Basic Information | |
---|---|
Family ID | F031526 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 182 |
Average Sequence Length | 47 residues |
Representative Sequence | AYGVIHGRFTDEQRKGVFKPEIPVGDDASPQQRLLAYTGRDPS |
Number of Associated Samples | 159 |
Number of Associated Scaffolds | 182 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.85 % |
% of genes near scaffold ends (potentially truncated) | 91.76 % |
% of genes from short scaffolds (< 2000 bps) | 96.15 % |
Associated GOLD sequencing projects | 153 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.63 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.286 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.385 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.879 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.110 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.54% β-sheet: 0.00% Coil/Unstructured: 77.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 182 Family Scaffolds |
---|---|---|
PF11225 | DUF3024 | 3.30 |
PF01569 | PAP2 | 2.20 |
PF00378 | ECH_1 | 2.20 |
PF06965 | Na_H_antiport_1 | 2.20 |
PF11716 | MDMPI_N | 2.20 |
PF01035 | DNA_binding_1 | 2.20 |
PF01042 | Ribonuc_L-PSP | 2.20 |
PF00196 | GerE | 1.65 |
PF01872 | RibD_C | 1.65 |
PF00440 | TetR_N | 1.65 |
PF01965 | DJ-1_PfpI | 1.65 |
PF13602 | ADH_zinc_N_2 | 1.10 |
PF02870 | Methyltransf_1N | 1.10 |
PF01341 | Glyco_hydro_6 | 1.10 |
PF01471 | PG_binding_1 | 1.10 |
PF03190 | Thioredox_DsbH | 1.10 |
PF12900 | Pyridox_ox_2 | 1.10 |
PF02515 | CoA_transf_3 | 1.10 |
PF13191 | AAA_16 | 1.10 |
PF13360 | PQQ_2 | 1.10 |
PF06877 | RraB | 0.55 |
PF03724 | META | 0.55 |
PF00582 | Usp | 0.55 |
PF03795 | YCII | 0.55 |
PF00107 | ADH_zinc_N | 0.55 |
PF00533 | BRCT | 0.55 |
PF01717 | Meth_synt_2 | 0.55 |
PF08327 | AHSA1 | 0.55 |
PF00005 | ABC_tran | 0.55 |
PF13271 | DUF4062 | 0.55 |
PF00999 | Na_H_Exchanger | 0.55 |
PF01553 | Acyltransferase | 0.55 |
PF02518 | HATPase_c | 0.55 |
PF13622 | 4HBT_3 | 0.55 |
PF00291 | PALP | 0.55 |
PF01266 | DAO | 0.55 |
PF01370 | Epimerase | 0.55 |
PF13411 | MerR_1 | 0.55 |
PF04237 | YjbR | 0.55 |
PF00561 | Abhydrolase_1 | 0.55 |
PF07617 | DUF1579 | 0.55 |
PF03576 | Peptidase_S58 | 0.55 |
PF00890 | FAD_binding_2 | 0.55 |
PF13517 | FG-GAP_3 | 0.55 |
PF06150 | ChaB | 0.55 |
PF07969 | Amidohydro_3 | 0.55 |
PF13683 | rve_3 | 0.55 |
PF03960 | ArsC | 0.55 |
PF02861 | Clp_N | 0.55 |
PF07311 | Dodecin | 0.55 |
PF00072 | Response_reg | 0.55 |
PF10598 | RRM_4 | 0.55 |
PF07992 | Pyr_redox_2 | 0.55 |
PF13620 | CarboxypepD_reg | 0.55 |
PF01842 | ACT | 0.55 |
PF03992 | ABM | 0.55 |
PF03069 | FmdA_AmdA | 0.55 |
PF07110 | EthD | 0.55 |
PF00528 | BPD_transp_1 | 0.55 |
PF13692 | Glyco_trans_1_4 | 0.55 |
PF07858 | LEH | 0.55 |
PF01409 | tRNA-synt_2d | 0.55 |
PF09424 | YqeY | 0.55 |
PF12172 | DUF35_N | 0.55 |
PF08240 | ADH_N | 0.55 |
PF04185 | Phosphoesterase | 0.55 |
PF13577 | SnoaL_4 | 0.55 |
PF01243 | Putative_PNPOx | 0.55 |
PF01575 | MaoC_dehydratas | 0.55 |
PF04226 | Transgly_assoc | 0.55 |
PF02826 | 2-Hacid_dh_C | 0.55 |
PF03136 | Pup_ligase | 0.55 |
PF00248 | Aldo_ket_red | 0.55 |
PF03023 | MurJ | 0.55 |
PF10503 | Esterase_PHB | 0.55 |
PF01904 | DUF72 | 0.55 |
PF07077 | DUF1345 | 0.55 |
PF03009 | GDPD | 0.55 |
PF03466 | LysR_substrate | 0.55 |
COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
---|---|---|---|
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 3.30 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 2.75 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.20 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 2.20 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.65 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.65 |
COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 1.10 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.10 |
COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.10 |
COG5297 | Cellulase/cellobiase CelA1 | Carbohydrate transport and metabolism [G] | 1.10 |
COG0016 | Phenylalanyl-tRNA synthetase alpha subunit | Translation, ribosomal structure and biogenesis [J] | 0.55 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.55 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.55 |
COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 0.55 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.55 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.55 |
COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG1393 | Arsenate reductase or related protein, glutaredoxin family | Inorganic ion transport and metabolism [P] | 0.55 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.55 |
COG2024 | O-phosphoseryl-tRNA(Cys) synthetase | Translation, ribosomal structure and biogenesis [J] | 0.55 |
COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.55 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.55 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.55 |
COG3076 | Regulator of RNase E activity RraB | Translation, ribosomal structure and biogenesis [J] | 0.55 |
COG3187 | Heat shock protein HslJ | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.55 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.55 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG3631 | Ketosteroid isomerase-related protein | General function prediction only [R] | 0.55 |
COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.55 |
