Basic Information | |
---|---|
Family ID | F031587 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 182 |
Average Sequence Length | 45 residues |
Representative Sequence | MAAGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAAL |
Number of Associated Samples | 141 |
Number of Associated Scaffolds | 182 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 94.44 % |
% of genes near scaffold ends (potentially truncated) | 81.32 % |
% of genes from short scaffolds (< 2000 bps) | 87.36 % |
Associated GOLD sequencing projects | 133 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.033 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.483 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.824 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.758 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 182 Family Scaffolds |
---|---|---|
PF00239 | Resolvase | 32.42 |
PF02796 | HTH_7 | 20.88 |
PF13384 | HTH_23 | 3.30 |
PF13518 | HTH_28 | 2.75 |
PF00589 | Phage_integrase | 2.75 |
PF06056 | Terminase_5 | 2.20 |
PF01526 | DDE_Tnp_Tn3 | 1.65 |
PF13466 | STAS_2 | 1.10 |
PF01740 | STAS | 1.10 |
PF00722 | Glyco_hydro_16 | 1.10 |
PF13551 | HTH_29 | 1.10 |
PF03631 | Virul_fac_BrkB | 1.10 |
PF07676 | PD40 | 1.10 |
PF13424 | TPR_12 | 1.10 |
PF00196 | GerE | 0.55 |
PF11752 | DUF3309 | 0.55 |
PF07228 | SpoIIE | 0.55 |
PF05899 | Cupin_3 | 0.55 |
PF02371 | Transposase_20 | 0.55 |
PF13401 | AAA_22 | 0.55 |
PF01638 | HxlR | 0.55 |
PF10099 | RskA | 0.55 |
PF13700 | DUF4158 | 0.55 |
PF00069 | Pkinase | 0.55 |
PF09339 | HTH_IclR | 0.55 |
PF02899 | Phage_int_SAM_1 | 0.55 |
PF10604 | Polyketide_cyc2 | 0.55 |
PF07366 | SnoaL | 0.55 |
PF01464 | SLT | 0.55 |
PF00561 | Abhydrolase_1 | 0.55 |
PF07586 | HXXSHH | 0.55 |
COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
---|---|---|---|
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 32.42 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 32.42 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.20 |
COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 1.65 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.10 |
COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 1.10 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.55 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.55 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.03 % |
Unclassified | root | N/A | 32.97 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459012|GOYVCMS01ETMRQ | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300001661|JGI12053J15887_10505248 | Not Available | 577 | Open in IMG/M |
3300003152|Ga0052254_1001051 | Not Available | 528 | Open in IMG/M |
3300004152|Ga0062386_100604672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 896 | Open in IMG/M |
3300005187|Ga0066675_10778931 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300005332|Ga0066388_101310792 | Not Available | 1249 | Open in IMG/M |
3300005332|Ga0066388_108665803 | Not Available | 506 | Open in IMG/M |
3300005335|Ga0070666_10824756 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300005335|Ga0070666_11308845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 541 | Open in IMG/M |
3300005337|Ga0070682_100312249 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300005435|Ga0070714_101214533 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300005445|Ga0070708_100485454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1165 | Open in IMG/M |
3300005467|Ga0070706_100139919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2259 | Open in IMG/M |
3300005467|Ga0070706_100141093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2249 | Open in IMG/M |
3300005467|Ga0070706_101928967 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005536|Ga0070697_100060167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3095 | Open in IMG/M |
3300005554|Ga0066661_10502622 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300006052|Ga0075029_100641153 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300006059|Ga0075017_100227960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1356 | Open in IMG/M |
3300006175|Ga0070712_100505100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 1014 | Open in IMG/M |
3300007265|Ga0099794_10528964 | Not Available | 622 | Open in IMG/M |
3300009143|Ga0099792_10775902 | Not Available | 626 | Open in IMG/M |
3300009174|Ga0105241_11612870 | Not Available | 628 | Open in IMG/M |
3300009176|Ga0105242_11050311 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300009522|Ga0116218_1208045 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300009522|Ga0116218_1501968 | Not Available | 541 | Open in IMG/M |
3300009523|Ga0116221_1527525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 518 | Open in IMG/M |
