPRPAPVVLATPSPAH* |
| Ga0137361_101620961 | 3300012362 | Vadose Zone Soil | LGSYFWLYMGSFGIGLGAVAIAFTFRPPQLLPAAVPSPIAAG* |
| Ga0137361_103523252 | 3300012362 | Vadose Zone Soil | WLFIGSAGIGLGAVAIALTFRPPRHLSPALPSPSLAH* |
| Ga0134048_13702314 | 3300012400 | Grasslands Soil | LFIGSAGIGLGAVAIALTFKAPRPLGAALPSPSVS* |
| Ga0137358_102863311 | 3300012582 | Vadose Zone Soil | VWLFTGSAGIGLGAVAITFTFRAPRQLPAALPSPSVS* |
| Ga0137413_108527832 | 3300012924 | Vadose Zone Soil | YSNYFWLYSGSFGIGLGAVAIALTFRPPREVSVFPPSPTVPQRA* |
| Ga0137416_104214822 | 3300012927 | Vadose Zone Soil | FIGSAGIGLGAVAIALSFRPPRHLSPTLPSPSLAH* |
| Ga0137407_119751242 | 3300012930 | Vadose Zone Soil | YMGSFGIGLGAVAIAFTFRPPRQMPVALPVPSAAS* |
| Ga0137410_105616901 | 3300012944 | Vadose Zone Soil | LGSYFWLYMGSFGIGLGAVAIAFTFRPPRRLPVAVPSAVAAG* |
| Ga0134076_105565022 | 3300012976 | Grasslands Soil | SYFWLFVGSFGIGLGAVAIAFTFRPPAEALAALGRAEAATSA* |
| Ga0163162_107925201 | 3300013306 | Switchgrass Rhizosphere | SGSYAWLFIGSAAIGLGAVAIAFTFRPPRSLSAALPSPSVAH* |
| Ga0137418_101704942 | 3300015241 | Vadose Zone Soil | FWLYMGSFGIGLGAVAIAFTFRPPQPLPAAVPSPIAAG* |
| Ga0137418_104736191 | 3300015241 | Vadose Zone Soil | YDVFGSYVWLFIGSAGIGLGAVAIALTFKAPRQLGAALPSPSVS* |
| Ga0182033_110039052 | 3300016319 | Soil | YIGSFGIGLGAVAIALTFRPPREISAGLQSASVAQSA |
| Ga0182034_110929021 | 3300016371 | Soil | WLFIGSFGIGLGAVAIALTFRPPRQVSFELPGRGVTQSA |
| Ga0182039_104222262 | 3300016422 | Soil | YVGSFGIGLAAVAIALTFRPPREISAGLQSASVAQSA |
| Ga0134112_100030346 | 3300017656 | Grasslands Soil | FWLFLGSFGIGLGAVAIAVTFRPPHAVVAALPTPGVAR |
| Ga0134112_101136283 | 3300017656 | Grasslands Soil | GSYFWLYMGSFGIGLGAVAIAFTFRPPRRLPAALPSPVVAG |
| Ga0184634_104900552 | 3300018031 | Groundwater Sediment | YFWLFIGSFGIGLGAVAIAAAFRPPGRVPVAMPSPTLAH |
| Ga0184641_10019072 | 3300019254 | Groundwater Sediment | YFWLYMGSFGIGLGAVAIAVTFRPPRPVMSALPRPVAAI |
| Ga0173479_101520091 | 3300019362 | Soil | LFIGSAAIGLGAVAIAFTFRPPRSLPAALPSPSVAH |
| Ga0193755_11785492 | 3300020004 | Soil | GSYAWLFIGSFGIGLGAVAIAFAFRPPAPFRVAVPSVAH |
| Ga0193717_11875912 | 3300020060 | Soil | FIGSSAIGLGAVAIAFTFRPPRSLSAALPSPSVAH |
| Ga0210403_105945223 | 3300020580 | Soil | GSYFWLYIGSFGIGLGAVAIAFTFRPPREVSVGLPIPQRA |