COG4308 | Limonene-1,2-epoxide hydrolase LimA/EphG | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
COG4572 | Cation transport regulator ChaB | Inorganic ion transport and metabolism [P] | 0.55 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.93 % |
Unclassified | root | N/A | 34.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459017|G14TP7Y01DE2Q1 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NBAIM08 | 612 | Open in IMG/M |
2189573003|GZIR7W402J28EZ | Not Available | 541 | Open in IMG/M |
3300000956|JGI10216J12902_100991813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1022 | Open in IMG/M |
3300000956|JGI10216J12902_104231925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 834 | Open in IMG/M |
3300000956|JGI10216J12902_105606663 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300004081|Ga0063454_100037840 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
3300004081|Ga0063454_102066502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
3300004463|Ga0063356_102880336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 741 | Open in IMG/M |
3300004463|Ga0063356_105140606 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300004463|Ga0063356_106153655 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300004479|Ga0062595_101358489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
3300004479|Ga0062595_102416194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300004643|Ga0062591_102941164 | Not Available | 505 | Open in IMG/M |
3300005334|Ga0068869_101232305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 658 | Open in IMG/M |
3300005347|Ga0070668_102079941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300005435|Ga0070714_101800364 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300005455|Ga0070663_101221847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
3300005468|Ga0070707_102185126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300005471|Ga0070698_101391783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 652 | Open in IMG/M |
3300005541|Ga0070733_11094088 | Not Available | 534 | Open in IMG/M |
3300005547|Ga0070693_100401742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → unclassified Janibacter → Janibacter sp. | 950 | Open in IMG/M |
3300005568|Ga0066703_10308650 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300005578|Ga0068854_101079091 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300005615|Ga0070702_100213113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1287 | Open in IMG/M |
3300005841|Ga0068863_102027607 | Not Available | 585 | Open in IMG/M |
3300005937|Ga0081455_10688459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
3300005985|Ga0081539_10131356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1229 | Open in IMG/M |
3300006031|Ga0066651_10377975 | Not Available | 757 | Open in IMG/M |
3300006048|Ga0075363_100362805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 847 | Open in IMG/M |
3300006353|Ga0075370_10320251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 924 | Open in IMG/M |
3300006755|Ga0079222_11166297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
3300006804|Ga0079221_11591346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
3300006844|Ga0075428_100465804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1353 | Open in IMG/M |
3300006845|Ga0075421_101068183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 909 | Open in IMG/M |
3300006854|Ga0075425_100411673 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300006871|Ga0075434_102044282 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300006876|Ga0079217_10918429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
3300006893|Ga0073928_10817146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
3300006904|Ga0075424_101589137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 693 | Open in IMG/M |
3300009094|Ga0111539_11586028 | Not Available | 759 | Open in IMG/M |
3300009094|Ga0111539_13038107 | Not Available | 542 | Open in IMG/M |
3300009137|Ga0066709_100055084 | All Organisms → cellular organisms → Bacteria | 4531 | Open in IMG/M |
3300009523|Ga0116221_1045589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2071 | Open in IMG/M |
3300009524|Ga0116225_1125610 | Not Available | 1179 | Open in IMG/M |
3300009525|Ga0116220_10570361 | Not Available | 518 | Open in IMG/M |
3300009672|Ga0116215_1087668 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300010036|Ga0126305_10293133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
3300010044|Ga0126310_11544237 | Not Available | 546 | Open in IMG/M |
3300010154|Ga0127503_10273832 | Not Available | 768 | Open in IMG/M |
3300010361|Ga0126378_12412232 | Not Available | 601 | Open in IMG/M |
3300010397|Ga0134124_12455611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 563 | Open in IMG/M |
3300010878|Ga0136899_10130468 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Eurotiomycetidae → Onygenales → Arthrodermataceae → Trichophyton → Trichophyton rubrum → Trichophyton rubrum CBS 118892 | 843 | Open in IMG/M |
3300012045|Ga0136623_10341752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
3300012201|Ga0137365_10894263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