3300009525|Ga0116220_10194922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mangrovisoli | 877 | Open in IMG/M |
3300009551|Ga0105238_10871737 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300009698|Ga0116216_10092456 | Not Available | 1861 | Open in IMG/M |
3300009698|Ga0116216_10911274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 526 | Open in IMG/M |
3300009700|Ga0116217_10329700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens | 977 | Open in IMG/M |
3300010343|Ga0074044_10163925 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
3300010343|Ga0074044_10212154 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300010379|Ga0136449_100274470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3104 | Open in IMG/M |
3300010379|Ga0136449_100804504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1552 | Open in IMG/M |
3300010379|Ga0136449_101571829 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300010379|Ga0136449_102648866 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300010379|Ga0136449_102815463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 686 | Open in IMG/M |
3300010379|Ga0136449_103694400 | Not Available | 578 | Open in IMG/M |
3300010396|Ga0134126_10238718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium SDU3-3 | 2155 | Open in IMG/M |
3300010396|Ga0134126_10357445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1703 | Open in IMG/M |
3300010396|Ga0134126_11994740 | Not Available | 635 | Open in IMG/M |
3300010400|Ga0134122_10583558 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300010401|Ga0134121_11447189 | Not Available | 700 | Open in IMG/M |
3300011107|Ga0151490_1804803 | Not Available | 543 | Open in IMG/M |
3300012207|Ga0137381_10464700 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300012209|Ga0137379_10023837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5879 | Open in IMG/M |
3300012209|Ga0137379_11689806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 530 | Open in IMG/M |
3300012210|Ga0137378_10626604 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300012211|Ga0137377_11293415 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300012923|Ga0137359_10572622 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300012925|Ga0137419_10598975 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300012927|Ga0137416_10504497 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300012985|Ga0164308_11987306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 542 | Open in IMG/M |
3300012986|Ga0164304_11810919 | Not Available | 511 | Open in IMG/M |
3300013297|Ga0157378_11811022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
3300013307|Ga0157372_10234331 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
3300014968|Ga0157379_10911025 | Not Available | 834 | Open in IMG/M |
3300016341|Ga0182035_10462145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia cyriacigeorgica | 1078 | Open in IMG/M |
3300016445|Ga0182038_10463894 | Not Available | 1074 | Open in IMG/M |
3300017823|Ga0187818_10031669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2269 | Open in IMG/M |
3300017926|Ga0187807_1101355 | Not Available | 905 | Open in IMG/M |
3300017932|Ga0187814_10022281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2379 | Open in IMG/M |
3300017932|Ga0187814_10311429 | Not Available | 604 | Open in IMG/M |
3300017937|Ga0187809_10194803 | Not Available | 717 | Open in IMG/M |
3300017942|Ga0187808_10110041 | Not Available | 1201 | Open in IMG/M |
3300017943|Ga0187819_10062792 | Not Available | 2206 | Open in IMG/M |
3300017959|Ga0187779_10489242 | Not Available | 813 | Open in IMG/M |
3300017961|Ga0187778_10294886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1048 | Open in IMG/M |
3300017966|Ga0187776_11033414 | Not Available | 606 | Open in IMG/M |
3300017973|Ga0187780_10293352 | Not Available | 1143 | Open in IMG/M |
3300017973|Ga0187780_11119674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 576 | Open in IMG/M |
3300017973|Ga0187780_11137122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
3300017974|Ga0187777_10647109 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300017975|Ga0187782_11262659 | Not Available | 579 | Open in IMG/M |
3300018001|Ga0187815_10325621 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300018060|Ga0187765_10417766 | Not Available | 832 | Open in IMG/M |
3300018064|Ga0187773_11050461 | Not Available | 537 | Open in IMG/M |
3300018085|Ga0187772_10757894 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300018085|Ga0187772_10938341 | Not Available | 630 | Open in IMG/M |
3300018086|Ga0187769_10312514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1175 | Open in IMG/M |