| Ga0210378_100701683 | 3300021073 | Groundwater Sediment | SYFWLFIASSGIGLGAVAIAFTFRPPRSLPAALPTPSVAA |
| Ga0210382_105057572 | 3300021080 | Groundwater Sediment | DAFGSYFWLFIASCGIGVGAVAIAFTFRPPHSLPAALPAPSVAR |
| Ga0210404_108869652 | 3300021088 | Soil | FIGSCGIGLGAVAIAITFRPPGLAPAAMPSPSLAAGG |
| Ga0213882_100271183 | 3300021362 | Exposed Rock | FWLYIGSFGIGLGAVAIALTFRPPRELSIALPSARVTQSA |
| Ga0213874_103251041 | 3300021377 | Plant Roots | YGWLYIGSFGIGLAAVLIALTFKPAVRLPRPAAMVPAE |
| Ga0210389_104154782 | 3300021404 | Soil | SYFWLYIGSFGIGLGAVAIALTFRPPREVSVVLPGPSVTQRA |
| Ga0210383_113872662 | 3300021407 | Soil | FGSYFWMYIGSFGIGLGAVAIAITFRPPERQPVAALSLQEA |
| Ga0210384_103766691 | 3300021432 | Soil | YFWLYIGSFGIGLGAVAIAFTFRPPREVSVGLPIPQRA |
| Ga0210384_110217042 | 3300021432 | Soil | YIGSFGIGLGAVAIAFTFRPPRELSLGLPSSGVTQRA |
| Ga0210391_105971121 | 3300021433 | Soil | GSYFWMYIGSFGIGLGAVAIAITFRPPERQPVAALSLQEA |
| Ga0210390_115159412 | 3300021474 | Soil | YFWLYIGSFGIGLGAVAIALTFRPPREVSVVLPGPSVTQRA |
| Ga0126371_118712521 | 3300021560 | Tropical Forest Soil | GSYFWLYIGSFGIGLGAVAIAFTFRPPREVALGVPNPGVVQSA |
| Ga0242670_10391121 | 3300022708 | Soil | QLSLALYGSFGIGLGAVAIALTFRPPREISLALPIASVTQRA |
| Ga0210132_10221263 | 3300025538 | Natural And Restored Wetlands | YFWLYMGSFGIGLGAVAIAVTFRAPRRLPAALAAPSLAR |
| Ga0207700_105693821 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SYFWLYIGSFGIALGAVAIAFTFRPPNRVQVAMPAASLA |
| Ga0207706_108456293 | 3300025933 | Corn Rhizosphere | YAWLFIGSAAIGLGAVAIAFTFRPPRSLPAALPSPSVAH |
| Ga0207661_112130672 | 3300025944 | Corn Rhizosphere | SYFWLYIASCGIGLSAVAIAFTFRPPQPRREFAVAVA |
| Ga0207712_114435591 | 3300025961 | Switchgrass Rhizosphere | FGSYFWMYMGSAGIGLGAVAIAFTFRPPERQPVALAAAGVA |
| Ga0207668_116890521 | 3300025972 | Switchgrass Rhizosphere | GSYGWLYIGSSAIGLGAVAIAFTFRPPRPLSAGLPSPSVAH |
| Ga0207703_119372881 | 3300026035 | Switchgrass Rhizosphere | SWLFLASFGIGLGAVAIAATFRAPRAMPAGLPSPGLAH |
| Ga0207648_113803732 | 3300026089 | Miscanthus Rhizosphere | MFIGSSAIGLGAVAIALTFRPPQLVAAALPSPSAAR |
| Ga0209234_11272583 | 3300026295 | Grasslands Soil | FLGSFGIGLGAVAIAFTFRAPRTRAAALPIPSVAH |
| Ga0209471_12403533 | 3300026318 | Soil | FGSYVWLFIGSAGIGLGAVGIALTFRPPRQLSAALPTPLAVH |
| Ga0209131_10167745 | 3300026320 | Grasslands Soil | AWMFIGSSAIGLGAVAIALTFRPPQLVGAALPSPSAAH |