3300012212|Ga0150985_112132916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2419 | Open in IMG/M |
3300012212|Ga0150985_114993016 | Not Available | 558 | Open in IMG/M |
3300012351|Ga0137386_11072715 | Not Available | 570 | Open in IMG/M |
3300012373|Ga0134042_1057272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
3300012469|Ga0150984_108815548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 535 | Open in IMG/M |
3300012469|Ga0150984_112024793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
3300012469|Ga0150984_122517417 | Not Available | 566 | Open in IMG/M |
3300012488|Ga0157343_1042138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
3300012683|Ga0137398_11081931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
3300012924|Ga0137413_11483057 | Not Available | 551 | Open in IMG/M |
3300012958|Ga0164299_11692000 | Not Available | 502 | Open in IMG/M |
3300012960|Ga0164301_10307059 | Not Available | 1071 | Open in IMG/M |
3300012961|Ga0164302_11045630 | Not Available | 640 | Open in IMG/M |
3300012987|Ga0164307_10501030 | Not Available | 918 | Open in IMG/M |
3300013104|Ga0157370_11479146 | Not Available | 611 | Open in IMG/M |
3300013296|Ga0157374_12868731 | Not Available | 509 | Open in IMG/M |
3300013307|Ga0157372_10767252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus | 1121 | Open in IMG/M |
3300013307|Ga0157372_13173394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300013308|Ga0157375_10859385 | Not Available | 1053 | Open in IMG/M |
3300013308|Ga0157375_12742072 | Not Available | 589 | Open in IMG/M |
3300014052|Ga0120109_1135323 | Not Available | 576 | Open in IMG/M |
3300014326|Ga0157380_11420171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
3300014655|Ga0181516_10449462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
3300014969|Ga0157376_11377523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
3300014969|Ga0157376_12576167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 548 | Open in IMG/M |
3300015190|Ga0167651_1064454 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300015371|Ga0132258_10278169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia oroxyli | 4106 | Open in IMG/M |
3300015371|Ga0132258_11445572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1737 | Open in IMG/M |
3300015372|Ga0132256_100413228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1452 | Open in IMG/M |
3300015373|Ga0132257_103180757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
3300015373|Ga0132257_103559704 | Not Available | 567 | Open in IMG/M |
3300016445|Ga0182038_12129020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
3300017942|Ga0187808_10583296 | Not Available | 520 | Open in IMG/M |
3300018044|Ga0187890_10381328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
3300018465|Ga0190269_11626795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 540 | Open in IMG/M |
3300018466|Ga0190268_11734579 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300018469|Ga0190270_10300152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1431 | Open in IMG/M |
3300018469|Ga0190270_12224223 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300018469|Ga0190270_13303306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
3300018476|Ga0190274_12085315 | Not Available | 664 | Open in IMG/M |
3300018481|Ga0190271_10495944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1332 | Open in IMG/M |
3300018920|Ga0190273_10096309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus | 1643 | Open in IMG/M |
3300018920|Ga0190273_10643682 | Not Available | 810 | Open in IMG/M |
3300019767|Ga0190267_10326479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
3300020012|Ga0193732_1071366 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300020070|Ga0206356_11419694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
3300021976|Ga0193742_1155678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
3300025862|Ga0209483_1181770 | Not Available | 852 | Open in IMG/M |
3300025912|Ga0207707_10519847 | Not Available | 1014 | Open in IMG/M |
3300025916|Ga0207663_10670050 | Not Available | 820 | Open in IMG/M |
3300025922|Ga0207646_11029337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
3300025929|Ga0207664_10916450 | Not Available | 787 | Open in IMG/M |
3300025961|Ga0207712_10917479 | Not Available | 775 | Open in IMG/M |
3300026041|Ga0207639_10577417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1035 | Open in IMG/M |
3300026088|Ga0207641_11963833 | Not Available | 586 | Open in IMG/M |
3300026118|Ga0207675_100769195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
3300026121|Ga0207683_10633341 | Not Available | 990 | Open in IMG/M |
3300026317|Ga0209154_1293240 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300026552|Ga0209577_10304649 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300027662|Ga0208565_1070867 | Not Available | 1082 | Open in IMG/M |
3300027662|Ga0208565_1202061 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 565 | Open in IMG/M |
3300027824|Ga0209040_10421694 | Not Available | 614 | Open in IMG/M |
3300027869|Ga0209579_10703647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella asiatica | 547 | Open in IMG/M |
3300027880|Ga0209481_10058305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1802 | Open in IMG/M |