3300018482|Ga0066669_11892511 | Not Available | 555 | Open in IMG/M |
3300019787|Ga0182031_1151174 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300021402|Ga0210385_10499322 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300021403|Ga0210397_10646034 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300021420|Ga0210394_11104176 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300021478|Ga0210402_11257350 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300025898|Ga0207692_10219362 | Not Available | 1126 | Open in IMG/M |
3300025905|Ga0207685_10329426 | Not Available | 764 | Open in IMG/M |
3300025906|Ga0207699_10658784 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300025909|Ga0207705_10464407 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300025910|Ga0207684_10117934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2274 | Open in IMG/M |
3300025910|Ga0207684_11711614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 506 | Open in IMG/M |
3300025913|Ga0207695_10849478 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300025918|Ga0207662_11132883 | Not Available | 556 | Open in IMG/M |
3300025928|Ga0207700_10999620 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300025928|Ga0207700_11088186 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300025928|Ga0207700_11326785 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300025938|Ga0207704_11314598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
3300025939|Ga0207665_10439944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
3300025949|Ga0207667_11458394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300025961|Ga0207712_11900097 | Not Available | 533 | Open in IMG/M |
3300026075|Ga0207708_10585133 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300026088|Ga0207641_12477901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 517 | Open in IMG/M |
3300026095|Ga0207676_11388180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 698 | Open in IMG/M |
3300026490|Ga0257153_1039884 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300026920|Ga0208575_1002300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2242 | Open in IMG/M |
3300026995|Ga0208761_1036929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 506 | Open in IMG/M |
3300027497|Ga0208199_1086503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
3300027568|Ga0208042_1118270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
3300027568|Ga0208042_1126453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mangrovisoli | 643 | Open in IMG/M |
3300027604|Ga0208324_1005555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4381 | Open in IMG/M |
3300027646|Ga0209466_1116830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
3300027662|Ga0208565_1129954 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300027671|Ga0209588_1209202 | Not Available | 606 | Open in IMG/M |
3300027698|Ga0209446_1064549 | Not Available | 930 | Open in IMG/M |
3300027738|Ga0208989_10248076 | Not Available | 581 | Open in IMG/M |
3300027812|Ga0209656_10436680 | Not Available | 581 | Open in IMG/M |
3300027824|Ga0209040_10356892 | Not Available | 692 | Open in IMG/M |
3300027915|Ga0209069_10122014 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300028782|Ga0307306_10214526 | Not Available | 554 | Open in IMG/M |
3300028787|Ga0307323_10307635 | Not Available | 569 | Open in IMG/M |
3300028792|Ga0307504_10353526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
3300028793|Ga0307299_10415815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
3300030707|Ga0310038_10423183 | Not Available | 575 | Open in IMG/M |
3300031544|Ga0318534_10027955 | Not Available | 3055 | Open in IMG/M |
3300031573|Ga0310915_10503833 | Not Available | 860 | Open in IMG/M |
3300031668|Ga0318542_10347931 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300031680|Ga0318574_10944744 | Not Available | 505 | Open in IMG/M |
3300031682|Ga0318560_10819714 | Not Available | 502 | Open in IMG/M |
3300031713|Ga0318496_10063264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1938 | Open in IMG/M |
3300031713|Ga0318496_10241312 | Not Available | 995 | Open in IMG/M |
3300031713|Ga0318496_10251157 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300031719|Ga0306917_11053369 | Not Available | 634 | Open in IMG/M |
3300031719|Ga0306917_11473603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 524 | Open in IMG/M |
3300031751|Ga0318494_10264133 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300031751|Ga0318494_10467016 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300031769|Ga0318526_10455252 | Not Available | 523 | Open in IMG/M |