| Ga0209687_12637461 | 3300026322 | Soil | GGYFWLFLGSFGIGLGAVAIAFTFRVPQSVPAALPSPSAAR |
| Ga0209801_13658822 | 3300026326 | Soil | WLYIGSFGIGLGAVAIAITFRPPRREPAAMPAPSLAH |
| Ga0209266_11911171 | 3300026327 | Soil | GSYFWLYMGSFGIGLGAVAIALTFRPPRPLPAAVPSPVAAG |
| Ga0209473_10510984 | 3300026330 | Soil | WLFLGSFGIGLGAVAIAATFRAPRRLPATLAMPVVAR |
| Ga0257167_10188483 | 3300026376 | Soil | YMGSFGIGLGAVAIAFTFRPPRQLPAALPVPSAAH |
| Ga0209806_10458891 | 3300026529 | Soil | YMGSFGIGLGAVAIALTFRPPRPLPAAVPSPVAAG |
| Ga0209806_11042834 | 3300026529 | Soil | FWLYIGSFAIGLGAVAIAITFRPPRRETAAMPAPSLAH |
| Ga0209058_12215631 | 3300026536 | Soil | WLFIASCGIGLGAVAIAFTFRPLRSLPAALPTPSAAH |
| Ga0209056_104400574 | 3300026538 | Soil | FVGSFGIGLGAVAIAATFRAPRPLLAAAVPSPSIS |
| Ga0209577_100267741 | 3300026552 | Soil | FIGSFGIGLGAAAVAVTFRPPCRLPATLPTPILAR |
| Ga0209524_11184281 | 3300027521 | Forest Soil | WLYIGSFGIGLGAVAIALTFRPPRELSVGLPGPSVAQSV |
| Ga0209388_10728143 | 3300027655 | Vadose Zone Soil | YFWLYMGSFGIGLGAVAIAFTFRPPRQLPAALPVPSAAH |
| Ga0209588_10513791 | 3300027671 | Vadose Zone Soil | FIGSAGIGLGAVAIALSFRPPRHLSPTLPSPSLAH |
| Ga0209966_11474621 | 3300027695 | Arabidopsis Thaliana Rhizosphere | LFAGSAGIGLGAVAIAATFRPPQPVQVPLPTPSLAG |
| Ga0209701_103732492 | 3300027862 | Vadose Zone Soil | FWLFIGSFGIGLGAVAIAFTFRPPRQLPAGLPTPIVVH |
| Ga0209481_104611951 | 3300027880 | Populus Rhizosphere | SYFWLFAGSAGIGLGAVAIAATFRPPQPVQVPLPTPSLAG |
| Ga0209590_105796341 | 3300027882 | Vadose Zone Soil | AWGSYFWLYMGSFGIGLGAVAIAFTFRPPRQVPMALPSPSVAH |
| Ga0247826_107781313 | 3300030336 | Soil | YSWLFVGSFGIGLGAVAIAFAFRPPAPFRVAVPSVAH |
| Ga0265461_132354381 | 3300030743 | Soil | YIGSFGIGLGAVVIAFTFRPPRESSVALPSPAITQSA |
| Ga0318534_106510801 | 3300031544 | Soil | FWLYIGSFGIGLGAVAIAFAFRPSREFSLALPSSSLIQGA |
| Ga0310686_1095519744 | 3300031708 | Soil | YIGSFGIGLGAVVITFTFRPPRESSVALPSPAITQSA |
| Ga0307469_100232211 | 3300031720 | Hardwood Forest Soil | LYMGSFGIGLGAVAIAFTFRPPRRVPAGLPAPSLAH |
| Ga0307469_103020483 | 3300031720 | Hardwood Forest Soil | GSYFWLYMGSFGIGLGAVAIAFTFRPPRQIPAAVPSPIAAG |
| Ga0307468_1011297762 | 3300031740 | Hardwood Forest Soil | LGGYFWLYMGSFGIGLGAVAIAFTFRPPRRLPAVLPAPSLAH |
| Ga0307468_1012887082 | 3300031740 | Hardwood Forest Soil | LYMGSFGIGLGAVAIALTFRPPRAAQALVPAPSAGG |