3300027895|Ga0209624_10623264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
3300027907|Ga0207428_10840695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
3300027909|Ga0209382_11612123 | Not Available | 641 | Open in IMG/M |
3300028380|Ga0268265_11830005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
3300028381|Ga0268264_11675370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
3300028589|Ga0247818_10675913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 715 | Open in IMG/M |
3300028596|Ga0247821_10283363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus tzadiensis | 1005 | Open in IMG/M |
3300029943|Ga0311340_10794380 | Not Available | 799 | Open in IMG/M |
3300029989|Ga0311365_11534579 | Not Available | 572 | Open in IMG/M |
3300030006|Ga0299907_10563905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
3300030294|Ga0311349_11779653 | Not Available | 569 | Open in IMG/M |
3300030336|Ga0247826_10891438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
3300030783|Ga0102752_1515364 | Not Available | 616 | Open in IMG/M |
3300030902|Ga0308202_1119693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → unclassified Ilumatobacter → Ilumatobacter sp. | 561 | Open in IMG/M |
3300030903|Ga0308206_1026498 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300030903|Ga0308206_1051238 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300030903|Ga0308206_1204802 | Not Available | 502 | Open in IMG/M |
3300030905|Ga0308200_1175664 | Not Available | 510 | Open in IMG/M |
3300030943|Ga0311366_11649743 | Not Available | 548 | Open in IMG/M |
3300030993|Ga0308190_1165756 | Not Available | 536 | Open in IMG/M |
3300031091|Ga0308201_10265837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-64-8 | 597 | Open in IMG/M |
3300031092|Ga0308204_10252077 | Not Available | 572 | Open in IMG/M |
3300031092|Ga0308204_10338563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 514 | Open in IMG/M |
3300031094|Ga0308199_1146218 | Not Available | 559 | Open in IMG/M |
3300031229|Ga0299913_10000360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 27789 | Open in IMG/M |
3300031231|Ga0170824_117441268 | Not Available | 527 | Open in IMG/M |
3300031234|Ga0302325_11602057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
3300031235|Ga0265330_10105979 | Not Available | 1202 | Open in IMG/M |
3300031236|Ga0302324_102176113 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 689 | Open in IMG/M |
3300031507|Ga0307509_10033883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes subtropicus | 5617 | Open in IMG/M |
3300031561|Ga0318528_10245991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 959 | Open in IMG/M |
3300031562|Ga0310886_10353472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
3300031564|Ga0318573_10255918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 934 | Open in IMG/M |
3300031670|Ga0307374_10127546 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
3300031680|Ga0318574_10687239 | Not Available | 600 | Open in IMG/M |
3300031722|Ga0311351_10924575 | Not Available | 667 | Open in IMG/M |
3300031765|Ga0318554_10876175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
3300031793|Ga0318548_10238098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 894 | Open in IMG/M |
3300031799|Ga0318565_10115028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1295 | Open in IMG/M |
3300031835|Ga0318517_10501903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
3300031860|Ga0318495_10324655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 683 | Open in IMG/M |
3300031902|Ga0302322_102314803 | Not Available | 661 | Open in IMG/M |
3300031911|Ga0307412_10442926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → unclassified Sporichthya → Sporichthya sp. | 1068 | Open in IMG/M |
3300031938|Ga0308175_103182825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 509 | Open in IMG/M |
3300031941|Ga0310912_11470148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
3300031954|Ga0306926_11794569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 696 | Open in IMG/M |
3300032002|Ga0307416_100426311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus | 1372 | Open in IMG/M |
3300032004|Ga0307414_12084373 | Not Available | 530 | Open in IMG/M |
3300032063|Ga0318504_10529414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 565 | Open in IMG/M |
3300032065|Ga0318513_10275538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 816 | Open in IMG/M |
3300032089|Ga0318525_10706647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
3300032091|Ga0318577_10531429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
3300032174|Ga0307470_11354538 | Not Available | 585 | Open in IMG/M |
3300032205|Ga0307472_101535398 | Not Available | 652 | Open in IMG/M |
3300032828|Ga0335080_10528474 | Not Available | 1249 | Open in IMG/M |
3300033412|Ga0310810_11095432 | Not Available | 664 | Open in IMG/M |
3300034113|Ga0364937_130076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
3300034126|Ga0370486_187888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
3300034148|Ga0364927_0012999 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
3300034148|Ga0364927_0090457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter fluminis | 842 | Open in IMG/M |