3300031779|Ga0318566_10392131 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300031799|Ga0318565_10054698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1860 | Open in IMG/M |
3300031845|Ga0318511_10285300 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300031860|Ga0318495_10157308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1025 | Open in IMG/M |
3300031879|Ga0306919_10840008 | Not Available | 705 | Open in IMG/M |
3300031938|Ga0308175_101454507 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300031946|Ga0310910_10767828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
3300031947|Ga0310909_11671373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea jiangxiensis | 503 | Open in IMG/M |
3300032008|Ga0318562_10573366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
3300032010|Ga0318569_10145765 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300032035|Ga0310911_10423736 | Not Available | 770 | Open in IMG/M |
3300032043|Ga0318556_10456170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes lutulentus | 669 | Open in IMG/M |
3300032068|Ga0318553_10109508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1413 | Open in IMG/M |
3300032068|Ga0318553_10180871 | Not Available | 1098 | Open in IMG/M |
3300032076|Ga0306924_11762685 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300032089|Ga0318525_10568594 | Not Available | 579 | Open in IMG/M |
3300032160|Ga0311301_10098255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 5758 | Open in IMG/M |
3300032160|Ga0311301_10179545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens | 3705 | Open in IMG/M |
3300032180|Ga0307471_103606370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
3300032261|Ga0306920_100920012 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
3300032770|Ga0335085_10435093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1513 | Open in IMG/M |
3300032770|Ga0335085_10685180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1142 | Open in IMG/M |
3300032770|Ga0335085_12258022 | Not Available | 545 | Open in IMG/M |
3300032805|Ga0335078_10056759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5766 | Open in IMG/M |
3300032805|Ga0335078_10313789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2101 | Open in IMG/M |
3300032805|Ga0335078_11696544 | Not Available | 693 | Open in IMG/M |
3300032805|Ga0335078_12608541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
3300032805|Ga0335078_12749028 | Not Available | 500 | Open in IMG/M |
3300032828|Ga0335080_10062935 | All Organisms → cellular organisms → Bacteria | 4109 | Open in IMG/M |
3300032828|Ga0335080_11209604 | Not Available | 759 | Open in IMG/M |
3300032892|Ga0335081_10143594 | All Organisms → cellular organisms → Bacteria | 3431 | Open in IMG/M |
3300032892|Ga0335081_11025841 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300032892|Ga0335081_11163151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Natronoglycomyces → Natronoglycomyces albus | 883 | Open in IMG/M |
3300032954|Ga0335083_11193159 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300032955|Ga0335076_10123048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2516 | Open in IMG/M |
3300033004|Ga0335084_11959846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
3300033158|Ga0335077_10371875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus | 1543 | Open in IMG/M |
3300033158|Ga0335077_10866239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
3300033158|Ga0335077_11426390 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300033158|Ga0335077_11849518 | Not Available | 566 | Open in IMG/M |
3300033290|Ga0318519_10800035 | Not Available | 580 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.48% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.54% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.99% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.79% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.14% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.04% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.30% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.75% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.20% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.10% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.10% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.10% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.10% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.10% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.10% |
Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.55% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.55% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.55% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