| Ga0306918_113032642 | 3300031744 | Soil | GGYFWLYMGSFGIGLGAVAIAVTFRPPRRVPGTMPAPMPAH |
| Ga0307477_109646632 | 3300031753 | Hardwood Forest Soil | GSFGIGLGAVAIALTFRPPREVSVGLPGASVTQSA |
| Ga0307475_115583782 | 3300031754 | Hardwood Forest Soil | SYFWLYIGSFGIGLGAVAIAFTFRPPREVSVGLPIPQRA |
| Ga0318554_100647423 | 3300031765 | Soil | SYFWLYIGSFGIGLGAVAIALTFRPPREISAGLRSASVTQSA |
| Ga0318509_103203432 | 3300031768 | Soil | LYIGSFGIGLGAVAIAFTFRPPREVLLGLPSPSVTQSA |
| Ga0307473_102278932 | 3300031820 | Hardwood Forest Soil | GYFWLYMGSFGIGLGAVAIAFTFRPPRRQPAALPSPSLAT |
| Ga0310917_110207621 | 3300031833 | Soil | DTFGSYFWRYLGSFGIGLGAVAIAFTFHPPRQLPVALAAPSVA |
| Ga0318511_103603532 | 3300031845 | Soil | IGSFGIGLGAVAIALTFRPPREVLVGLPSPSVTQSA |
| Ga0306925_122559052 | 3300031890 | Soil | CSYFWLYIGSFGIGLGAVAIALTFRPPREISAGLRSASVTQSA |
| Ga0306923_101337011 | 3300031910 | Soil | FWLYIGSFGIGLGAVAIALTFRPPREVSAVMPSPSIA |
| Ga0310912_107032683 | 3300031941 | Soil | WLYIGSFGIGLGAVAIALTFRPPREFSVVLPAPSLTSSA |
| Ga0310913_107605401 | 3300031945 | Soil | GSYFWLYIGSFGIGLGAVAIAFTFRPPRELAASRTSSTVPQRA |
| Ga0306922_116795811 | 3300032001 | Soil | WLYIGSFGIGLGAVAIAFTFRPPRDLSLALPVSRVTQGA |
| Ga0318563_103843361 | 3300032009 | Soil | FDTFGSYFWMYVGSFGIGLGAVAIAFTSRPPERQPMALAVA |
| Ga0318575_101767502 | 3300032055 | Soil | GSYFWRYLGSFGIGLGAVAIAFTFHPPRQLPVALAAPSVP |
| Ga0318533_100080018 | 3300032059 | Soil | SYFWLYIGSFGIGLGAVAIAFTFRPPRELAVPLPSPSLA |
| Ga0306924_113671132 | 3300032076 | Soil | IGSFGIGLGAVAIAFTFRPPRDLSLALPVSRVTQGA |
| Ga0318525_100701163 | 3300032089 | Soil | DTFGSYFWLFIGSAGIGLGAVAIAFTFRAPRRVPAGLPTASLAH |
| Ga0307471_1020475621 | 3300032180 | Hardwood Forest Soil | FIASCAIGLGAVAIAFTFRPPTAAPVVLPSPSPARLSG |
| Ga0307472_1012066101 | 3300032205 | Hardwood Forest Soil | TSGSYAWLFIGSAAIGLGAVAIALTFRPPRSLPAALPSPSVAH |
| Ga0307472_1021178212 | 3300032205 | Hardwood Forest Soil | YFWLYIGSFGIGLGAVAIALTFRPPRDLSATLPDLSVPQRA |
| Ga0307472_1021861602 | 3300032205 | Hardwood Forest Soil | LFIGSCAIGLGAVAIALTFRPPRPLSVVLPEPSPAR |
| Ga0335084_115462641 | 3300033004 | Soil | WLFIASSAIGLGAVAIALAFRPPQPAAAALPSPIPAS |
| Ga0326726_114497081 | 3300033433 | Peat Soil | WLYMGSFGIGLGAVAIALTFRPPRAARALVPAPSAGG |
| ⦗Top⦘ |