3300034151|Ga0364935_0204346 | Not Available | 636 | Open in IMG/M |
3300034155|Ga0370498_149621 | Not Available | 563 | Open in IMG/M |
3300034281|Ga0370481_0201395 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300034678|Ga0314803_063555 | Not Available | 663 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.24% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.85% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.30% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.30% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.75% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.20% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.20% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.65% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.65% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.65% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.65% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.65% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.65% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.10% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.10% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.10% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.10% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.10% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.10% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.10% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.10% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.55% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.55% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.55% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.55% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.55% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.55% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.55% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.55% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.55% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.55% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.55% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.55% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.55% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.55% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.55% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.55% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010878 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 7) | Environmental | Open in IMG/M |
3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030783 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
3300034126 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4ZMR_00432920 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | EMIHGRFTEDQRKGVFGPEVDVGPNPSAEDKLLAYTGRDPSR |
FE2_01753290 | 2189573003 | Grass Soil | VAYDMIHGRLSDEQRQGVFKPAVAVTPDASPQDRLLAYTGRDPANRGAQN |
JGI10216J12902_1009918131 | 3300000956 | Soil | QDATMPDGLPQAAYEMIHGRFSDEQRKGVFKPELAVASSASAQDKLLAYTGRQPSR* |
JGI10216J12902_1042319252 | 3300000956 | Soil | MPEPLPEAAYEMIHGRFTDDQRKGVFKPVVAVPATASAQDRLLAYTGRRP* |
JGI10216J12902_1056066632 | 3300000956 | Soil | IHGRFTDEQRKGVFKPEVPVAADASAQARLLGYTGRQPG* |
Ga0063454_1000378402 | 3300004081 | Soil | AYEQIHGRFTDEQRQGIFKPEIQVGADATPQERLLAYTGRTP* |
Ga0063454_1020665022 | 3300004081 | Soil | TMPDGLAGAAYDAIHGRFTDEQRPGIFKPEISVGDDAGPQERLLAYTGRRPS* |
Ga0063356_1028803363 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IHGRFTDEQRTGVFKPEIPVGDDATPQQRLLAYTGREPG* |
Ga0063356_1051406062 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DLAEAAYETIHGRFTDEQRKGVFKPEVKVGDDASPQDRLLAYTGRDPNR* |
Ga0063356_1061536551 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PDGLAAAAYEAIHGRFTDEQRKGVFDPEIPITETASAQDKLLAYTGRDPSLPS* |
Ga0062595_1013584892 | 3300004479 | Soil | NGRLTDEQRKGAFKPELPVPRDASAQDKLLAYTGRNPSK* |
Ga0062595_1024161941 | 3300004479 | Soil | HKIIHGRFTDEERKGIFGPEITVPTNASAQDTLLAYTGRNPSR* |
Ga0062591_1029411642 | 3300004643 | Soil | IIHGKFTDEQRKGLFKPEVSVAPTASAQDRLLAYTGRDPSR* |
Ga0068869_1012323052 | 3300005334 | Miscanthus Rhizosphere | IHGRFTDEERKGIFGPEITVPTNASAQDTLLAYTGRNPSR* |
Ga0070668_1020799411 | 3300005347 | Switchgrass Rhizosphere | KGLPEAAYEMIHGRFTDDQRKGVFKPEIDVPADAPAQDKLLAYTGRTPS* |
Ga0070714_1018003642 | 3300005435 | Agricultural Soil | QDDTMPDGLAQAAYDVIHGRFTDDQRKGVFKPELPVSDDATPQQRLLAYTGRNPG* |
Ga0070663_1012218472 | 3300005455 | Corn Rhizosphere | HGLPEAAYKIIHGRFTDDERKGIFGPEITVPTNASAQDTLLAYTGRDPSR* |
Ga0070707_1021851262 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAGLAKAAYEMIHGRFTDEQRKGLFKPEIAVGKDATPQEKLLAYTGRAA* |
Ga0070698_1013917832 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSGLAEAAYKTIYGRFTDEQRNGMFKPEISVADDASPQERLLAYAGGEPR* |
Ga0070733_110940882 | 3300005541 | Surface Soil | DAAYGMIHGRFTDEQRKGVFKPEISVGPDASAQEKLLAYTGRDPAGGG* |
Ga0070693_1004017421 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | QDATMPDGLADAAYEIVHGRFTDEERKGVFGPEVVISKGVSAQDRLLAYTGRNPSR* |
Ga0066703_103086502 | 3300005568 | Soil | MPDGLAQAAYDVIHGRFTDEQRKGVFKPEITVGDDATPQQRLLAYTGRNPS* |
Ga0068854_1010790911 | 3300005578 | Corn Rhizosphere | HGKFTDEQRKGVFKPEIKVPDDASPQDRLLAYTGRQP* |
Ga0070702_1002131131 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VHGRFTDEERKGVFGPEVATSKGASAQDRLLAYTGRNPSR* |
Ga0068863_1020276072 | 3300005841 | Switchgrass Rhizosphere | TDEQRKGVFKPEIAVPADASPQDRLLAYTGRSPST* |