3300026995 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N56_00278590 | 2170459012 | Grass Soil | MAVGPQDAPRHAGKVVRRVLLRRNIVIDAETAQLVAAAVQAALQ |
JGI12053J15887_105052482 | 3300001661 | Forest Soil | MADSPQDPPRHVGHVVRRVLLRRNIAIDAETAQLVAAAVQA |
Ga0052254_10010512 | 3300003152 | Sediment | MAADSQDVPRHAGQVVRRVLLRRNIAIDAETAQLVAAAVQAALQAGAPSRRPRR |
Ga0062386_1006046721 | 3300004152 | Bog Forest Soil | MADSPQDPPRHAGHVVRRVLLRRNIAVDAETAQLVADAVQAALRAG |
Ga0066675_107789311 | 3300005187 | Soil | MAADPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPR |
Ga0066388_1013107921 | 3300005332 | Tropical Forest Soil | MAAEPQDALRHAGRVVRRVLLRRNIAVDAETAQLVAAVVQA |
Ga0066388_1086658031 | 3300005332 | Tropical Forest Soil | MAADPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQ |
Ga0070666_108247561 | 3300005335 | Switchgrass Rhizosphere | MADGLQDAPRHAGQVVRRVLLRAMAVDAETAQLVADAVQAALRAGAPSRPP |
Ga0070666_113088452 | 3300005335 | Switchgrass Rhizosphere | MAAGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPR |
Ga0070682_1003122493 | 3300005337 | Corn Rhizosphere | MADGLQDAPRHAGQVVRRVLLRRNIAIDPETAQLVAAAVQ |
Ga0070714_1012145331 | 3300005435 | Agricultural Soil | MATATQDASRHAAQVVRRVLLRRNIAIDPETAQLVAAAVQVALQAGASSRPP |
Ga0070708_1004854543 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVADPHDAPPHAGQVVRRVLLRRNIVIDAETAHLVAAAVQAALQGGSPCGSC* |
Ga0070706_1001399194 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVADSQDAPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGAPSRPPR* |
Ga0070706_1001410931 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVGPQDAPRHAGKVVRRVLLRRNIVIDAETAQLVAAAV* |
Ga0070706_1019289672 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAADPQDAPPHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQA |
Ga0070697_1000601673 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAADLQDAPRHAGQVVRRVLLRRNIVIDAETAHLVAAAVQAALQGGSPCGSC* |
Ga0066661_105026221 | 3300005554 | Soil | MAAAPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAAL |
Ga0075029_1006411531 | 3300006052 | Watersheds | MADGLQDASRHAGQVVRRVLLRRNIAVDAETAQLVADAVQAALQP |
Ga0075017_1002279604 | 3300006059 | Watersheds | MAAEPQDAPRHAGQVVRRVLLRRNIAVDAETAQLVAAAVQAA |
Ga0070712_1005051002 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VADGLQDAPRHAGQVVRRVLLRRNIAIDAETAQLVVAAV* |
Ga0099794_105289641 | 3300007265 | Vadose Zone Soil | MADSPQDPPRHVGHVVRRVLLRRHIAIDAETAQLIAAAVQAALQAGASSR |
Ga0099792_107759021 | 3300009143 | Vadose Zone Soil | VTEPAGIGPHDAPPRAGQVVRRVLLRWNIAIDAVTAQLVAAAVQAALQ |
Ga0105241_116128702 | 3300009174 | Corn Rhizosphere | MRPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSR |
Ga0105242_110503112 | 3300009176 | Miscanthus Rhizosphere | MAGDSQDAPRHAGQVVRRVLLRRNIATGTDTAQLVTAAVQAS* |
Ga0116218_12080451 | 3300009522 | Peatlands Soil | MDDRPQDATRHAGQVVRRVLLRRNIAIDAETAQLVADAV |
Ga0116218_15019682 | 3300009522 | Peatlands Soil | MADGLQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALRAGAPARPPR |
Ga0116221_15275252 | 3300009523 | Peatlands Soil | MAADSQDVPRHAGQVVRRVLLRRNIVIDAETAQLVVAAF* |
Ga0116220_101949222 | 3300009525 | Peatlands Soil | MADGLQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALRAGAPARPGWWC* |
Ga0105238_108717371 | 3300009551 | Corn Rhizosphere | MRPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQ |
Ga0116216_100924563 | 3300009698 | Peatlands Soil | MAANSQDAPRHAGQVVRRVLLRRNIAIDAETAQLVAAAVQAALQ |
Ga0116216_109112742 | 3300009698 | Peatlands Soil | MAADPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVA |
Ga0116217_103297002 | 3300009700 | Peatlands Soil | MAADPQDAPQHAGQVVRRALLRRNIVIDAETAQLVVAAF* |
Ga0074044_101639251 | 3300010343 | Bog Forest Soil | MADGPQDAPRHAGQVVRRVLLRRNIAIDAETAQIVADAVQAALRA |
Ga0074044_102121543 | 3300010343 | Bog Forest Soil | MAADPQDAPRHAGQVVRRVLLRRNIVIDAETAQLVAA |
Ga0136449_1002744702 | 3300010379 | Peatlands Soil | MAADPQDAPQHAGQVVRRVLLRRNIVIDAETAQLVVAAF* |
Ga0136449_1008045044 | 3300010379 | Peatlands Soil | MAAEPQDAPRHAGQVVRRVLLRRSIVIDAETAQLVADAVQAALRAG |
Ga0136449_1015718293 | 3300010379 | Peatlands Soil | MAAGPQDVPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQ |
Ga0136449_1026488661 | 3300010379 | Peatlands Soil | MADGLQDAPRHAGQVVRRVLLRRNIVIDAETAQLVADAVQAALR |
Ga0136449_1028154631 | 3300010379 | Peatlands Soil | MADSPQDPPRHAGHVVRRVLLRRNIAIDPRPAQRVADAIAGRI* |
Ga0136449_1036944002 | 3300010379 | Peatlands Soil | MADSPQDLPRHAGHVVRRVLLRRNIAIDAETAQLVADAVQAALRAGAPS |
Ga0134126_102387182 | 3300010396 | Terrestrial Soil | MAGDSQDAPRHAGQVVRRVLRRNIATDTDTAQLVTAAVQAS* |
Ga0134126_103574453 | 3300010396 | Terrestrial Soil | MAAGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAV |
Ga0134126_119947402 | 3300010396 | Terrestrial Soil | MAAGPRDAPRHAGQVVRRVLLRRSIAIDPETAQLVAAAVQAALQPAAPSRP |
Ga0134122_105835582 | 3300010400 | Terrestrial Soil | MADGLQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADA |
Ga0134121_114471891 | 3300010401 | Terrestrial Soil | MAGDSQDAPRHAGQVVHRVLLRRNIATDTDTAQLVTAAVQAS* |
Ga0151490_18048031 | 3300011107 | Soil | MAAGPQDAPRHAGHVVRRVLLRRNIAIDAETAQLVAAAGQA |
Ga0137381_104647001 | 3300012207 | Vadose Zone Soil | MAADSQDVPRHAGQVVRRVLLRRNIAVDAETAQLVAAAV |
Ga0137379_100238371 | 3300012209 | Vadose Zone Soil | MAADPQDASPHAGQVVRRVLLRRNIVIDPETAQLVATAVQAAL* |
Ga0137379_116898062 | 3300012209 | Vadose Zone Soil | MADSPQDPPRHVGHVVRRVLLRRNIAIDAETAQLVAAAVQAALQ |
Ga0137378_106266041 | 3300012210 | Vadose Zone Soil | MADSPQDPPRHVGHVIRRVLLRRNIAIDAETAQLVAAA |
Ga0137377_112934152 | 3300012211 | Vadose Zone Soil | MAADPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSRPP |
Ga0137359_105726222 | 3300012923 | Vadose Zone Soil | MAAGPQDAPRHAGQVVRRVLLRRNIAIDPETAQLVAGAV |
Ga0137419_105989751 | 3300012925 | Vadose Zone Soil | MAAGPQDAARHAGQVVRRVLLRRNIAIDAETAQLVA |
Ga0137416_105044972 | 3300012927 | Vadose Zone Soil | MAAGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVAGAVQAAL |
Ga0164308_119873061 | 3300012985 | Soil | MADGPKDATRHAGQVVRRVLLRRNIAIDAETAQLVVAAV* |
Ga0164304_118109192 | 3300012986 | Soil | MAADSQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPS |
Ga0157378_118110223 | 3300013297 | Miscanthus Rhizosphere | MATPADPQNPSRHAGQVVRRVVLRRNIAIDPEAAQLVADAVQAVLRPARL |
Ga0157372_102343314 | 3300013307 | Corn Rhizosphere | MAGRPQDAPRHAGQVVRRVLLRRNIATGTDTAQLVTAAVQAS* |
Ga0157379_109110251 | 3300014968 | Switchgrass Rhizosphere | MAAEPQEVPQHAGQVVRRVLLRRNIAVDAETAQLAAAVQAALQADAPSRLARR |
Ga0182035_104621451 | 3300016341 | Soil | MAAGPQDAPRHAGQAARRVLLRRNIVIDAEPAQLVAAVQAALQSGAPS |
Ga0182038_104638942 | 3300016445 | Soil | MAADPQDAPRHAGHVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGAAIRPRA |
Ga0187818_100316693 | 3300017823 | Freshwater Sediment | MAAGPQDTPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQRSATF |
Ga0187807_11013551 | 3300017926 | Freshwater Sediment | MADGPQDATRHAGQVVRRALLRRNIVIDAETAQLVAAAVQA |
Ga0187814_100222813 | 3300017932 | Freshwater Sediment | MAVGPQDAPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQRSATF |
Ga0187814_103114291 | 3300017932 | Freshwater Sediment | MADGPQDATRHAGQVVRRALLRRNIVIDAETAQLVAAAVQAALQ |
Ga0187809_101948031 | 3300017937 | Freshwater Sediment | MAADPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALRPATPSRP |
Ga0187808_101100412 | 3300017942 | Freshwater Sediment | MAADSQDVPRHAGQVVRRVLLRRNIVIDAETAQLVAAAV |
Ga0187819_100627921 | 3300017943 | Freshwater Sediment | MAVGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALRA |
Ga0187779_104892422 | 3300017959 | Tropical Peatland | MAADSQDPSRHAGQVVRRVLLSRNIVIDAETAQLVAAAVQAALQAGAASRAGTS |
Ga0187778_102948863 | 3300017961 | Tropical Peatland | MAAEPQDAPRHAGQVVRRVLLRRNIAVDAETAQLVVAAVQAALQVGAPSRSA |
Ga0187776_110334142 | 3300017966 | Tropical Peatland | MAAGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALRPAAPS |
Ga0187780_102933521 | 3300017973 | Tropical Peatland | MADGPQDATRHAGQVVRRVLLRRNIAAGAETAQLVAAAVQAALQPGQPSRPP |
Ga0187780_111196741 | 3300017973 | Tropical Peatland | MAAGPQDAPRHAGHVVRRVLLRRNIAIDAETAQLVADAVQAALQPVVPS |
Ga0187780_111371221 | 3300017973 | Tropical Peatland | MAADSQDATRHAGQVVRRVLLRRNIVVDAETAQLVAAA |
Ga0187777_106471091 | 3300017974 | Tropical Peatland | MADRPQDPPPHAGHVVRRVLLRRNIAIDPETARLVAD |
Ga0187782_112626591 | 3300017975 | Tropical Peatland | MADRPQDPPRHAGHVVRRVLLRRNIAIDPETAQLVAA |
Ga0187815_103256212 | 3300018001 | Freshwater Sediment | MADRPQDATRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGASSR |
Ga0187805_103059472 | 3300018007 | Freshwater Sediment | VTEPATLGPHDVSSHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAAL |
Ga0187765_104177661 | 3300018060 | Tropical Peatland | MAADPQDPPRHAGHVVRRVLLRRNIAVDAETAQLVAEAVQAALKA |
Ga0187773_110504612 | 3300018064 | Tropical Peatland | MTDGLQDAPPPAGQVVRRVLLRRNIAIDAETAQLVAAAVQAVLQPAAPSRP |
Ga0187772_107578942 | 3300018085 | Tropical Peatland | MAADPRDATRHAGQVVRRVLLRRNVAIDAETAQLVA |
Ga0187772_109383411 | 3300018085 | Tropical Peatland | MAAEPQDAPRYAGQVVRRVLLRRNIAIDAETAQLVAAAVQAALQADA |
Ga0187769_103125141 | 3300018086 | Tropical Peatland | MAAEPQDAARHAGQVVRRVLLRRNIAIDAETAQLVAVAVQA |
Ga0066669_118925111 | 3300018482 | Grasslands Soil | MDADPQDPPPHAGQVVRVLLRRNIAVDAETAQLVAAAVQAALQAG |
Ga0182031_11511742 | 3300019787 | Bog | MAVDTDPQEPPCHAGRVVRRVLLRRSIVIDQETAQLVVGAVQAALRASTPSRPP |
Ga0210385_104993222 | 3300021402 | Soil | MADGVQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALRADAPSR |
Ga0210397_106460341 | 3300021403 | Soil | VADGLQDAPRHAGQVVRRVLLRRNIAIDAETAQLVAAAV |
Ga0210394_111041761 | 3300021420 | Soil | MAAGPQDAPRHAGQVVRRVLLRRNIAIDPETAQLVAAAVQAALQAGRPSRPPRRG |