Ga0081455_106884591 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LPDAAYAMIHGRFTDDQRQGVFKPEVHLSAGASMQDQLLAYTGRDPR* |
Ga0081539_101313563 | 3300005985 | Tabebuia Heterophylla Rhizosphere | TMPEGLAEAAYNTIHGRFSEEQRKGVFKPEVPVPADATPQERLLSYTGRQSD* |
Ga0066651_103779752 | 3300006031 | Soil | PAGLPESAYDIVYGRFTDEQRPGVFKPEIAVPADASAQEKLLAYTGRSPST* |
Ga0075363_1003628051 | 3300006048 | Populus Endosphere | AYNMIHGKFTDDQRKGTFKPEVPVGPDASAQDKLLAYTGRNPSG* |
Ga0075370_103202511 | 3300006353 | Populus Endosphere | FTDDQRKGTFKPEVPVGPDASAQDKLLAYTGRNPSG* |
Ga0079222_111662972 | 3300006755 | Agricultural Soil | MPDGLAEAAYETIHGRFTDEQRKGVFGPEIPVDDDAPAQARLLAYSGRDPASPD* |
Ga0079221_115913461 | 3300006804 | Agricultural Soil | DAAYRTIHGKFTEEQRVGVFGPEIPVPDTASAQARLLAFSGRDPSGAG* |
Ga0075428_1004658042 | 3300006844 | Populus Rhizosphere | TDEQRKGMFKPEVPIGDDASPQDRLLAYTGRDPR* |
Ga0075421_1010681833 | 3300006845 | Populus Rhizosphere | AYDMIHGRFTDEQRKGTFKPEIAVPQDATAQDKLLAYTGRPPND* |
Ga0075425_1004116733 | 3300006854 | Populus Rhizosphere | FTDEQRKGVFKPEIKVPADASPQEKLLAYTGRPPSS* |
Ga0075434_1020442822 | 3300006871 | Populus Rhizosphere | AYETIHGKFTDEQRKGLFKPEVRVPDDAPPQDKLLAYTGRKP* |
Ga0079217_109184291 | 3300006876 | Agricultural Soil | GLAEAAYQTIHGKFTEDQRKGVFKPEVKVGDDASAQDKLLAYTGRDPNA* |
Ga0073928_108171462 | 3300006893 | Iron-Sulfur Acid Spring | MPEGLPDAAYSFIHGRFTEDQRKGVFKPEVAVAPGASAQDKLLAYTGRDPSSAI* |
Ga0075424_1015891373 | 3300006904 | Populus Rhizosphere | AAFKMIDGRLTDDQRGTMFKPALPVPDSASAQDKLLGYGGRTP* |
Ga0111539_115860281 | 3300009094 | Populus Rhizosphere | PEAAYEMIHGRFTDDQRKGVFKPEIDVPADAPAQDKLLAYTGRTPS* |
Ga0111539_130381072 | 3300009094 | Populus Rhizosphere | GQDATMPDGLAAAAYEMVHGAFSDEQRKGVFKPEVAVSDDASPQEKFLAYTGRDPG* |
Ga0066709_1000550841 | 3300009137 | Grasslands Soil | QDATMPRGLPEAAFEFIHGRFTDDQRKGVFKPEVKVAKNASPQDKLLAYTGRDPSQ* |
Ga0116221_10455892 | 3300009523 | Peatlands Soil | MPKELPEAAYNMIHGRFSDQQRTGVFKPEITVAPDSSFQERLLAYTGRDPAL* |
Ga0116225_11256101 | 3300009524 | Peatlands Soil | MPKELPEAAYNMIHGRFSDQQRSGVFKPEITVAPDSSFQERLLAYTGRDPAL* |
Ga0116220_105703611 | 3300009525 | Peatlands Soil | TMPDGLPPVAYQMIHGRFTDEQRVGVFKAAVAVLPGASPQDCLLAYTGRDPS* |
Ga0116215_10876683 | 3300009672 | Peatlands Soil | PKELPEAAYNMIHGRFSDQQRSGVFKPEITVAPDSSFQERLLAYTGRDPAL* |
Ga0126305_102931333 | 3300010036 | Serpentine Soil | FTDEQRKGVFGPEIAVDDDATPQQRLLAYTGRDPD* |
Ga0126310_115442371 | 3300010044 | Serpentine Soil | AFTDDQRTGVFKPEIEVGDDASAQEKLLAYTGREPS* |
Ga0127503_102738321 | 3300010154 | Soil | QDATMPDGLAEASYDMIHGRFTDDQRKGVFKPEVAVASNASAQDRLLSYTGRDPSE* |
Ga0126378_124122321 | 3300010361 | Tropical Forest Soil | MPDGLALAAYETIHGRFTEAQRVGVFKPEIEVPDDASPQAKLLAYTGRDPSPQ* |
Ga0134124_124556112 | 3300010397 | Terrestrial Soil | EAAYEMIHGRFTEEQRKGVFKPEIKVPADASAQDKLLAYTGRRA* |
Ga0136899_101304682 | 3300010878 | Soil | FTDEQRKGVFKPEVTVGPEATAQDRLLAYTGRDPAG* |
Ga0136623_103417521 | 3300012045 | Polar Desert Sand | PAAAYEAIHGRFTDEQRKGVFKPEVDVPRNASAQDRLLAYTGRDPASGY* |
Ga0137365_108942632 | 3300012201 | Vadose Zone Soil | ATMPAGLPDVAYEMINGRLTDDQRQGAFKPEIATGPDATAQEKLLAYTGRDPSR* |
Ga0150985_1121329161 | 3300012212 | Avena Fatua Rhizosphere | AYGVIHGRFTDEQRKGVFKPEIPVGDDASPQQRLLAYTGRDPS* |
Ga0150985_1149930161 | 3300012212 | Avena Fatua Rhizosphere | PEDLAEAAYDAIHGRFTDDQRKGVFKPEVTVDGDASPQDRLLAYSGRDPAA* |
Ga0137386_110727151 | 3300012351 | Vadose Zone Soil | AQATGQDATMPDGLAQAAYTTIHGRFTDEQRKGLFAPEVPVAGDATPQQRLLAYTGRTPD |
Ga0134042_10572722 | 3300012373 | Grasslands Soil | MIHGRFTDEQRKGLFKPEVTVGPNASAQDKLLAYTGRDPSV* |
Ga0150984_1088155481 | 3300012469 | Avena Fatua Rhizosphere | TGQDTTMPDGLAEAAYTTIHGRFTDEQRKGTFKPELPVGEDATPQQRLLAYTGRNPK* |
Ga0150984_1120247931 | 3300012469 | Avena Fatua Rhizosphere | MPDGLAAAAYGVVHGRFTDEQRKGVFKPEVTVGDDAPPQQRLLAYTGRDPS* |
Ga0150984_1225174171 | 3300012469 | Avena Fatua Rhizosphere | KLTDDQRKTSFKPEVEVGAAASMQDRFLAYSGRNPNQ* |
Ga0157343_10421381 | 3300012488 | Arabidopsis Rhizosphere | GAFTDDQRQGVFAPELPAPPDATAQQKLLAYTGRDPG* |
Ga0137398_110819311 | 3300012683 | Vadose Zone Soil | AAYQMINGRFTDDQREGVFKPEVHLVRDASAQDKLHAYNGRDPSA* |
Ga0137413_114830572 | 3300012924 | Vadose Zone Soil | YELIHGRFTEEQRKGVFKPEVAVASNASAQDKLLAYTGRDPR* |
Ga0164299_116920001 | 3300012958 | Soil | GQDTTMPDGLAAAAYEMVHGAFTDDQRKGVFKPEIQVGDDASPQEKFLAYTGRDPS* |
Ga0164301_103070591 | 3300012960 | Soil | KATAQDATMPAGLPEAAYEIIHGRFTEDQRKGVFKPEVDVEPEASPQDRLLAYTGRDPSS |
Ga0164302_110456302 | 3300012961 | Soil | AAYEIIHGRFTEDQRKGVFKPEVDVEPAASPQDRLLAYTGRDPSS* |
Ga0164307_105010302 | 3300012987 | Soil | IYGRFTDDQRKGVFGPEVAVSADASAQDKLLAYTGRNPSR* |
Ga0157370_114791461 | 3300013104 | Corn Rhizosphere | ATGADDTMPEGLAQAAYDVIHGRFTDDQRKGVFKPEVPLGADATAQQRLLAYAGRDPG* |
Ga0157374_128687311 | 3300013296 | Miscanthus Rhizosphere | TGQDATMPDGLAEAAYEALHGRFTDEQRKGTFQPEVPIGADASAQDRLLAYAGRNPSD* |
Ga0157372_107672521 | 3300013307 | Corn Rhizosphere | GRFTDDQRTGVFKPEVPVGDDATPQQRLLAYTGRNPS* |
Ga0157372_131733942 | 3300013307 | Corn Rhizosphere | ARAAGQDDTMPKGLPEAAYELIHGKFTDEQRKGLFKPEVSVGPDASAQDRLLAYTGRNPS |
Ga0157375_108593852 | 3300013308 | Miscanthus Rhizosphere | HGAFTDEQRKGVFKPEIQVGDDASPQEKFLAYTGRDPS* |
Ga0157375_127420721 | 3300013308 | Miscanthus Rhizosphere | AAYEMIHGRFTDEQRKGVFKPEIAVPADASPQDRLLAYTGRSPST* |
Ga0120109_11353232 | 3300014052 | Permafrost | AKATAQDATMPEGLPEAAFEMIHGRFTDDQRKGVFKPEVAVSSSASAQDRLLAYTGRDPSG* |