Ga0210402_112573502 | 3300021478 | Soil | MAADPQDEPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPR |
Ga0207692_102193621 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAEPQEVPQHAGQVVRRVLLRRNIAVDAETVQLVAAAV |
Ga0207685_103294261 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MATPADPQNPSRHAGQVVRRVVLRRNIAIDPEAAQLV |
Ga0207699_106587842 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MAMAADQQDPPRHAGHVVRRVLLRRNIAIDAETAQLVAAAVQAALEA |
Ga0207705_104644071 | 3300025909 | Corn Rhizosphere | MAGDSQDAPRHVGQVVRRVLLRRNIATGTDTAQLVTAAVQAS |
Ga0207684_101179343 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVADSQDAPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGAPSRPPR |
Ga0207684_117116142 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIGPRDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAA |
Ga0207695_108494782 | 3300025913 | Corn Rhizosphere | MAAGPRDAPRHAGQVVRRVLLRRNIATGTDTAQLVTAAVQAS |
Ga0207662_111328832 | 3300025918 | Switchgrass Rhizosphere | MADGLQDAPRHAGQVVRRVLLRRNIAVDAETAQLVADA |
Ga0207700_109996202 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVAGAVQAALQPAAPSRPPRR |
Ga0207700_110881861 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MADGLQDAPRHAGQVVRRVLLRRNIAIDAETAQLAADAVQAALRAGAH |
Ga0207700_113267851 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAGPQDAPRHAGQVVRRVLLCRNIVIDAETAQLVAAAVQ |
Ga0207704_113145981 | 3300025938 | Miscanthus Rhizosphere | MAAGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALRPA |
Ga0207665_104399441 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MADGLQDAPRHAGRVVRRVLLRRNIAIDTETAQLVA |
Ga0207667_114583941 | 3300025949 | Corn Rhizosphere | MRPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSRPPRRR |
Ga0207712_119000972 | 3300025961 | Switchgrass Rhizosphere | MADSPQDTPRHAGRVVRHVLLRRNIAVDAETAQLVADAVQAALRAGP |
Ga0207708_105851332 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MADSPQDPPRHAGRVVRRVLLRRNIAIDAETAQLV |
Ga0207641_124779012 | 3300026088 | Switchgrass Rhizosphere | MATPADPQNPSRHAGQVVRRVLLRRNIAIDPEAAQLV |
Ga0207676_113881803 | 3300026095 | Switchgrass Rhizosphere | MAAEPQEVPQHAGQVVRRVLLRRNIAVDAETAQLAAAVQAALQAD |
Ga0257153_10398841 | 3300026490 | Soil | MAAGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVAGAVQAALRPAAPS |
Ga0208575_10023001 | 3300026920 | Soil | MAAGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPARP |
Ga0208761_10369291 | 3300026995 | Soil | MTADPQDAPRHVGQVVRRVLLRRNIAIDAETAQLV |
Ga0208199_10865032 | 3300027497 | Peatlands Soil | VNVPGARPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSQ |
Ga0208042_11182702 | 3300027568 | Peatlands Soil | VNVPGARPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSQPPRR |
Ga0208042_11264532 | 3300027568 | Peatlands Soil | MADGLQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALRAGAPARPPRR |
Ga0208324_10055554 | 3300027604 | Peatlands Soil | MADGPQDAPRHAGQVVRRVLLRRNIAIDAETAQIVADA |
Ga0209466_11168301 | 3300027646 | Tropical Forest Soil | MAAGPQDAPRHAGQAARRVLLRRNIVIDAEPAQLVAAYEDL |
Ga0208565_11299541 | 3300027662 | Peatlands Soil | MADGLQDAPRHAGQVVRRVLLRRNIVIDAETAQLVADAVQAALQAGA |
Ga0209588_12092021 | 3300027671 | Vadose Zone Soil | MAADPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVAGAVQAALQPAAPSRP |
Ga0209446_10645491 | 3300027698 | Bog Forest Soil | VNVPGARPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALQPAAPSQP |
Ga0208989_102480761 | 3300027738 | Forest Soil | MAAGPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAAL |
Ga0209656_104366802 | 3300027812 | Bog Forest Soil | MAADPQDATRHAGKVVRRVLLRRNIAVDAETAQLVA |
Ga0209040_103568921 | 3300027824 | Bog Forest Soil | MAADPQDATRHAGQVVRRVLLRRNIVIDAETAHLVAAAVQAALQAGAP |
Ga0209069_101220143 | 3300027915 | Watersheds | MAADPQDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQA |
Ga0307306_102145262 | 3300028782 | Soil | MADSPQDPPRHVGRVVRRVLLRRNIAIDAETAQLVAVAVQ |
Ga0307323_103076352 | 3300028787 | Soil | MADSPQDPPRHVGHVVRRVLLRRNIAIDAETAQLVAAAVQAALQAGASSRP |
Ga0307504_103535261 | 3300028792 | Soil | MAAEPQDAPRHAGQVVRRVLLRRNIAVDAETAQLV |
Ga0307299_104158152 | 3300028793 | Soil | MADSPQDAPRHAVQVARRVLLRRNIAVDVETAQVVVAAVQAALQAGTPSRPPA |
Ga0310038_104231831 | 3300030707 | Peatlands Soil | MADSPQDPPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGAPSRPPR |
Ga0318534_100279553 | 3300031544 | Soil | MAGPQDVPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGAAIRPRA |
Ga0310915_105038331 | 3300031573 | Soil | MAAGPQDAPRHAGQAARRVLLRRNIVIDAEPAQLVAAVQAALQSGAPSRRPRH |
Ga0318542_103479311 | 3300031668 | Soil | MAADPRDAPRHAGQVVRRVLLRRNIAIDAETAQLVAD |
Ga0318574_109447441 | 3300031680 | Soil | MAAEPQDAPRHAGQVVRRVLLRRNIAVDAETAQLVAAVQAALQAGAPSRPTRRR |
Ga0318560_108197142 | 3300031682 | Soil | MAGPQDVPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQA |
Ga0318496_100632641 | 3300031713 | Soil | MAADPQDTPRHGGRVVRRVLLRRNIVIDTETAQLVAAAVQAALQAGA |
Ga0318496_102413123 | 3300031713 | Soil | MAADPHDAPRHAGRVVRRVLLRRNIVIDTETAQLVAAAVQAALQAGAPSR |
Ga0318496_102511572 | 3300031713 | Soil | MAADPRDAPRHAGQVVRRVLLRRNIAIDPETAQLVADAVQAALQPAAPSR |
Ga0306917_110533691 | 3300031719 | Soil | MAADPQDTPRHGGRVVRRVLLRRNIVIDTETAQLVAAAVQAVLQAGAPSR |
Ga0306917_114736032 | 3300031719 | Soil | MAADPQDAPRHVGQVVRRVLLRRNIAIDAETAQLVADAVQAALR |
Ga0318494_102641332 | 3300031751 | Soil | LAADSQDVPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQ |
Ga0318494_104670161 | 3300031751 | Soil | MAADPQDAPRHAGQVVRRVLLRRNIAIDTETAQLVAAAVQAALQT |
Ga0318526_104552521 | 3300031769 | Soil | SRRRADMAADPQDTPRHGGRVVRRVLLRRNIVIDTETAQLVAAAVQAALQADAPGARVDT |
Ga0318566_103921311 | 3300031779 | Soil | MAADPRDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQAALRADT |
Ga0318565_100546985 | 3300031799 | Soil | MAADPQDTPRHGGRVVRRVLLRRNIVIDTETAQLVAAAVQAVLQA |
Ga0318511_102853002 | 3300031845 | Soil | MAADPRDAPRHAGQVVRRVLLRRNIAIDAETAQLVADAVQ |
Ga0318495_101573081 | 3300031860 | Soil | MAADPQDTPRHGGRVVRRVLLRRNIVIDTETAQLVAAAVQAALQAGAPSRPPR |
Ga0306919_108400082 | 3300031879 | Soil | MAAEPQDAPRHAGQVVRRVLLRQNIAVDAETAQLVAAA |
Ga0308175_1014545072 | 3300031938 | Soil | MAADPQDAPRHAGQVVRRVLLRHNIAIDAETAQLVADA |
Ga0310910_107678283 | 3300031946 | Soil | MAADPRDAPRHAGQVVRRVLLRRNIAIDPETAQLVADA |
Ga0310909_116713731 | 3300031947 | Soil | MAADPQDAPRHVGQVVRRVLLRRNIAIDAETAQLV |
Ga0318562_105733664 | 3300032008 | Soil | MAADPQDTPRHGGRVVRRVLLRRNIVIDTETAQLVAAAVQAVL |
Ga0318569_101457652 | 3300032010 | Soil | MAADPRDAPRHAGQVVRRVLLRRNIAIDPETAQLVADAVQAALQPAAPSRP |
Ga0310911_104237361 | 3300032035 | Soil | AADPQDAPRHAGHVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGAAIRPRA |
Ga0318556_104561702 | 3300032043 | Soil | MAADPQDTPRHGGRVVRRVLLRRNIVIDTETAQLVAAAVQAALQADAPGARVDT |
Ga0318553_101095081 | 3300032068 | Soil | MAADPQDTPRHGGRVVRRVLLRRNIVIDTETAQLVAAAVQAAL |
Ga0318553_101808713 | 3300032068 | Soil | MAGPQDVPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQ |
Ga0306924_117626851 | 3300032076 | Soil | PAAIGPHDAPPHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQAGAPSRRGTS |
Ga0318525_105685941 | 3300032089 | Soil | LAADSQDVPRHAGQVVRRVLLRRNIVIDAATAQLVAAAVQAALQADRPSGPP |
Ga0311301_100982552 | 3300032160 | Peatlands Soil | MADSPQDPPRHAGHVVRRVLLRRNIAIDPRPAQRVADAIAGRI |
Ga0311301_101795453 | 3300032160 | Peatlands Soil | MAADPQDAPQHAGQVVRRALLRRNIVIDAETAQLVVAAF |
Ga0307471_1036063702 | 3300032180 | Hardwood Forest Soil | MAAEPQDAPRHAGQVVRRVLLRRNIAVDAETAQLAAAAVQAALQAEEAKPPGR |
Ga0307472_1015191581 | 3300032205 | Hardwood Forest Soil | VTEPATGPHDAPPHAVRVVRRVLLRRNIVIDAETAQLVA |
Ga0306920_1009200121 | 3300032261 | Soil | MAADPQDATRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAELKPATPS |
Ga0335085_104350931 | 3300032770 | Soil | MADRPQDPPRHAGHVVRRVLLRRNIAVDAETAQLVADAGCEPLF |
Ga0335085_106851804 | 3300032770 | Soil | MAAEPQDVPRHAGQVVRRVLLRRNIAVDPETAQLVAA |
Ga0335085_122580221 | 3300032770 | Soil | MASDSHDAPRHAGQVVRRVLLRRNIAIDAETAQLAAAAVQAALQASAPCA |
Ga0335078_100567598 | 3300032805 | Soil | MTVDPQDAPGHAGRVVRRVLLRRNIAIDAETAQLVAA |
Ga0335078_103137891 | 3300032805 | Soil | MAAEPQDAPRHAGQVVRRVLLRRNIAVDAETAQLVAAAV |
Ga0335078_116965441 | 3300032805 | Soil | MAGRPQDATRRAGHVVRRVLLRRNIAVDAETAQLVADAVQAALRAEMPSRPR |
Ga0335078_126085411 | 3300032805 | Soil | MPGATGPRPVTVRPQDAPRHAGQVVRRNIGIEAETAQLVAAAVQAALQASAPSRAPRR |
Ga0335078_127490283 | 3300032805 | Soil | MAADPQDAPGHAGQVARRVLLRRNVAIDAETVQLVAAAVQ |
Ga0335080_100629351 | 3300032828 | Soil | MAAGPQDAPRHAGQVVCRVLPRRNIAIDAETAQLVADAVQAALQPALQ |
Ga0335080_112096041 | 3300032828 | Soil | MAAGPQDAPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQA |
Ga0335081_101435941 | 3300032892 | Soil | MAADPQDVPRHAGQVVRRVLLRRNIAVDAETAQLVAAAVQAALQ |
Ga0335081_110258411 | 3300032892 | Soil | MATDPQDTPRHAGQVVRRVLLRRNIAVDPETAQLVAAAVQAALH |
Ga0335081_111631512 | 3300032892 | Soil | MAADSEYATRHAGQVVRRVLLRCNIAVDAETAQPVAAV |
Ga0335083_111931591 | 3300032954 | Soil | MADRLQDAPRHAGHVVRRVLLRRNIAIDAETAQLVADAVQAAL |
Ga0335076_101230481 | 3300032955 | Soil | MAAEPQDAPRHAGQVVRRVLLRRNIAVDAETAQLVAAAVQAALQAGAPSRPAR |
Ga0335084_119598463 | 3300033004 | Soil | MAAEPQDVPRHAGQVVRRVLLRRNIAVDPETAQLVAAAVQAALQT |
Ga0335077_103718753 | 3300033158 | Soil | VAAEPQDAPRHAGRAVRRVLLRRNIAVDAETAQLVAAAVQAALQAGAPSRP |
Ga0335077_108662391 | 3300033158 | Soil | MAAEPQDAPRHAGQVVRRVLLRRNIAVDAETAQLVAAAVQAALQA |
Ga0335077_114263902 | 3300033158 | Soil | MADRPQDPPRHAGQVVRRVLLRRNIAVDAEAAQLVADAVQAVLRAGMPSR |
Ga0335077_118495183 | 3300033158 | Soil | MAAGPQDAPRHAGQVVRRVLLRRNIAVDAETAQLAAAA |
Ga0318519_108000352 | 3300033290 | Soil | LAADSQDVPRHAGQVVRRVLLRRNIVIDAETAQLVAAAVQAALQADTPSG |
⦗Top⦘ |