Ga0157380_114201712 | 3300014326 | Switchgrass Rhizosphere | MPDGLADAAYEIVHGRFTDEERKGVFGPEVVISKGVSAQDRLLAYTGRNPSR* |
Ga0181516_104494621 | 3300014655 | Bog | QDPTLPEGLAEAAFSMIYGRFTDEQRQGLFKPALSVDDAARAQDKLLAYTGRDPRRAT* |
Ga0157376_113775232 | 3300014969 | Miscanthus Rhizosphere | FEMIHGRFTDEQRKGVFKPEIQVPDDAPAQDRLLAYTGRAPSS* |
Ga0157376_125761672 | 3300014969 | Miscanthus Rhizosphere | PDGLAKAAYNVIHGRFSDEQRKGVFKPEIQVGDDATPQQRLLAYTGRDPN* |
Ga0167651_10644543 | 3300015190 | Glacier Forefield Soil | TEEQRKGVFKPEIEVGSDASAQDRLLAYSGRDPQGV* |
Ga0132258_102781691 | 3300015371 | Arabidopsis Rhizosphere | TAQDATMPSGLAEAAYEMIYGRFTDEQRPGVFKPEVAVASDASVQDKLLAYTGRDPSS* |
Ga0132258_114455723 | 3300015371 | Arabidopsis Rhizosphere | AKATRQDTTMPKGLPEAAYEMIHGRFTDEQRKGVFKPEVPVAADASAQDKLLAYTGRDPRS* |
Ga0132256_1004132281 | 3300015372 | Arabidopsis Rhizosphere | QDAEMPDGLAEAAYRTIHGSFTDDQRQGVFGPEIPVDSSASFQEKLLAYSGRDPSR* |
Ga0132257_1031807572 | 3300015373 | Arabidopsis Rhizosphere | SLMRGVAAAPEGLADAAYNAVHGRFTDEQRKGMFKPEIAVPDDAPAQDRLLAYLGRSPS* |
Ga0132257_1035597041 | 3300015373 | Arabidopsis Rhizosphere | FTEEQRKGVFKPEVAVAADASPQDKLLAYTGRTPAA* |
Ga0182038_121290201 | 3300016445 | Soil | YDVIHGRFTDEQRKGIFKPEVPVDADATPQHRLLAYTGRRPD |
Ga0187808_105832961 | 3300017942 | Freshwater Sediment | EMIHGRFTDEQRQGVFKPEIRVAPDSSAQERLLAYTGRDPAQGI |
Ga0187890_103813282 | 3300018044 | Peatland | WVDAGLAEAAYETIHGRFSDEQRQGVFKPAVAVADDASPQGRLLAYTGRRPG |
Ga0190269_116267951 | 3300018465 | Soil | YEMIHGRFTDEQRKGVFKPGVQVGADASPQDRLLAYTGRTPA |
Ga0190268_117345791 | 3300018466 | Soil | GLPDAAYSMIHGRFTDEQRKGVFKPEISVAPTASPQEKLLAYTGRSP |
Ga0190270_103001521 | 3300018469 | Soil | TGQDTTMPDGLAEEVYGMLHGRFTDDERKGVFKPELKVGADASPQERLLAYTGRDPSA |
Ga0190270_122242231 | 3300018469 | Soil | KQDATMPEGLAQAAYDHIHGRFTDEQRRGVFEPEIPVGDDATPQERLLAYTGRDDRGN |
Ga0190270_133033061 | 3300018469 | Soil | IHGRFTDEQRKGVFAPVIAVGDDATPQQRLLGYTGRTTASSDSRSDPGVR |
Ga0190274_120853151 | 3300018476 | Soil | PEAAYQQIHGRFTEEERQGVFKPEIAVPPDASPQQRLLAYTGRATPA |
Ga0190271_104959443 | 3300018481 | Soil | GLAEAAYDTIHGRFTDEQREGTFGPELPVDADASPQERLLAYTGRQPS |
Ga0190273_100963091 | 3300018920 | Soil | CIHGRFTDEQRKGVFGPEIPVGDDATPQQRLLAYTGRDPL |
Ga0190273_106436822 | 3300018920 | Soil | GLPQAAYEVIHGRFTDEQRKGVFKPEIPVGDDATPQQRLLAYTGRAPE |
Ga0190267_103264792 | 3300019767 | Soil | DGLAEAAYECIHGRFSDEERKGVFGPEVRVGDDAAPQERLLAYTGRTPA |
Ga0193732_10713662 | 3300020012 | Soil | FTDDQRKGVFKPEVAVASTASAQDKLLAYTGRDPSR |
Ga0206356_114196941 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHGKFTDEQRKGVFKPEIKVPDDASPQDRLLAYTGRQP |
Ga0193742_11556782 | 3300021976 | Soil | FDMIYGRFTDDQRKGVFKPEVTVATTASAQDKLLAYTGRDPSR |
Ga0209483_11817702 | 3300025862 | Arctic Peat Soil | YDMIHGRFSDEQRQGVFKPAVKVAPDASAQDKLLAYTGRDPAS |
Ga0207707_105198473 | 3300025912 | Corn Rhizosphere | DTIHGKFTDEQRQGLFKPEIEVADGASPQEQLLAYTGRAS |
Ga0207663_106700502 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PAGLPESAYEIIYGRFTDEQRPAVFKPEIAVPADASAQEKLLAYTGRSPST |
Ga0207646_110293372 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YKTIYGRFTDEQRNGMFKPEISVADDASPQERLLAYAGGEPR |
Ga0207664_109164503 | 3300025929 | Agricultural Soil | AAYDVIHGRFTDDQRKGVFKPELPVGDDATPQQRLLAYTGRNPG |
Ga0207712_109174791 | 3300025961 | Switchgrass Rhizosphere | ATGQDATMPSGLPEAAYQIIHGKFTDEQRKGLFKPEVSVAPTASAQDRLLAYTGRDPSR |
Ga0207639_105774172 | 3300026041 | Corn Rhizosphere | TGLPEAAFEMIHGRFTDEQRKGVFKPEIQVPDDAPAQDRLLAYTGRAPS |
Ga0207641_119638331 | 3300026088 | Switchgrass Rhizosphere | TDEQRKGVFKPEIAVPADASPQDRLLAYTGRSPST |
Ga0207675_1007691951 | 3300026118 | Switchgrass Rhizosphere | HGKFTDEQRKGVFKPEVKVADDASAQDKLLAYTGRDPSA |
Ga0207683_106333412 | 3300026121 | Miscanthus Rhizosphere | MPSGLAEAAYESIHGKFTDEQRKGLFKPEIAVDATASPQEKLLAYTGRDPRA |
Ga0209154_12932403 | 3300026317 | Soil | TDDQRKGVFKPEVKVAPDATAQDRLLAYTGRDPSQ |
Ga0209577_103046494 | 3300026552 | Soil | PQAAFDMIHGRFTDDQRKGVFKPEVKVAPDATAQDRLLAYTGRDPSQ |
Ga0208565_10708672 | 3300027662 | Peatlands Soil | PKELPEAAYNMIHGRFSDQQRSGVFKPEITVAPDSSFQERLLAYTGRDPAL |
Ga0208565_12020612 | 3300027662 | Peatlands Soil | DDQRTGVFKPEIAVATDASAQDRLLAYTGRDPSPTA |
Ga0209040_104216941 | 3300027824 | Bog Forest Soil | GRFTDEQRQGVFKPEIRVAPDSSAQERLLAYTGRDPAQGI |
Ga0209579_107036472 | 3300027869 | Surface Soil | KGLPEAAYDIIHGRFTEEQRQGVFNPEVAVPPNASAQDKLLAYTGRDPSTTMPRGG |
Ga0209481_100583053 | 3300027880 | Populus Rhizosphere | MIHGRFTEEQRKGVFKPEIAVPPTASAQDRLLAYTGRDPLTA |
Ga0209624_106232641 | 3300027895 | Forest Soil | MPECLPEAAYAMIHGRFTDDQRQGVFKPEVAIGPNSSPQAKLLAYTGRDPSEGAWV |
Ga0207428_108406951 | 3300027907 | Populus Rhizosphere | MPDGLAAAAYESVHGKFTDEQRKGMFKPEVPIGDDASPQDRLLAYTGRDPR |
Ga0209382_116121231 | 3300027909 | Populus Rhizosphere | TMPDGLAAAAYEMVHGKFTDEQRKGIFKPEVPISDDASPQDRLLAYTGRDPR |
Ga0268265_118300051 | 3300028380 | Switchgrass Rhizosphere | PTGLPEAAFEMIHGRFTDEQRKGVFKPEIQVPDDAPAQDRLLAYTGRAPSS |
Ga0268264_116753702 | 3300028381 | Switchgrass Rhizosphere | GAFTDDQRAGVFGPEIAIASDASAQAQLLAYTGRDPRT |
Ga0247818_106759132 | 3300028589 | Soil | GQDTTMPDGLAEEVYGMIHGRFTEDERKGVFKPAVKVGADASPQERLLAYTGRDPSA |
Ga0247821_102833631 | 3300028596 | Soil | ATKQDATMPDGLAQAAYEHIHGRFTDEQRQGVFGPEIPVGDDVTPQQRLLAYTGRGG |
Ga0311340_107943802 | 3300029943 | Palsa | STMPDGLPDAAYSLIHGRFTEEQRKGIFKPEVPVGPDASAQDRLLAYTGRDPSPSA |
Ga0311365_115345791 | 3300029989 | Fen | AEDAYRSIHGLFTDEQRVGIFKPELPVGIDATAQERLLAYPGRPPG |
Ga0299907_105639052 | 3300030006 | Soil | MPDGLPEAAFEMIHGRFTGEQRKGVFEPEVKVADNASPQDKLLAYTGRDPN |
Ga0311349_117796531 | 3300030294 | Fen | AYRSIFGMFTDVQRVGVFKPALPVGDDATAQERLLAYTGRPA |
Ga0247826_108914382 | 3300030336 | Soil | ASAAYDSIHGLFTDEQRKGVFGPEIAVGEGATPQQRLLAYTGRDPD |
Ga0102752_15153641 | 3300030783 | Soil | AMPEGLPEAAYEMIHGRFTDEQRRNVFKPEVAVGPNASAQEKLLAYTGRDPSV |
Ga0308202_11196932 | 3300030902 | Soil | QDATMPDGLPDAAYQLIHGRFDEQRKGMFKPEVKVAEDASPQDKLLAYAGRKPAR |
Ga0308206_10264981 | 3300030903 | Soil | AAYGMIHGRFTEEQRKGVFKPEVAVPAGASAQDRLLAYTGRRPG |
Ga0308206_10512383 | 3300030903 | Soil | IHGRFTDEQRKGIFKSEVAVAPDASAQDKLLAYTGRDPSA |
Ga0308206_12048021 | 3300030903 | Soil | GRFSEEQRNGVFKPEVTVSANASPQARLLAYTGRQPE |
Ga0308200_11756642 | 3300030905 | Soil | LAQATGQDTEMPDGLADAAFDMINGRLTDDQRNGMFKPAVAVGSDASMQDQFLAYAGRNP |
Ga0311366_116497432 | 3300030943 | Fen | TMPDGLAEEAYRSIFGMFTDVQRVGVFKPALPVGDDATAQERLLAYTGRPA |
Ga0308190_11657561 | 3300030993 | Soil | RFTEDQRKGVFGPEIPVGDDATPQQRLLAYTGRDPD |
Ga0308201_102658371 | 3300031091 | Soil | QDSTMPDGLAEKAYNAIHGMFTEEQRKGVFKPELPVSDDAPGQERLLAYTGRTPD |
Ga0308204_102520771 | 3300031092 | Soil | DGLADAAYKMIHGKFTDDQRKGMFKPEVPVGPDASAQDKLLAYTGRTPSG |
Ga0308204_103385632 | 3300031092 | Soil | FTDEQRKGLFKPEVEIPSGSSAQDKLLAYTGRDPSS |
Ga0308199_11462183 | 3300031094 | Soil | YECIHGRFTEDQRKGVFGPEIPVGDDATPQQRLLAYTGRDPD |
Ga0299913_1000036012 | 3300031229 | Soil | MIHGRFTGEQRKGVFEPEVKVADNASPQDKLLAYTGRDPN |
Ga0170824_1174412681 | 3300031231 | Forest Soil | IHGRFTDEQRRGLFAPEVPVADDATPQQQLLAYTGRTPD |
Ga0302325_116020571 | 3300031234 | Palsa | TMPVGLPEAAYTIIHGRFSDDQRRGVFKPEVAVAPDSSSQDKLLGYSGRDPVSMT |
Ga0265330_101059791 | 3300031235 | Rhizosphere | YDVIHGRFTDEQRKGMFKPEVPLDGDSTPQQRLLAYTGRAPS |
Ga0302324_1021761131 | 3300031236 | Palsa | DGLPDAAYSLIHGRFTEEQRKGIFKPEMPVGPNASAQERLLAYTGRDPSPPV |
Ga0307509_100338837 | 3300031507 | Ectomycorrhiza | MPPGLAEAAHKIIHGRFTDEERKGIFGPEITVPTSASAQDTLLAYTGRNPSG |
Ga0318528_102459912 | 3300031561 | Soil | QDATMPDGLPEAAYGMIHGRFTDEQRKGVFKPEVVVGTDASPQEKLLAYTGRDPSMKG |
Ga0310886_103534721 | 3300031562 | Soil | GLPEAAYELIHGQFTDEQRKGVFKSEVPVPADAPAQDKLLAYTGRDPRA |
Ga0318573_102559181 | 3300031564 | Soil | GMIHGRFTEDQRRGVFKPAVAVADDASPQDRFLAYTGRDPAVEK |
Ga0307374_101275461 | 3300031670 | Soil | FPDEQRKGLFAPEARVADDAPPQQRLLAYTGRTPE |
Ga0318574_106872391 | 3300031680 | Soil | RAAYGMIYGRFTDDQRRGVFKPAVAVADDASPQDKFLAYTGRDPAW |
Ga0311351_109245752 | 3300031722 | Fen | PDGLAEDAYRSIHGLFTEEQRVGIFKPELPVGIDATAQERLLAYTGRPPG |
Ga0318554_108761752 | 3300031765 | Soil | GLPDAAYRAIHGRFTDEQRVGVFKPEVPVPPDAPPQEKLLAYTGRDPFG |
Ga0318548_102380983 | 3300031793 | Soil | EDQRRGVFKPAVAVADDASPQDRFLAYTGRDPAVEK |
Ga0318565_101150283 | 3300031799 | Soil | LAEAAYGMIHGRFTEDQRRGVFKPAVAVADDASPQDRFLAYTGRDPAVEK |
Ga0318517_105019031 | 3300031835 | Soil | HGRFTEDQRRGVFKPAVAVADDASPQDRFLAYTGRDPAVEK |
Ga0318495_103246552 | 3300031860 | Soil | GQDATMPAGLAEAAYGMIHGRFTEDQRRGVFKPAVAVADDASPQDRFLAYTGRDPAVEK |
Ga0302322_1023148032 | 3300031902 | Fen | DATMPAGLPERAYEMIFGAFTDDQRKGVFKPEVAVAADGPAQDRLLAYAGRDPDTVIS |
Ga0307412_104429262 | 3300031911 | Rhizosphere | LADAAYDLVHGKFTEEQRVGVFKPERPIADDASPQARLLAYTGREP |
Ga0308175_1031828252 | 3300031938 | Soil | MPAGTADAAYQVIHGRFTDEQRQGVFKPEVPVDDDATPQQRLLAYTGRDPA |
Ga0310912_114701481 | 3300031941 | Soil | AYDTIHGRFTDDQRKGVFKPEVDVGAEASAQERLLAYTGRDPTVG |
Ga0306926_117945692 | 3300031954 | Soil | GMIHGRFTDEQRNGVFKPEVVVGTDASPQEKLLAYTGRDPSMKG |
Ga0307416_1004263113 | 3300032002 | Rhizosphere | VVAHDAVLYDCIHGLFTEEQRKGVFGPEIPVGDDVTPQQRLLAYTGRDPD |
Ga0307414_120843731 | 3300032004 | Rhizosphere | GRFTEEQRHGVFKPEVEVPDGASPQERLLAYTGRAPE |
Ga0318504_105294142 | 3300032063 | Soil | AAYGMIHGRFTDEQRKGVFKPEVVVGTDASPQEKLLAYTGRDPSMKG |
Ga0318513_102755381 | 3300032065 | Soil | GLPEAAYGMIHGRFTDEQRNGVFKPEVVVGTDASPQEKLLAYTGRDPSMKG |
Ga0318525_107066471 | 3300032089 | Soil | DQMPEGLPQAAYDVIHGRFTDEQRKGIFKPEVPVDADATPQQRLLAYTGRRPD |
Ga0318577_105314292 | 3300032091 | Soil | TMPTGLAEAAYGMIHGRFTEDQRRGVFKPAVAVADDASPQDRFLAYTGRDPAVEK |
Ga0307470_113545382 | 3300032174 | Hardwood Forest Soil | AAAYELIHGMYTDDQRMGLFKPVVQLGGDASAQDRLLAYTGRNPA |
Ga0307472_1015353981 | 3300032205 | Hardwood Forest Soil | GQDATMPDGLAQAAYDTVYGRFTEEQRKGVFKPEIPIGSDASPQQRLLAYTGRQPA |
Ga0335080_105284741 | 3300032828 | Soil | IHGRFTDEERKGVFKPERAVGEGASPQEKLLAYTGRPPST |
Ga0310810_110954321 | 3300033412 | Soil | KLTDDQRKGSFKPEVQIDADASAQDKLLAYSGRKP |
Ga0364937_130076_356_514 | 3300034113 | Sediment | MPAGLPEAAYEMIHGRFTDDQRKGVFKPEVTVADDASAQDKLLAYTGRDPTG |
Ga0370486_187888_391_513 | 3300034126 | Untreated Peat Soil | LSHGRFTDDQRKGIFKPEITVPADASPQDKLLAYTGRQTN |
Ga0364927_0012999_3_122 | 3300034148 | Sediment | HGRLPDEQRKGAFKPEVAVSPDASAQDQLLGYTGRNPSG |
Ga0364927_0090457_719_841 | 3300034148 | Sediment | IHGQFTDEQRKGVFKPEMKVGDEASAQDKLLAYTGRDPKA |
Ga0364935_0204346_504_635 | 3300034151 | Sediment | YETIHGQFTDEQRKGVFKPEIEVGADASAQDKLLAYTGRDPKA |
Ga0370498_149621_406_558 | 3300034155 | Untreated Peat Soil | MPAGLPEAAYDMIHGRFTDEQRKGIFKPEVTVAANASAQERLLAYTGRKS |
Ga0370481_0201395_2_139 | 3300034281 | Untreated Peat Soil | DAAYELIHGRFTDDERKGIFKPEVTVPADASPQEKLLAYTGRPTN |
Ga0314803_063555_3_161 | 3300034678 | Soil | TTPDGLAEAAYDCIRDRFTEELRKGVFGPETPVGDDATPQQRLLAYTGRDPD |
⦗Top⦘ |